[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:hslU

[Show Plain Result]

#ERROR : Can't open dsspfile "1do0A.bssp"
#ERROR : Can't open dsspfile "1yyfA.bssp"
#ERROR : Can't open dsspfile "1e94E.bssp"
#ERROR : Can't open dsspfile "1do2A.bssp"
#ERROR : Can't open dsspfile "1dooE.bssp"
#ERROR : Can't open dsspfile "1g41A.bssp"
#ERROR : Can't open dsspfile "1g3iU.bssp"
#ERROR : Can't open dsspfile "1g3iX.bssp"
#ERROR : Can't open dsspfile "1g3iA.bssp"
#ERROR : Can't open dsspfile "1g3iS.bssp"
#ERROR : Can't open dsspfile "1g4aE.bssp"
#ERROR : Can't open dsspfile "1kyiA.bssp"
#ERROR : Can't open dsspfile "1g3iW.bssp"
#ERROR : Can't open dsspfile "1g3iV.bssp"
#ERROR : Can't open dsspfile "1g3iT.bssp"
#ERROR : Can't open dsspfile "1g3iE.bssp"
#ERROR : Can't open dsspfile "1g3iC.bssp"
#ERROR : Can't open dsspfile "1g3iD.bssp"
#ERROR : Can't open dsspfile "1g3iF.bssp"
#ERROR : Can't open dsspfile "1ofhA.bssp"
#ERROR : Can't open dsspfile "1ofiC.bssp"
#ERROR : Can't open dsspfile "1ofiA.bssp"
#ERROR : Can't open dsspfile "1ofiB.bssp"
#ERROR : Can't open dsspfile "1im2A.bssp"
#ERROR : Can't open dsspfile "1um8A.bssp"
#ERROR : Can't open dsspfile "2r62A.bssp"
#ERROR : Can't open dsspfile "1lv7A.bssp"
#ERROR : Can't open dsspfile "2ce7F.bssp"
#ERROR : Can't open dsspfile "2ce7E.bssp"
#ERROR : Can't open dsspfile "2ce7D.bssp"
#ERROR : Can't open dsspfile "2ce7C.bssp"
#ERROR : Can't open dsspfile "2ce7B.bssp"
#ERROR : Can't open dsspfile "2ce7A.bssp"
#ERROR : Can't open dsspfile "3b9pA.bssp"
#ERROR : Can't open dsspfile "1r6bX.bssp"
#ERROR : Can't open dsspfile "2qz4A.bssp"
#ERROR : Can't open dsspfile "1ksfX.bssp"
#ERROR : Can't open dsspfile "3h4mA.bssp"
#ERROR : Can't open dsspfile "3d8bB.bssp"
#ERROR : Can't open dsspfile "3d8bA.bssp"
#ERROR : Can't open dsspfile "1yqiC.bssp"
#ERROR : Can't open dsspfile "1yqiB.bssp"
#ERROR : Can't open dsspfile "1yqiA.bssp"
#ERROR : Can't open dsspfile "1qvrA.bssp"
#ERROR : Can't open dsspfile "1r7rA.bssp"
#ERROR : Can't open dsspfile "1g3iS.bssp"
#ERROR : Can't open dsspfile "1g4aE.bssp"
#ERROR : Can't open dsspfile "1g3iW.bssp"
#ERROR : Can't open dsspfile "1g3iV.bssp"
#ERROR : Can't open dsspfile "1g3iE.bssp"
#ERROR : Can't open dsspfile "1g3iC.bssp"
#ERROR : Can't open dsspfile "1g3iF.bssp"
#ERROR : Can't open dsspfile "1ofhA.bssp"
#ERROR : Can't open dsspfile "1ofiC.bssp"
#ERROR : Can't open dsspfile "1ofiA.bssp"
#ERROR : Can't open dsspfile "1ofiB.bssp"
#ERROR : Can't open dsspfile "1im2A.bssp"
#ERROR : Can't open dsspfile "1um8A.bssp"

## Summary of PDB Search
:455
    e-140  65%  1do0A  [c.37.1] PROTEIN (HEAT SHOCK LOCUS U)
    e-140  65%  1yyfA  [x.x.x] ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT
    e-140  65%  1e94E  [c.37.1] HEAT SHOCK PROTEIN HSLU
    e-140  65%  1do2A  [c.37.1] PROTEIN (HEAT SHOCK LOCUS U)
    e-134  65%  1dooE  [c.37.1 (1g4bE)] HEAT SHOCK LOCUS U
    4e-84  72%  1g41A  [c.37.1] HEAT SHOCK PROTEIN HSLU
    8e-83  72%  1g3iU  [c.37.1] ATP-DEPENDENT HSLU PROTEASE ATP-BINDING SUBUNIT
    1e-82  72%  1g3iX  [c.37.1] ATP-DEPENDENT HSLU PROTEASE ATP-BINDING SUBUNIT
    4e-82  73%  1g3iA  [c.37.1] ATP-DEPENDENT HSLU PROTEASE ATP-BINDING SUBUNIT
    3e-81  60%  1g3iS  [c.37.1] ATP-DEPENDENT HSLU PROTEASE ATP-BINDING SUBUNIT
    6e-81  66%  1g4aE  [c.37.1] ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT
    1e-80  72%  1kyiA  [c.37.1] ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT
    1e-80  60%  1g3iW  [c.37.1] ATP-DEPENDENT HSLU PROTEASE ATP-BINDING SUBUNIT
    3e-80  59%  1g3iV  [c.37.1] ATP-DEPENDENT HSLU PROTEASE ATP-BINDING SUBUNIT
    3e-80  72%  1g3iT  [c.37.1] ATP-DEPENDENT HSLU PROTEASE ATP-BINDING SUBUNIT
    6e-80  67%  1g3iE  [c.37.1] ATP-DEPENDENT HSLU PROTEASE ATP-BINDING SUBUNIT
    2e-79  67%  1g3iC  [c.37.1] ATP-DEPENDENT HSLU PROTEASE ATP-BINDING SUBUNIT
    3e-79  71%  1g3iD  [c.37.1] ATP-DEPENDENT HSLU PROTEASE ATP-BINDING SUBUNIT
    4e-79  67%  1g3iF  [c.37.1] ATP-DEPENDENT HSLU PROTEASE ATP-BINDING SUBUNIT
    2e-78  56%  1ofhA  [c.37.1] ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT
    1e-74  68%  1ofiC  [c.37.1] ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT
    5e-74  68%  1ofiA  [c.37.1] ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT
    7e-74  68%  1ofiB  [c.37.1] ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT
    2e-73  69%  1im2A  [c.37.1] ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT
    2e-25  47%  1um8A  [c.37.1] ATP-DEPENDENT CLP PROTEASE ATP-BINDING SUBUNIT
    1e-07  45%  2r62A  [x.x.x] CELL DIVISION PROTEASE FTSH HOMOLOG
    1e-07  43%  1lv7A  [c.37.1] FTSH
    1e-06  43%  2ce7F  [x.x.x] CELL DIVISION PROTEIN FTSH
    1e-06  43%  2ce7E  [x.x.x] CELL DIVISION PROTEIN FTSH
    1e-06  43%  2ce7D  [x.x.x] CELL DIVISION PROTEIN FTSH
    1e-06  43%  2ce7C  [x.x.x] CELL DIVISION PROTEIN FTSH
    1e-06  43%  2ce7B  [x.x.x] CELL DIVISION PROTEIN FTSH
    1e-06  43%  2ce7A  [x.x.x] CELL DIVISION PROTEIN FTSH
    8e-06  37%  3b9pA  [x.x.x] CG5977-PA, ISOFORM A
    2e-05  33%  1r6bX  [a.174.1 - c.37.1 - c.37.1] CLPA PROTEIN
    2e-05  42%  2qz4A  [x.x.x] PARAPLEGIN
