[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:pyrH

[Show Plain Result]

#ERROR : Can't open dsspfile "3ek6E.bssp"
#ERROR : Can't open dsspfile "3ek6C.bssp"
#ERROR : Can't open dsspfile "3ek6B.bssp"
#ERROR : Can't open dsspfile "3ek6A.bssp"
#ERROR : Can't open dsspfile "3ek5F.bssp"
#ERROR : Can't open dsspfile "3ek5B.bssp"
#ERROR : Can't open dsspfile "3ek5A.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "2a1fA.bssp"
#ERROR : Can't open dsspfile "2v4yA.bssp"
#ERROR : Can't open dsspfile "2bndA.bssp"
#ERROR : Can't open dsspfile "2v4yF.bssp"
#ERROR : Can't open dsspfile "2v4yD.bssp"
#ERROR : Can't open dsspfile "2bneA.bssp"
#ERROR : Can't open dsspfile "2v4yE.bssp"
#ERROR : Can't open dsspfile "2bneB.bssp"
#ERROR : Can't open dsspfile "2bndB.bssp"
#ERROR : Can't open dsspfile "2v4yB.bssp"
#ERROR : Can't open dsspfile "2jjxA.bssp"
#ERROR : Can't open dsspfile "2va1E.bssp"
#ERROR : Can't open dsspfile "2va1C.bssp"
#ERROR : Can't open dsspfile "2va1B.bssp"
#ERROR : Can't open dsspfile "2va1D.bssp"
#ERROR : Can't open dsspfile "2va1A.bssp"
#ERROR : Can't open dsspfile "2va1F.bssp"
#ERROR : Can't open dsspfile "2bnfA.bssp"
#ERROR : Can't open dsspfile "1ybdA.bssp"
#ERROR : Can't open dsspfile "2bnfB.bssp"
#ERROR : Can't open dsspfile "1z9dA.bssp"
#ERROR : Can't open dsspfile "2ij9A.bssp"
#ERROR : Can't open dsspfile "2ij9B.bssp"
#ERROR : Can't open dsspfile "2j4jC.bssp"
#ERROR : Can't open dsspfile "2j4kB.bssp"
#ERROR : Can't open dsspfile "2j4lJ.bssp"
#ERROR : Can't open dsspfile "2j4jA.bssp"
#ERROR : Can't open dsspfile "2j4lF.bssp"
#ERROR : Can't open dsspfile "2j4lB.bssp"
#ERROR : Can't open dsspfile "2j4kA.bssp"
#ERROR : Can't open dsspfile "2j4jF.bssp"
#ERROR : Can't open dsspfile "2j4kE.bssp"
#ERROR : Can't open dsspfile "2j4kC.bssp"
#ERROR : Can't open dsspfile "2akoA.bssp"
#ERROR : Can't open dsspfile "2j4lG.bssp"
#ERROR : Can't open dsspfile "2j4lE.bssp"
#ERROR : Can't open dsspfile "2hmfA.bssp"
#ERROR : Can't open dsspfile "3c1nD.bssp"
#ERROR : Can't open dsspfile "3c1nC.bssp"
#ERROR : Can't open dsspfile "3c1nB.bssp"
#ERROR : Can't open dsspfile "3c1nA.bssp"
#ERROR : Can't open dsspfile "3c1mD.bssp"
#ERROR : Can't open dsspfile "3c1mC.bssp"
#ERROR : Can't open dsspfile "3c1mA.bssp"
#ERROR : Can't open dsspfile "2j0xB.bssp"
#ERROR : Can't open dsspfile "2j0wA.bssp"
#ERROR : Can't open dsspfile "2ji5B.bssp"
#ERROR : Can't open dsspfile "2j4lI.bssp"

## Summary of PDB Search
:249
    2e-50  46%  3ek6E  [x.x.x] URIDYLATE KINASE
    2e-50  46%  3ek6C  [x.x.x] URIDYLATE KINASE
    2e-50  46%  3ek6B  [x.x.x] URIDYLATE KINASE
    2e-50  46%  3ek6A  [x.x.x] URIDYLATE KINASE
    2e-50  46%  3ek5F  [x.x.x] URIDYLATE KINASE
    2e-50  46%  3ek5B  [x.x.x] URIDYLATE KINASE
    2e-50  46%  3ek5A  [x.x.x] URIDYLATE KINASE
    2e-45  47%  2a1fF  [x.x.x] URIDYLATE KINASE
    2e-45  47%  2a1fE  [x.x.x] URIDYLATE KINASE
    2e-45  47%  2a1fD  [x.x.x] URIDYLATE KINASE
    2e-45  47%  2a1fC  [x.x.x] URIDYLATE KINASE
    2e-45  48%  2a1fA  [x.x.x] URIDYLATE KINASE
