[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:ACD31100.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vlyA.bssp"
#ERROR : Can't open dsspfile "1nrkA.bssp"

## Summary of PDB Search
:248
    2e-07  35%  1vlyA  [d.250.1 - b.44.2] UNKNOWN PROTEIN FROM 2D-PAGE
    2e-07  35%  1nrkA  [d.250.1 - b.44.2] YGFZ PROTEIN
:248

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxGVDTKKFLQGLTTADLNGLSIDNDILLTAFANLKGRIISLCFVKFISNEKLLLSVE
1vlyA           --------------GADSEKY-QGQVTADVS--QAEDQHLLAAHCDAKGKWSNLRL--FRDGDGFAWIER
1nrkA           --------------GADSEKY-QGQVTADVS--QAEDQHLLAAHCDAKGKWSNLRL--FRDGDGFAWIER


                         .         .         *         .         .         .         .:140
query           QEVFENLLAWLKKYGMFSKVSFNPNDDYALFFTKTGFLNHDILTKGSLTSEMTFEQVRKENIINKLATIN
1vlyA           RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSKEKQVVKEGAVTDEATTDKLRGENIEAGFPVID
1nrkA           RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSKEKQVVKEGAVTDEATTDKLRGENIEAGFPVID


                         +         .         .         .         .         *         .:210
query           AANFEKFLPAELDLDNVDKVVCYTKGCYMGQEVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1vlyA           AANSGQFIPQATNLQALGG-ISFKKGCYTGQEV-------------------------------------
1nrkA           AANSGQFIPQATNLQALGG-ISFKKGCYTGQEV-------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1vlyA           --------------------------------------
1nrkA           --------------------------------------