    2e-05  33%  1ksfX  [a.174.1 - c.37.1 - c.37.1] ATP-DEPENDENT CLP PROTEASE
    3e-05  36%  3h4mA  [x.x.x] PROTEASOME-ACTIVATING NUCLEOTIDASE
    5e-05  44%  3d8bB  [x.x.x] FIDGETIN-LIKE PROTEIN 1
    7e-05  39%  3d8bA  [x.x.x] FIDGETIN-LIKE PROTEIN 1
    3e-04  39%  1yqiC  [x.x.x] TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE
    3e-04  39%  1yqiB  [x.x.x] TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE
    3e-04  39%  1yqiA  [x.x.x] TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE
    6e-04  43%  1qvrA  [a.174.1 - c.37.1 - c.37.1] CLPB PROTEIN
    0.001  27%  1r7rA  [b.52.2 - d.31.1 - c.37.1 - c.37.1] TRANSITIONAL ENDOPLASMIC
    3e-37  79%  1g3iS  [c.37.1] ATP-DEPENDENT HSLU PROTEASE ATP-BINDING SUBUNIT(query 5->111)
    2e-50  63%  1g4aE  [c.37.1] ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT(query 5->163)
    3e-37  79%  1g3iW  [c.37.1] ATP-DEPENDENT HSLU PROTEASE ATP-BINDING SUBUNIT(query 5->111)
    3e-37  79%  1g3iV  [c.37.1] ATP-DEPENDENT HSLU PROTEASE ATP-BINDING SUBUNIT(query 5->111)
    2e-40  81%  1g3iE  [c.37.1] ATP-DEPENDENT HSLU PROTEASE ATP-BINDING SUBUNIT(query 5->111)
    2e-40  81%  1g3iC  [c.37.1] ATP-DEPENDENT HSLU PROTEASE ATP-BINDING SUBUNIT(query 5->111)
    2e-40  81%  1g3iF  [c.37.1] ATP-DEPENDENT HSLU PROTEASE ATP-BINDING SUBUNIT(query 5->111)
    1e-45  83%  1ofhA  [c.37.1] ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT(query 5->108)
    1e-39  82%  1ofiC  [c.37.1] ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT(query 5->108)
    5e-42  82%  1ofiA  [c.37.1] ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT(query 5->108)
    1e-39  82%  1ofiB  [c.37.1] ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT(query 5->108)
    9e-42  70%  1im2A  [c.37.1] ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT(query 6->134)
    7e-12  37%  1um8A  [c.37.1] ATP-DEPENDENT CLP PROTEASE ATP-BINDING SUBUNIT(query 1->108)
:455

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARR
1do0A           ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
1yyfA           ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
1e94E           ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
1do2A           ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
1dooE           ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
1g41A           ----MTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARR
1g3iU           ----MTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARR
1g3iX           ----MTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARR
1g3iA           ----MTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARR
1g3iS           ----------------------------------------------------------------------
1g4aE           ----------------------------------------------------------------------
1kyiA           ----MTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARR
1g3iW           ----------------------------------------------------------------------
1g3iV           ----------------------------------------------------------------------
1g3iT           ----MTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARR
1g3iE           ----------------------------------------------------------------------
1g3iC           ----------------------------------------------------------------------
1g3iD           ----MTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARR
1g3iF           ----------------------------------------------------------------------
1ofhA           ----------------------------------------------------------------------
1ofiC           ----------------------------------------------------------------------
1ofiA           ----------------------------------------------------------------------
1ofiB           ----------------------------------------------------------------------
1im2A           ----------------------------------------------------------------------
1um8A           ----------------------------------------------------------------------
2r62A           --------------------------------------------------PKGVLLVGPPGTGKTLLAKA
1lv7A           --------------------------------------------------PKGVLMVGPPGTGKTLLAKA
2ce7F           --------------------------------------------------PKGILLVGPPGTGKTLLARA
2ce7E           --------------------------------------------------PKGILLVGPPGTGKTLLARA
2ce7D           --------------------------------------------------PKGILLVGPPGTGKTLLARA
2ce7C           --------------------------------------------------PKGILLVGPPGTGKTLLARA
2ce7B           --------------------------------------------------PKGILLVGPPGTGKTLLARA
2ce7A           --------------------------------------------------PKGILLVGPPGTGKTLLARA
3b9pA           -----------------IAGQDVAKQALQEMVILPSVRPELFTGLRAPA--KGLLLFGPPGNGKTLLARA
1r6bX           -----TLKNLGDRLKMLVFGQDKAIEALTEAIK--MARAGLGHEHKPV---GSFLFAGPTGVGKTEVTVQ
2qz4A           --------------------------------------------------PKGALLLGPPGCGKTLLAKA
1ksfX           -----TLKNLGDRLKMLVFGQDKAIEALTEAIK--MARAGLGHEHKPV---GSFLFAGPTGVGKTEVTVQ