    1e-41  42%  2v4yA  [x.x.x] URIDYLATE KINASE
    5e-41  42%  2bndA  [x.x.x] URIDYLATE KINASE
    7e-41  43%  2v4yF  [x.x.x] URIDYLATE KINASE
    9e-41  43%  2v4yD  [x.x.x] URIDYLATE KINASE
    5e-40  42%  2bneA  [x.x.x] URIDYLATE KINASE
    6e-40  42%  2v4yE  [x.x.x] URIDYLATE KINASE
    1e-39  42%  2bneB  [x.x.x] URIDYLATE KINASE
    7e-39  41%  2bndB  [x.x.x] URIDYLATE KINASE
    2e-38  42%  2v4yB  [x.x.x] URIDYLATE KINASE
    1e-33  34%  2jjxA  [x.x.x] URIDYLATE KINASE
    6e-32  37%  2va1E  [x.x.x] URIDYLATE KINASE
    3e-30  38%  2va1C  [x.x.x] URIDYLATE KINASE
    3e-29  38%  2va1B  [x.x.x] URIDYLATE KINASE
    6e-29  37%  2va1D  [x.x.x] URIDYLATE KINASE
    6e-29  38%  2va1A  [x.x.x] URIDYLATE KINASE
    2e-28  37%  2va1F  [x.x.x] URIDYLATE KINASE
    1e-25  41%  2bnfA  [x.x.x] URIDYLATE KINASE
    2e-25  39%  1ybdA  [x.x.x] URIDYLATE KINASE
    2e-23  41%  2bnfB  [x.x.x] URIDYLATE KINASE
    6e-22  35%  1z9dA  [x.x.x] URIDYLATE KINASE
    6e-11  39%  2ij9A  [x.x.x] URIDYLATE KINASE
    4e-10  38%  2ij9B  [x.x.x] URIDYLATE KINASE
    2e-08  28%  2j4jC  [x.x.x] URIDYLATE KINASE
    2e-08  27%  2j4kB  [x.x.x] URIDYLATE KINASE
    5e-08  27%  2j4lJ  [x.x.x] URIDYLATE KINASE
    6e-08  27%  2j4jA  [x.x.x] URIDYLATE KINASE
    1e-07  27%  2j4lF  [x.x.x] URIDYLATE KINASE
    2e-07  29%  2j4lB  [x.x.x] URIDYLATE KINASE
    2e-07  29%  2j4kA  [x.x.x] URIDYLATE KINASE
    2e-07  29%  2j4jF  [x.x.x] URIDYLATE KINASE
    9e-07  30%  2j4kE  [x.x.x] URIDYLATE KINASE
    4e-06  27%  2j4kC  [x.x.x] URIDYLATE KINASE
    1e-05  36%  2akoA  [x.x.x] GLUTAMATE 5-KINASE
    2e-05  28%  2j4lG  [x.x.x] URIDYLATE KINASE
    2e-05  29%  2j4lE  [x.x.x] URIDYLATE KINASE
    8e-05  30%  2hmfA  [x.x.x] PROBABLE ASPARTOKINASE
    8e-05  30%  3c1nD  [x.x.x] PROBABLE ASPARTOKINASE
    8e-05  30%  3c1nC  [x.x.x] PROBABLE ASPARTOKINASE
    8e-05  30%  3c1nB  [x.x.x] PROBABLE ASPARTOKINASE
    8e-05  30%  3c1nA  [x.x.x] PROBABLE ASPARTOKINASE
    8e-05  30%  3c1mD  [x.x.x] PROBABLE ASPARTOKINASE
    8e-05  30%  3c1mC  [x.x.x] PROBABLE ASPARTOKINASE
    8e-05  30%  3c1mA  [x.x.x] PROBABLE ASPARTOKINASE
    1e-04  31%  2j0xB  [x.x.x] LYSINE-SENSITIVE ASPARTOKINASE 3
    1e-04  31%  2j0wA  [x.x.x] LYSINE-SENSITIVE ASPARTOKINASE 3
    3e-04  37%  2ji5B  [x.x.x] URIDYLATE KINASE
    7e-04  30%  2j4lI  [x.x.x] URIDYLATE KINASE
:249

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxSGESLSADQGFGINVESAQPIINQIKTLTNFGVELALVVGGGNILRGG
3ek6E           ----------------------SGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRGG
3ek6C           ----------------------SGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRGG
3ek6B           ----------------------SGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRGG
3ek6A           ----------------------SGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRGG
3ek5F           ----------------------SGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRGG
3ek5B           ----------------------SGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRGG
