[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:rnd

[Show Plain Result]

#ERROR : Can't open dsspfile "1yt3A.bssp"
#ERROR : Can't open dsspfile "2hbjA.bssp"
#ERROR : Can't open dsspfile "3cymA.bssp"

## Summary of PDB Search
:364
    3e-27  26%  1yt3A  [x.x.x] RIBONUCLEASE D
    6e-23  29%  2hbjA  [x.x.x] EXOSOME COMPLEX EXONUCLEASE RRP6
    2e-09  26%  3cymA  [x.x.x] UNCHARACTERIZED PROTEIN BAD_0989
:364

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xIINTNKQLNNVIEILKNTSQIAVDTEFYWMRTYYPELCLVQLATENEIFLIDTLKDLEFKKLKEIFEDK
1yt3A           -MITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPLGITDWSPLKAILRDP
2hbjA           --VDTSTELESMLEDLKNTKEIAVDLEHHDYRSYYGIVCLMQISTRERDYLVDTLKLRELHILNEVFTNP
3cymA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DILKIIHSATNDIPIIKRFFNCEVNNIFDTQLAATFLGFQTQSSXXXXXXXXXXXXXXXXSQFSDWRNRP
1yt3A           SITKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMSWGFASMVEEYSGVTLDKSESRTDWLARP
2hbjA           SIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIGL-PRHSLAYLLENFANFKTSKKYQLADWRIRP
3cymA           DAVWILHDSLQDLPGFDEL-GMEPQRLFDTEIAARLLGLKRFGLAAVTEHFLGLTLAKEHSA-ADWSYRP


                         +         .         .         .         .         *         .:210
query           LTQNQLNYAIKDVEYLIQLKEYLQQQLAKSEYQDFFEQELIEVQKTQFNSIENIHAKIGNIQKFDEKTQR
1yt3A           LTERQCEYAAADVWYLLPITAKLMVETEASGWAALDECRLMQMRRQEVVAPEDAWRDITNAWQLRTRQLA
2hbjA           LSKPMTAAARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFTPSSEVYSPIEKMYQYNIPPER
3cymA           LPRDWRNYAALDVELLIELETKMRAELKRQGKMEWAQEEFDYALKRKEHLIPWMH--VSHITEVMRDRQA


                         .         .         .         +         .         .         .:280
query           NAILIAQWRETIAQEKNIPVRFIFNNKILYTIAHINPKSLNSFEHSELKSLKPWIKKGVVTALNSSKSLD
1yt3A           CLQLLADWRLRKARERDLAVNFVVREEHLWSVARYMPXXXXXXXXXXXKTLLALVEKAQTLPEDALPQPM
2hbjA           EVLVLYQWRDLIARRDDESPRFVMPNQLLAALVAYTP---------------------------------
3cymA           LAIVRALWRDELAREYDIAPTLLLSDSSIIEVAKRKPHNAAQF---------------------------


                         .         *         .         .         .         .         +:350
query           QVTLEQTSGSKLSTELNDKIIDFFDTYTKQLKFDSSIIASRKDIRSLAYNLNIDTNYKNNKLLNGWRYEI
1yt3A           LNLMDMPGYRKAFKAIKSLITDVSETH----KISAELLASRRQINQL-LNWHWKLKPQNNELISGWRGEL
2hbjA           ----------------------------------------------------------------------
3cymA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VGKKLxxxxxxxxx
1yt3A           MAEAL---------
2hbjA           --------------
3cymA           --------------