[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:ACD31006.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2gfpA.bssp"

## Summary of PDB Search
:509
    7e-06  21%  2gfpA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN D
:509

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTIVAVAIPQIMGAIGANVETIADVTTVYIVTAAIFI
2gfpA           ----------------------------------TIYIPAIADMARDLNVREGAVQSVMGAYLLTYGVSQ


                         .         .         *         .         .         .         .:140
query           LLSGLIIEKYGIKRVALVSSVIFGISSIMCGLSTSLAEMIVFRAFQGMGGAFLPSVAQTYISTSFKNEEY
2gfpA           LFYGPISDRVGRRPVILVGMSIFMXXXXXXXXXXXXXXXIAASAMQXXXXXXXXXXARTLPRDLYERTQL


                         +         .         .         .         .         *         .:210
query           NKMMTIYSMVIVMGPIIGPVLGGAICENMSWEWIFYVNVPLCIVAFIIIAFMMEATQIxxxxxxxxxxxx
2gfpA           RHANSLLNMGILVSPLLAPLIGGLLDTMWNWRACYLFLLVLCAVTFSMARWMPETRPV------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2gfpA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2gfpA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2gfpA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2gfpA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxx
2gfpA           -------------------