3ek5A           ----------------------SGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRGG
2a1fF           ----------------------SGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGA
2a1fE           ----------------------SGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGA
2a1fD           ----------------------SGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGA
2a1fC           ----------------------SGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGA
2a1fA           ----------------------SGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGA
2v4yA           ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
2bndA           ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
2v4yF           ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
2v4yD           ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
2bneA           ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
2v4yE           ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
2bneB           ----------------------SGEALQGTE-FGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
2bndB           ----------------------SGEALQGTE-FGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
2v4yB           ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
2jjxA           ----------------------SGGALADQTGNSFNSKRLEHIANEILSIVDLGIEVSIVIGGGNIFRGH
2va1E           ----------------------SGACLKQNDSSIIDFIKINDLAEQIEKISKKYI-VSIVLGGGNIWRGS
2va1C           ----------------------SGACLKQNDSSIIDFIKINDLAEQIEKISKKYI-VSIVLGGGNIWRGS
2va1B           ----------------------SGACLKQNDSSIIDFIKINDLAEQIEKISKKYI-VSIVLGGGNIWRGS
2va1D           ----------------------SGACLKQNDSSIIDFIKINDLAEQIEKISKKYI-VSIVLGGGNIWRGS
2va1A           ----------------------SGACLKQNDSSIIDFIKINDLAEQIEKISKKYI-VSIVLGGGNIWRGS
2va1F           ----------------------SGACLKQNDSSIIDFIKINDLAEQIEKISKKYI-VSIVLGGGNIWRGS
2bnfA           ----------------------SGEALQGTEGFGIDA-SILDRAQEIKXXXXXXXXXXXXXXXXNLFRGG
1ybdA           ----------------------SGESLGSDP-FGINHDTIVQTVGEIAEXXXXXXXXXXXXXXXXXXXXS
2bnfB           ----------------------SGEALQGTE-FGIDA-SILDRAQEIKXXXXXXXXXXXXXXXXNLFRGG
1z9dA           ----------------------SGEALAGEKGVGIDIPTVQAIAKEIAEVHVSGVQIALVIGGGNLWRGP
2ij9A           ----------------------------------------------------------------------
2ij9B           ----------------------------------------------------------------------
2j4jC           -----------------------------------NVDNLIVLRQSIKELADNGFRVGIVTGGGSTARRY
2j4kB           -----------------------------------NVDNLIVLRQSIKELADNGFRVGIVTGGGSTARRY
2j4lJ           -----------------------------------NVDNLIVLRQSIKELADNGFRVGIVTGGGSTARRY
2j4jA           -----------------------------------NVDNLIVLRQSIKELADNGFRVGIVTGGGSTARRY
2j4lF           -----------------------------------NVDNLIVLRQSIKELADNGFRVGIVTGGGSTARRY
2j4lB           -----------------------------------NVDNLIVLRQSIKELADNGFRVGIVTGGGSTARRY