3h4mA           --------------------------------------------------PKGILLYGPPGTGKTLLAKA
3d8bB           --------------------------------------------------PKGILLFGPPGTGKTLIGKC
3d8bA           --------------------------------------------------PKGILLFGPPGTGKTLIGKC
1yqiC           --------------------------------------------------PRGILLYGPPGTGKTLIARA
1yqiB           --------------------------------------------------PRGILLYGPPGTGKTLIARA
1yqiA           --------------------------------------------------PRGILLYGPPGTGKTLIARA
1qvrA           ----------------------------------------------------SFLFLGPTGVGKTELAKT
1r7rA           ----------------------------------------------------------------------
1g3iS           ----MTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARR
1g4aE           ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
1g3iW           ----MTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARR
1g3iV           ----MTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARR
1g3iE           ----MTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARR
1g3iC           ----MTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARR
1g3iF           ----MTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARR
1ofhA           ----MTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARR
1ofiC           ----MTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARR
1ofiA           ----MTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARR
1ofiB           ----MTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARR
1im2A           -----TPREIVSELDQHIIGQADAKRAVAIALRNRWRR-QLQEPLRHEVTPKNIL-IGPTGVGKTEIARR
1um8A           LSYIPAPKELKAVLDNYVIGQEQAKKVFSVAVYNHYKRLSFKEKLKKQXSKSNILLIGPTGSGKTLMAQT


                         .         .         *         .         .         .         .:140
query           LAKLADAPFIKVEATKFTEVGYVGKDVESIIRDLVETAVKMXXXXXXXXXXXXXXRLAEDRILDVLIPPA
1do0A           LAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPA
1yyfA           LAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPA
1e94E           LAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPA
1do2A           LAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPA
1dooE           LAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPA
1g41A           LAKLANAPFIKVEATKFT----VGKEVDSIIRDLTDSAMKL-----------------------------
1g3iU           LAKLANAPFIKVEA-----------EVDSIIRDLTDSAMKL-----------------------------
1g3iX           LAKLANAPFIKVEA-----------EVDSIIRDLTDSAMKL-----------------------------
1g3iA           LAKLANAPFIKVEATKFTE-------VDSIIRDLTDSAMKL-----------------------------
1g3iS           ----------------------------------------------------------------------
1g4aE           ----------------------------------------------------------------------
1kyiA           LAKLANAPFIKVEATKFTE-------VDSIIRDLTDSAMKL-----------------------------
1g3iW           ----------------------------------------------------------------------
1g3iV           ----------------------------------------------------------------------
1g3iT           LAKLANAPFIKVEA-----------EVDSIIRDLTDSAMKL-----------------------------
1g3iE           ----------------------------------------------------------------------
1g3iC           ----------------------------------------------------------------------
1g3iD           LAKLANAPFIKVEATKFTE-------VDSIIRDLTDSAMKL-----------------------------
1g3iF           ----------------------------------------------------------------------
1ofhA           ----------------------------------------------------------------------
1ofiC           ----------------------------------------------------------------------
1ofiA           ----------------------------------------------------------------------
1ofiB           ----------------------------------------------------------------------
1im2A           ----------------------------------------------------------------------
1um8A           ----------------------------------------------------------------------
2r62A           VAGEAHVPFFSMGGSSFIEM-FVGLGA-SRVRDLFETAKK------------------------------
1lv7A           IAGEAKVPFFTISGSDFVEM-FVGVGA-SRVRDMFEQAKK------------------------------
2ce7F           VAGEANVPFFHISGSDFVEL-FVGVGA-ARVRDLFAQA--------------------------------
2ce7E           VAGEANVPFFHISGSDFVEL-FVGVGA-ARVRDLFAQA--------------------------------
2ce7D           VAGEANVPFFHISGSDFVEL-FVGVGA-ARVRDLFAQA--------------------------------
2ce7C           VAGEANVPFFHISGSDFVEL-FVGVGA-ARVRDLFAQA--------------------------------
2ce7B           VAGEANVPFFHISGSDFVEL-FVGVGA-ARVRDLFAQA--------------------------------
2ce7A           VAGEANVPFFHISGSDFVEL-FVGVGA-ARVRDLFAQA--------------------------------
3b9pA           VATECSATFLNISAASLTS-KYVG-DGEKLVRALFAVARHM-----------------------------
1r6bX           LSKALGIELLRFDMSEYMEPGYVGFDQGGLLTDAV-----------------------------------
2qz4A           VATEAQVPFLAMAGAEFVEV--------------------------------------------------
1ksfX           LSKALGIELLRFDMSEYMEPGYVGFDQGGLLTDAV-----------------------------------
