[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:wbtG

[Show Plain Result]

#ERROR : Can't open dsspfile "2jjmA.bssp"
#ERROR : Can't open dsspfile "2bisA.bssp"
#ERROR : Can't open dsspfile "2bw3A.bssp"

## Summary of PDB Search
:366
    2e-05  29%  2jjmA  [x.x.x] GLYCOSYL TRANSFERASE, GROUP 1 FAMILY PROTEIN
    9e-05  26%  2bisA  [x.x.x] GLGA GLYCOGEN SYNTHASE
    6e-04  23%  2bw3A  [x.x.x] TRANSPOSASE
:366

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2jjmA           ----------------------------------------------------------------------
2bisA           ----------------------------------------------------------------------
2bw3A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYRKTKYINSIRMGLENYDGHKNLTKFMIKLNAKFSKFS
2jjmA           ----------------------------------------------------------------------
2bisA           ----------------------------------------------------------------------
2bw3A           --------------------------------YHENNELRDLILGLKSLDFERSTAENIYKLKAIFSQFN


                         +         .         .         .         .         *         .:210
query           DLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDDNVKIIGIIARNHADKNIS
2jjmA           ----------------------------------------------------------------------
2bisA           -----------------------YVFNGIDCSFWNESYLTGSRDERKKSLDEGVTFMFIGRFDRGQKGVD
2bw3A           VEDLSSIKFVTDRGANVV------------KSLANNIRINCSSHLLSNVLENSFEETPELNPILACKNIV


                         .         .         .         +         .         .         .:280
query           RFLQIANLLLKSNPSLRFLIAGRECSKIDIGSYLDNKSNVNKFFVFESVDSSEYLPVLDLYLSTSKVEGF
2jjmA           -------------------------------------------------------------------ESF
2bisA           VLLKAIEILSKEFQEMRFIIIGKGDPELEARSLEEKHGNVK---VITEMLSREFVRELDFVIIPSYFEPF
2bw3A           KYFKKANLQHRLRSSLKSECPTRWNSTYTLRSILDNWESVIQ-ILSEAGETQRIVHINKSIIQTVNIDGF


                         .         *         .         .         .         .         +:350
query           PNILAEAMLCEVPIVASNVGDCKDILNGYGEVFELSQGNKEIIEKIMKVLETTVVMKKRMREYIINNFSI
2jjmA           GLVLLEAMACGVPCIGTRVGGIPEVIQ-HGDTGYLCEGVADQAIQLLKDEELHRNMGERARESVYEQFRS
2bisA           GLVALEAMCLGAIPIASAVGGLRDIITNETGILVKAGDPGELANAILKALELSRSDLSKFRENCAMSFSW
2bw3A           ERIFKELQTCSSPFVVPSILKVKEICSDVGDVADIAKLKVNIIKNVRIIWE-------------------


                         .         .         .         .         *         .         .:420
query           EAILEKHEKLYHExxx
2jjmA           EKIVSQYETIYYD---
2bisA           EKSAERYVKAY-----
2bw3A           ----------------