2j4kA           -----------------------------------NVDNLIVLRQSIKELADNGFRVGIVTGGGSTARRY
2j4jF           -----------------------------------NVDNLIVLRQSIKELADNGFRVGIVTGGGSTARRY
2j4kE           ----------------------------------------------IKELADNGFRVGIVTGGGSTARRY
2j4kC           -----------------------------------NVDNLIVLRQSIKELADNGFRVGIVTGGGSTARRY
2akoA           ----------------------------------------------------------------------
2j4lG           -----------------------------------NVDNLIVLRQSIKELADFRV--GIVTGGGSTARRY
2j4lE           -----------------------------------NVDNLIVLRQSIKELADNGFRVGIVTGGGSTARRY
2hmfA           ----------------------------------------------------------------------
3c1nD           ----------------------------------------------------------------------
3c1nC           ----------------------------------------------------------------------
3c1nB           ----------------------------------------------------------------------
3c1nA           ----------------------------------------------------------------------
3c1mD           ----------------------------------------------------------------------
3c1mC           ----------------------------------------------------------------------
3c1mA           ----------------------------------------------------------------------
2j0xB           ----------------------------------------------------------------------
2j0wA           ----------------------------------------------------------------------
2ji5B           -------------------------------------------------------EVAVVVGGGKLARK-
2j4lI           -------------------------------------------------LADNGFRVGIVTGGGSTARRY


                         .         .         *         .         .         .         .:140
query           RANFGNKIRRATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGLLKVASAHEFNQELAKGRVLI
3ek6E           LAASG--MDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLEKGRIAI
3ek6C           LAASG--MDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLEKGRIAI
3ek6B           LAASG--MDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLEKGRIAI
3ek6A           LAASG--MDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLEKGRIAI
3ek5F           LAASG--MDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLEKGRIAI
3ek5B           LAASG--MDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLEKGRIAI
3ek5A           LAASG--MDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLEKGRIAI
2a1fF           KAKAG--MNRVVGDHMGMLATVMNGLAMRDSLFRADVNAKLMSAFQLNGICDTYNWSEAIKMLREKRVVI
2a1fE           KAKAG--MNRVVGDHMGMLATVMNGLAMRDSLFRADVNAKLMSAFQLNGICDTYNWSEAIKMLREKRVVI
2a1fD           KAKAG--MNRVVGDHMGMLATVMNGLAMRDSLFRADVNAKLMSAFQLNGICDTYNWSEAIKMLREKRVVI
2a1fC           KAKAG--MNRVVGDHMGMLATVMNGLAMRDSLFRADVNAKLMSAFQLNGICDTYNWSEAIKMLREKRVVI
2a1fA           KAKAG--MNRVVGDHMGMLATVMNGLAMRDSLFRADVNAKLMSAFQLNGICDTYNWSEAIKMLREKRVVI
2v4yA           LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVI
2bndA           LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNAVCDSYSWAEAISLLRNNRVVI