3h4mA           VATETNATFIRVVGSELVK-KFIGEGA-SLVKDIFKLA--------------------------------
3d8bB           IASQSGATFFSISASSLTE---------------------------------------------------
3d8bA           IASQSGATFFSISASSLTS-KWVGEG-EKMVRALFAVA--------------------------------
1yqiC           VANETGAFFFLING---PEISKLAGESESNLRKAFEEAEK------------------------------
1yqiB           VANETGAFFFLING---PEISKLAGESESNLRKAFEEAEK------------------------------
1yqiA           VANETGAFFFLING---PEISKLAGESESNLRKAFEEAEK------------------------------
1qvrA           LAATTEEAMIRIDMTEYME---------------------------------------------------
1r7rA           ----------------------------------------------------------------------
1g3iS           LAKLANAPFIKVEA-----------EVDSIIRDLTDSAMKL-----------------------------
1g4aE           LAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDAMKLLI
1g3iW           LAKLANAPFIKVEA-----------EVDSIIRDLTDSAMKL-----------------------------
1g3iV           LAKLANAPFIKVEA-----------EVDSIIRDLTDSAMKL-----------------------------
1g3iE           LAKLANAPFIKVEATKFTE-------VDSIIRDLTDSAMKL-----------------------------
1g3iC           LAKLANAPFIKVEATKFTE-------VDSIIRDLTDSAMKL-----------------------------
1g3iF           LAKLANAPFIKVEATKFTE-------VDSIIRDLTDSAMKL-----------------------------
1ofhA           LAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDSA--------------------------------
1ofiC           LAKLANAPFIKVEATKFTE-------VDSIIRDLTDSA--------------------------------
1ofiA           LAKLANAPFIKVEATKFTE---VGKEVDSIIRDLTDSA--------------------------------
1ofiB           LAKLANAPFIKVEATKFTE-------VDSIIRDLTDSA--------------------------------
1im2A           LAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDSA-KLVRQQEIAKNRARAEDVAEERLID------
1um8A           LAKHLDIPIAISDATSLT--------VENILTRLLQAS--------------------------------


                         +         .         .         .         .         *         .:210
query           RTSESKVGFANEPAEDAASKKEKENKTREIFRKKIQNGELDDKEIEIEVAVAPKTIGVMGPPGMEDMTSQ
1do0A           KNNWGQTEQQQEPSA-----------ARQAFRKKLREGQLDDKEIEIDARKL-----------------K
1yyfA           KNNWGQTEQQQEPSA-----------ARQAFRKKLREGQLDDKEIEKQKARKLKIKDAM-----------
1e94E           KNNWGQTEQQQEPSA-----------ARQAFRKKLREGQLDDKEIEKQKARKLKIKDAM-----------
1do2A           KNNWGQTEQQQEPSA-----------ARQAFRKKLREGQLDDKEIEKQKARKLKIKDAM-----------
1dooE           KNNWGQTEQQQEPSA-----------ARQAFRKKLREG--------LKIKDAMK----------------
1g41A           ----------------------------------------------------------------------
1g3iU           ----------------------------------------------------------------------
1g3iX           ----------------------------------------------------------------------
1g3iA           ----------------------------------------------------------------------
1g3iS           --------------------------------------------------VTPKNILMIGPTGVTEIARR
1g4aE           ----------------------------------------------------------------------
1kyiA           ----------------------------------------------------------------------
1g3iW           --------------------------------------------------VTPKNILMIGPTGVTEIARR
1g3iV           --------------------------------------------------VTPKNILMIGPTGVTEIARR
1g3iT           ----------------------------------------------------------------------
1g3iE           ----------------------------------------------------------------------
1g3iC           ----------------------------------------------------------------------
1g3iD           ----------------------------------------------------------------------
1g3iF           ----------------------------------------------------------------------
1ofhA           --------------------------------------------------VTPKNILMIGPTGVGK--TE
1ofiC           ----------------------------------------------------------------------
1ofiA           ----------------------------------------------------------------------
1ofiB           ----------------------------------------------------------------------
1im2A           ----------------------------------------------------------------------
1um8A           ----------------------------------------------------------------------
2r62A           ----------------------------------------------------------------------
1lv7A           ----------------------------------------------------------------------
2ce7F           ----------------------------------------------------------------------
2ce7E           ----------------------------------------------------------------------
2ce7D           ----------------------------------------------------------------------
2ce7C           ----------------------------------------------------------------------
2ce7B           ----------------------------------------------------------------------
2ce7A           ----------------------------------------------------------------------
3b9pA           ----------------------------------------------------------------------
1r6bX           ----------------------------------------------------------------------
