[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:rpoH

[Show Plain Result]

#ERROR : Can't open dsspfile "3dxjF.bssp"
#ERROR : Can't open dsspfile "1l9zH.bssp"
#ERROR : Can't open dsspfile "1l9uH.bssp"
#ERROR : Can't open dsspfile "1iw7F.bssp"
#ERROR : Can't open dsspfile "1sigA.bssp"
#ERROR : Can't open dsspfile "1ku2A.bssp"
#ERROR : Can't open dsspfile "1rp3E.bssp"
#ERROR : Can't open dsspfile "1rp3C.bssp"
#ERROR : Can't open dsspfile "1rp3A.bssp"
#ERROR : Can't open dsspfile "1rp3G.bssp"
#ERROR : Can't open dsspfile "2p7vB.bssp"
#ERROR : Can't open dsspfile "1sc5A.bssp"
#ERROR : Can't open dsspfile "1ttyA.bssp"
#ERROR : Can't open dsspfile "1ku7D.bssp"
#ERROR : Can't open dsspfile "1ku7A.bssp"
#ERROR : Can't open dsspfile "1ku3A.bssp"
#ERROR : Can't open dsspfile "1rioH.bssp"

## Summary of PDB Search
:292
    7e-18  28%  3dxjF  [x.x.x] RNA POLYMERASE PRICIPAL SIGMA FACTOR (RPOD)
    1e-17  28%  1l9zH  [i.8.1] SIGMA FACTOR SIGA
    1e-17  28%  1l9uH  [i.8.1] SIGMA FACTOR SIGA
    2e-16  27%  1iw7F  [a.177.1 - a.4.13 - a.4.13] RNA POLYMERASE SIGMA-70 SUBUNIT
    1e-13  43%  1sigA  [x.x.x] RNA POLYMERASE PRIMARY SIGMA FACTOR
    1e-13  32%  1ku2A  [a.177.1 - a.4.13] SIGMA FACTOR SIGA
    2e-08  25%  1rp3E  [a.177.1 - a.4.13 - a.4.13] RNA POLYMERASE SIGMA FACTOR
    2e-08  25%  1rp3C  [a.177.1 - a.4.13 - a.4.13] RNA POLYMERASE SIGMA FACTOR
    2e-08  25%  1rp3A  [a.177.1 - a.4.13 - a.4.13] RNA POLYMERASE SIGMA FACTOR
    1e-05  24%  1rp3G  [a.177.1 - a.4.13 - a.4.13] RNA POLYMERASE SIGMA FACTOR
    1e-05  37%  2p7vB  [a.4.13 (1tlhB)] RNA POLYMERASE SIGMA FACTOR RPOD
    3e-05  23%  1sc5A  [a.177.1 - a.4.13 - a.4.13] RNA POLYMERASE SIGMA FACTOR FLIA
    7e-05  43%  1ttyA  [a.4.13] RNA POLYMERASE SIGMA FACTOR RPOD
    4e-04  45%  1ku7D  [a.4.13] SIGMA FACTOR SIGA
    4e-04  45%  1ku7A  [a.4.13] SIGMA FACTOR SIGA
    4e-04  45%  1ku3A  [a.4.13] SIGMA FACTOR SIGA
    8e-04  47%  1rioH  [a.4.13] SIGMA FACTOR SIGA
:292