2qz4A           ----------------------------------------------------------------------
1ksfX           ----------------------------------------------------------------------
3h4mA           ----------------------------------------------------------------------
3d8bB           ----------------------------------------------------------------------
3d8bA           ----------------------------------------------------------------------
1yqiC           ----------------------------------------------------------------------
1yqiB           ----------------------------------------------------------------------
1yqiA           ----------------------------------------------------------------------
1qvrA           ----------------------------------------------------------------------
1r7rA           ----------------------------------------------------------------------
1g3iS           ----------------------------------------------------------------------
1g4aE           EEEAAKLVNPEELKQDAIDAVEQ-----------------------------------------------
1g3iW           ----------------------------------------------------------------------
1g3iV           ----------------------------------------------------------------------
1g3iE           ----------------------------------------------------------------------
1g3iC           ----------------------------------------------------------------------
1g3iF           ----------------------------------------------------------------------
1ofhA           ----------------------------------------------------------------------
1ofiC           ----------------------------------------------------------------------
1ofiA           ----------------------------------------------------------------------
1ofiB           ----------------------------------------------------------------------
1im2A           ----------------------------------------------------------------------
1um8A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LQDLFSSLSTXXXXXXXXXXXXXXXLAQDEEAAKLVNEEDIKARALEAVEQNGIVFLDEIDKVCRKSSNS
1do0A           IKDAMKLLI-------------------EEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESS
1yyfA           ------------------------KLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESS
1e94E           ------------------------KLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESS
1do2A           ------------------------KLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESS
1dooE           -------------------------LLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESS
1g41A           ----------------------------DDEAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKKGEYS
1g3iU           ---------------------------RDDEAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKKS---
1g3iX           ----------------------------DDEAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKKS---
1g3iA           ----------------------------DDEAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKK----
1g3iS           LAKLFIKVEAEVDSIIRDLTDSAMKLVRQQEIAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKKS---
1g4aE           ----------------------------EEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESS
1kyiA           -----------------------------KNAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKK----
1g3iW           LAKLFIKVEAEVDSIIRDLTDSAMKLVRQQEIAK--NREELKQKAIDAVEQNGIVFIDEIDKICKKS---
1g3iV           LAKLFIKVEAEVDSIIRDLTDSAMKLVRQQEIAKN-NPEELKQKAIDAVEQNGIVFIDEIDKICKKS---
1g3iT           ---------------------------------KLINPEELKQKAIDAVEQNGIVFIDEIDKICKKS---
1g3iE           -------------------------LVRQQEIAKNRNPEELKQKAIDAVEQNGIVFIDEIDKICKK----
1g3iC           -------------------------LVRQQEIAKAINPEELKQKAIDAVEQNGIVFIDEIDKICKK----
1g3iD           ---------------------------QQEIAKNRANPEELKQKAIDAVEQNGIVFIDEIDKICKK----
1g3iF           -------------------------LVRQQEIAKRINPEELKQKAIDAVEQNGIVFIDEIDKICKK----
1ofhA           IARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDSAGGAIDAVEQNGIVFIDEIDKICKKGEYS
1ofiC           ---------------------------------------DSAGGAIDAVEQNGIVFIDEIDKICK-----
1ofiA           ---------------------------------------DSAGGAIDAVEQNGIVFIDEIDKICK-----
1ofiB           ---------------------------------------DSAGGAIDAVEQNGIVFIDEIDKICKK----
1im2A           ----------------------------DDEAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKEYS--
1um8A           --------------------------------------ENILTRLLQASDQKGIVFIDEIDKI-------
2r62A           ----------------------------------------------------------------------
1lv7A           ----------------------------------------------------------------------
2ce7F           ----------------------------------------------------------------------
2ce7E           ----------------------------------------------------------------------
2ce7D           ----------------------------------------------------------------------
2ce7C           ----------------------------------------------------------------------
2ce7B           ----------------------------------------------------------------------
2ce7A           ----------------------------------------------------------------------