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSLEQEQELARRYKYKKDLDAAQQLVLSHLRFVTK
3dxjF           -------------------------------------------------------ARQHLIEANLRLVVS
1l9zH           -----------------------------------------KELKRYLHIAREGEAARQLIEANLRLVVS
1l9uH           -----------------------------------------KELKRYLHIAREGEAARQLIEANLRLVVS
1iw7F           -------------------------------------------------------ARQHLIEANLRLVVS
1sigA           -----------------------------------LTIEQVKDINRRMSIAKARRAKKEMVEANLRLVIS
1ku2A           -----------------------------------------KELKRYLHIAREGEAARQLIEANLRLVVS
1rp3E           ---------------------------------------------------------EELILKYLPLVKA
1rp3C           ---------------------------------------------------------EELILKYLPLVKA
1rp3A           ---------------------------------------------------------EELILKYLPLVKA
1rp3G           ---------------------------------------------------------EELILKYLPLVKA
2p7vB           ----------------------------------------------------------------------
1sc5A           ---------------------------------------------------------EELILKYLPLVKA
1ttyA           ----------------------------------------------------------------------
1ku7D           ----------------------------------------------------------------------
1ku7A           ----------------------------------------------------------------------
1ku3A           ----------------------------------------------------------------------
1rioH           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IARNFSGYGLSIADLIQEGNIGLMKAVSKFDPDQGVRLLSFAVHWIKAEMHDYVLKNWKIVKVATTKAQR
3dxjF           IAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVEN
1l9zH           IAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVEN
1l9uH           IAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVEN
1iw7F           IAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVEN
1sigA           IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIR-----------------------
1ku2A           IAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVEN
1rp3E           IATNIKKHDVDIRDLISYGVIGLIKAVDNLSTENPKRAEAYIKLRIKGAIYDY-LRSLDFGSXXXXXXXX
1rp3C           IATNIKKHDVDIRDLISYGVIGLIKAVDNLSTENPKRAEAYIKLRIKGAIYDY-LRSLDFGSXXXXXXXX
1rp3A           IATNIKKHDVDIRDLISYGVIGLIKAVDNLSTENPKRAEAYIKLRIKGAIYDY-LRSLDFGSXXXXXXXX
1rp3G           IATNIKKHDVDIRDLISYGVIGLIKAVDNLSTENPKRAEAYIKLRIKGAIYDY-LRSLDFGSXXXXXXXX
2p7vB           ----------------------------------------------------------------------
1sc5A           IATNIKKHDVDIRDLISYGVIGLIKAVDNLSTENPKRAEAYIKLRIKGAIYDY-LRSLDFGSXXXXXXXX
1ttyA           ----------------------------------------------------------------------
1ku7D           ----------------------------------------------------------------------
1ku7A           ----------------------------------------------------------------------
1ku3A           ----------------------------------------------------------------------
1rioH           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KLFFNLRSSKDKIGWLSSENIKELAEELGVKEETVIEMEKRMCQGDASLDLPYTDDDGEQTSQQSLYLED
3dxjF           KLSRTARQLQQELG--REPTYEEIAEAMGPGDAKRVEETLKIAQEPVSLETPIGD---EKDSFYGDFIPD
1l9zH           KLSRTARQLQQELG--REPSYEEIAEAMGPGDAKRVEETLKIAQEPVSLETPID------------FIPD
1l9uH           KLSRTARQLQQELG--REPSYEEIAEAMGPGDAKRVEETLKIAQEPVSLETPID------------FIPD
1iw7F           KLSRTARQLQQELG--REPTYEEIAEAMGPGDAKRVEETLKIAQEPVSLETPIGD---EKDSFYGDFIPD
1sigA           ----------------------------------------------------------------------
1ku2A           KLSRTARQLQQELG--REPSYEEIAEAMG-----------------------------------------
1rp3E           XXXXXXXXXXXXXXXXPTD--EEVAKELGISTEELFKLDKINFSYILSLEEVFRDFARDYSE-----LIP
1rp3C           XXXXXXXXXXXXXXXXPTD--EEVAKELGISTEELFKLDKINFSYILSLEEVFRDFARDYSE-----LIP
1rp3A           XXXXXXXXXXXXXXXXPTD--EEVAKELGISTEELFKLDKINFSYILSLEEVFRDFARDYSE-----LIP
1rp3G           XXXXXXXXXXXXXXXXPTD--EEVAKELGISTE---ELFKTLDKINFSYILSLEE-----------VFRD
2p7vB           ----------------------------------------------------------------------
1sc5A           XXXXXXXXXXXXXXXXPTD--EEVAKELGISTE---ELFKTLDKINFSYILSLEEVFRDFARDYSELIPS
1ttyA           ----------------------------------------------------------------------
1ku7D           ----------------------------------------------------------------------
1ku7A           ----------------------------------------------------------------------
1ku3A           ----------------------------------------------------------------------
1rioH           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KSSNIEHQVVQQDYYDNFKAIVKDVLSGFDTRTKDIIMSRYLLDNKATLQDLAAKYNISAERVRQIEEDA
3dxjF           E--HLPSPVDAATQXXXXXXXXXXXXXXXXREAMVLKLRKGLIDGRETLEEVGAFFGVTRERIRQIENKA
1l9zH           E--NLPSPVXXXXXXXXXXXXXXXXXXXXXREAMVLKLRKGLIDGRETLEEVGAYFGVTRERIRQIENKA
1l9uH           E--NLPSPVXXXXXXXXXXXXXXXXXXXXXREAMVLKLRKGLIDGRETLEEVGAYFGVTRERIRQIENKA
1iw7F           E--HLPSPVDAATQXXXXXXXXXXXXXXXXREAMVLKLRKGLIDG----EEVGAFFGVTRERIRQIENKA
1sigA           ----------------------------------------------------------------------
1ku2A           ----------------------------------------------------------------------
1rp3E           SSTNVEEEVIKRELTEK----VKEAVSKLPEREKLVI--QLIFYEELPAKEVAKILETSVSRVSQLKAKA
1rp3C           SSTNVEEEVIKRELTEK----VKEAVSKLPEREKLVI--QLIFYEELPAKEVAKILETSVSRVSQLKAKA
1rp3A           SSTNVEEEVIKRELTEK----VKEAVSKLPEREKLVI--QLIFYEELPAKEVAKILETSVSRVSQLKAKA
1rp3G           FARDYSEEVIKRELTEK----VKEAVSKLPEREKLVI--QLIFYEELPAKEVAKILETSVSRVSQLKAKA
2p7vB           -----------------------DVLAGLTAREAKVLRMRFGIDMNTTLEEVGKQFDVTRERIRQIEAKA
1sc5A           STEVIKRELTEK---------VKEAVSKLPEREKLVI--QLIFYEELPAKEVAKILETSVSRVSQLKAKA
1ttyA           ------------------------VLKTLSPREAMVLRMRYLLDGKPTLEEVGQYFNVTRERIRQIEVKA
1ku7D           -------------------------------------MRKGLIDGRETLEEVGAYFGVTRERIRQIENKA
1ku7A           -------------------------------------MRKGLIDGRETLEEVGAYFGVTRERIRQIENKA
1ku3A           -------------------------------------MRKGLIDGRETLEEVGAYFGVTRERIRQIENKA
1rioH           -----------------------------------------LIDGRETLEEVGAYFGVTRERIRQIENKA


                         .         *         .         .         .         .         +:350
query           LAKLKKAIKNxx
3dxjF           LRKLK-------
1l9zH           LRKLK-------
1l9uH           LRKLK-------
1iw7F           LRKLK-------
1sigA           ------------
1ku2A           ------------
1rp3E           LERLREMLSN--
1rp3C           LERLREMLSN--
1rp3A           LERLREMLSN--
1rp3G           LERLREMLSN--
2p7vB           LRKLR-------
1sc5A           LERLREML----
1ttyA           LRKLR-------
1ku7D           LRKLK-------
1ku7A           LRKLK-------
1ku3A           LRKLK-------
1rioH           LRKLK-------