3b9pA           ----------------------------------------------------------------------
1r6bX           ----------------------------------------------------------------------
2qz4A           ----------------------------------------------------------------------
1ksfX           ----------------------------------------------------------------------
3h4mA           ----------------------------------------------------------------------
3d8bB           ----------------------------------------------------------------------
3d8bA           ----------------------------------------------------------------------
1yqiC           ----------------------------------------------------------------------
1yqiB           ----------------------------------------------------------------------
1yqiA           ----------------------------------------------------------------------
1qvrA           ----------------------------------------------------------------------
1r7rA           -----------------------------EIMSKLAGESESNLRAFEEAEKNAIIFIDELDAIAPKREKT
1g3iS           ----------------------------------------------------------------------
1g4aE           ----------------------------------------------------------------------
1g3iW           ----------------------------------------------------------------------
1g3iV           ----------------------------------------------------------------------
1g3iE           ----------------------------------------------------------------------
1g3iC           ----------------------------------------------------------------------
1g3iF           ----------------------------------------------------------------------
1ofhA           ----------------------------------------------------------------------
1ofiC           ----------------------------------------------------------------------
1ofiA           ----------------------------------------------------------------------
1ofiB           ----------------------------------------------------------------------
1im2A           ----------------------------------------------------------------------
1um8A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GADVSREGVQRDLLPLVEGSTVSTKYGVIKTDHILFIASGAFHVAKPSDLIPELQGRLPIRVELKSLEIE
1do0A           GPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTS
1yyfA           GPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTS
1e94E           GPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTS
1do2A           GPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTS
1dooE           GPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTS
1g41A           GADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAA
1g3iU           GADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAA
1g3iX           GADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAA
1g3iA           GADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAA
1g3iS           GADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAA
1g4aE           GPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTS
1kyiA           GADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAA
1g3iW           GADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAA
1g3iV           GADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAA
1g3iT           GADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAA
1g3iE           GADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAA
1g3iC           GADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAA
1g3iD           GADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAA
1g3iF           GADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAA
1ofhA           GADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAA
1ofiC           -ADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAA
1ofiA           --DVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAA
1ofiB           ---VSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAA
1im2A           GADVSREGVQRDLLPLVEGSTVSTKHGV-KTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAA
1um8A           -----GEGVQQALLKIVEGSLVNQ----IDTSDILFICAGAFHLVQTHDLIPELIGRLPVLSTLDSISLE
2r62A           ----------------------------------------------------------------------
1lv7A           ----------------------------------------------------------------------
2ce7F           ----------------------------------------------------------------------
2ce7E           ----------------------------------------------------------------------
2ce7D           ----------------------------------------------------------------------
2ce7C           ----------------------------------------------------------------------
2ce7B           ----------------------------------------------------------------------
2ce7A           ----------------------------------------------------------------------
3b9pA           ----------------------------------------------------------------------
1r6bX           ----------------------------------------------------------------------
2qz4A           ----------------------------------------------------------------------
1ksfX           ----------------------------------------------------------------------
3h4mA           ----------------------------------------------------------------------
3d8bB           ----------------------------------------------------------------------
3d8bA           ----------------------------------------------------------------------
1yqiC           ----------------------------------------------------------------------
1yqiB           ----------------------------------------------------------------------
1yqiA           ----------------------------------------------------------------------
1qvrA           ----------------------------------------------------------------------
1r7rA           HGEVERRIVSQ-LLTLMDG---------LKAHVIVMAATNRPNSIDPADIIPDATGRLEIQIHTKNMKLA
1g3iS           ----------------------------------------------------------------------
1g4aE           ----------------------------------------------------------------------
1g3iW           ----------------------------------------------------------------------
1g3iV           ----------------------------------------------------------------------
1g3iE           ----------------------------------------------------------------------
1g3iC           ----------------------------------------------------------------------
1g3iF           ----------------------------------------------------------------------
1ofhA           ----------------------------------------------------------------------
1ofiC           ----------------------------------------------------------------------
1ofiA           ----------------------------------------------------------------------
1ofiB           ----------------------------------------------------------------------
1im2A           ----------------------------------------------------------------------
1um8A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DFVRILREPDCSILKQYIALMKTEGIDLSFEEDAIRKIAEIAYKVNEEVENIGARRLHTVMERLLEKISF
1do0A           DFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISY
1yyfA           DFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISY
1e94E           DFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISY
1do2A           DFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISY
1dooE           DFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISY
1g41A           DFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISF
1g3iU           DFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISF
1g3iX           DFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISF
1g3iA           DFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISF
1g3iS           DFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISF
1g4aE           DFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISY
1kyiA           DFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISF
1g3iW           DFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISF
1g3iV           DFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISF
1g3iT           DFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISF
1g3iE           DFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISF
1g3iC           DFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISF
1g3iD           DFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISF
1g3iF           DFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISF
1ofhA           DFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISF
1ofiC           DFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISF
1ofiA           DFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISF
1ofiB           DFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISF
1im2A           DFERILTEPHASLTEQYKAL-ATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTV-ER-LDKISF
1um8A           AMVDILQKPKNALIKQYQQLFKMDEVDLIFEEEAIKEIAQLALE-----RKTGARGLRAIIEDFCLDIMF
2r62A           ----------------------------------------------------------------------
1lv7A           ----------------------------------------------------------------------
2ce7F           ----------------------------------------------------------------------
2ce7E           ----------------------------------------------------------------------
2ce7D           ----------------------------------------------------------------------
2ce7C           ----------------------------------------------------------------------
2ce7B           ----------------------------------------------------------------------
2ce7A           ----------------------------------------------------------------------
3b9pA           ----------------------------------------------------------------------
1r6bX           ----------------------------------------------------------------------
2qz4A           ----------------------------------------------------------------------
1ksfX           ----------------------------------------------------------------------
3h4mA           ----------------------------------------------------------------------
3d8bB           ----------------------------------------------------------------------
3d8bA           ----------------------------------------------------------------------
1yqiC           ----------------------------------------------------------------------
1yqiB           ----------------------------------------------------------------------
1yqiA           ----------------------------------------------------------------------
1qvrA           ----------------------------------------------------------------------
1r7rA           DDVQVANETHGHVGADLAALCSEAAL------QAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQ
1g3iS           ----------------------------------------------------------------------
1g4aE           ----------------------------------------------------------------------
1g3iW           ----------------------------------------------------------------------
1g3iV           ----------------------------------------------------------------------
1g3iE           ----------------------------------------------------------------------
1g3iC           ----------------------------------------------------------------------
1g3iF           ----------------------------------------------------------------------
1ofhA           ----------------------------------------------------------------------
1ofiC           ----------------------------------------------------------------------
1ofiA           ----------------------------------------------------------------------
1ofiB           ----------------------------------------------------------------------
1im2A           ----------------------------------------------------------------------
1um8A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           DAPELVEKNINITTDYVNEKLGNLVKNKDLSQYIL
1do0A           DASDLSGQNITIDADYVSKHLDALVADEDLSRFIL
1yyfA           DASDLSGQNITIDADYVSKHLDALVADEDLSRFIL
1e94E           DASDLSGQNITIDADYVSKHLDALVADEDLSRFIL
1do2A           DASDLSGQNITIDADYVSKHLDALVADEDLSRFIL
1dooE           DASDLSGQNITIDADYVSKHLDALVADEDLSRFIL
1g41A           SASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
1g3iU           SASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
1g3iX           SASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
1g3iA           SASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
1g3iS           SASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
1g4aE           DASDLSGQNITIDADYVSKHLDALVADEDLSRFIL
1kyiA           SASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
1g3iW           SASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
1g3iV           SASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
1g3iT           SASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
1g3iE           SASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
1g3iC           SASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
1g3iD           SASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
1g3iF           SASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
1ofhA           SASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
1ofiC           SASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
1ofiA           SASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
1ofiB           SASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
1im2A           SASD-NGQTVNIDAAYVADALGEVVENEDLSRFIL
1um8A           DLPKLKGSEVRITKDCVLKQAEPLI----------
2r62A           -----------------------------------
1lv7A           -----------------------------------
2ce7F           -----------------------------------
2ce7E           -----------------------------------
2ce7D           -----------------------------------
2ce7C           -----------------------------------
2ce7B           -----------------------------------
2ce7A           -----------------------------------
3b9pA           -----------------------------------
1r6bX           -----------------------------------
2qz4A           -----------------------------------
1ksfX           -----------------------------------
3h4mA           -----------------------------------
3d8bB           -----------------------------------
3d8bA           -----------------------------------
1yqiC           -----------------------------------
1yqiB           -----------------------------------
1yqiA           -----------------------------------
1qvrA           -----------------------------------
1r7rA           SNPSALRETVVEVPQVTWEDIGGL-----------
1g3iS           -----------------------------------
1g4aE           -----------------------------------
1g3iW           -----------------------------------
1g3iV           -----------------------------------
1g3iE           -----------------------------------
1g3iC           -----------------------------------
1g3iF           -----------------------------------
1ofhA           -----------------------------------
1ofiC           -----------------------------------
1ofiA           -----------------------------------
1ofiB           -----------------------------------
1im2A           -----------------------------------
1um8A           -----------------------------------