2v4yF           LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVI
2v4yD           LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVI
2bneA           LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVI
2v4yE           LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVI
2bneB           LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVI
2bndB           LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNAVCDSYSWAEAISLLRNNRVVI
2v4yB           LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVI
2jjxA           LAEEWG-IDRVEADNIGTLGTIINSLMLRGVLTSKNKEVRVMTSIPFNAVAEPYIRLRAVHHLDNGYIVI
2va1E           IAKELD-MDRNLADNMGMMATIINGLALENALNHLNVNTIVLSAIKCDKLVHESSANNIKKAIEKEQVMI
2va1C           IAKELD-MDRNLADNMGMMATIINGLALENALNHLNVNTIVLSAIKCDKLVHESSANNIKKAIEKEQVMI
2va1B           IAKELD-MDRNLADNMGMMATIINGLALENALNHLNVNTIVLSAIKCDKLVHESSANNIKKAIEKEQVMI
2va1D           IAKELD-MDRNLADNMGMMATIINGLALENALNHLNVNTIVLSAIKCDKLVHESSANNIKKAIEKEQVMI
2va1A           IAKELD-MDRNLADNMGMMATIINGLALENALNHLNVNTIVLSAIKCDKLVHESSANNIKKAIEKEQVMI
2va1F           IAKELD-MDRNLADNMGMMATIINGLALENALNHLNVNTIVLSAIKCDKLVHESSANNIKKAIEKEQVMI
2bnfA           LAKAGNRV----VGDHGLAT--VNGLA-RDALHRAYVNARLSAIP-----LNVCDSYSWAEAISNNRVVI
1ybdA           -AQAGSD--RATAD----YGATVNALALKDAFETLGIKARVQSALSQQ-IAETYARPKAIQYLEEGKVVI
2bnfB           LAKAGNRV----VGDHGLAT--VNGLA-RDALHRAYVNARLSAIP-----LNVCDSYSWAEAISNNRVVI
1z9dA           AADAGDRVQ---ADYTGL--GTVNAL-VADSLQHYGVDTRVQTAI-PQNVAEPYIRGRALRHLEKNRIVV
2ij9A           -------------DYIGIAATRLNAMLL--------ISAIPSAAK------KVPVDFMEAEELSKLYRVV
2ij9B           -------------DYIGIAATRLNAMLL--------ISAIPSAAK------KVPVDFMEAEELSKLYRVV
2j4jC           AREIG--IGEAYLDLLGIWASRLNAYLV------------MFSLQDLAYMHVPQSLEEFIQDWSHGKVVV
2j4kB           AREIG--IGEAYLDLLGIWASRLNAYLV------------MFSLQDLAYMHVPQSLEEFIQDWSHGKVVV
2j4lJ           AREIG--IGEAYLDLLGIWASRLNAYLV------------MFSLQDLAYMHVPQSLEEFIQDWSHGKVVV
2j4jA           AREIG--IGEAYLDLLGIWASRLNAYLV------------MFSLQDLAYMHVPQSLEEFIQDWSHGKVVV
2j4lF           AREIG--IGEAYLDLLGIWASRLNAYLV------------MFSLQDLAYMHVPQSLEEFIQDWSHGKVVV
2j4lB           AREIG--IGEAYLDLLGIWASRLNAYLV------------MFSLQDLAYMHVPQSLEEFIQDWSHGKVVV
2j4kA           AREIG--IGEAYLDLLGIWASRLNAYLV------------MFSLQDLAYMHVPQSLEEFIQDWSHGKVVV
2j4jF           AREIG--IGEAYLDLLGIWASRLNAYLV------------MFSLQDLAYMHVPQSLEEFIQDWSHGKVVV
2j4kE           AREIG--IGEAYLDLLGIWASRLNAYLV------------MFSLQDLAYMHVPQSLEEFIQDWSHGKVVV
2j4kC           AREIG--IGEAYLDLLGIWASRLNAYLV------------MFSLQDLAYMHVPQSLEEFIQDWSHGKVVV
2akoA           ----------------------------------------------------------------------
2j4lG           AREIG--IGEAYLDLLGIWASRLNAYLV------------MFSLQDLAYMHVPQSLEEFIQDWSHGKVVV
2j4lE           AREIG--IGEAYLDLLGIWASRLNAYLV------------MFSLQDLAYMHVPQSLEEFIQDWSHGKVVV
2hmfA           ----------------------------------------------------------------------
3c1nD           ----------------------------------------------------------------------
3c1nC           ----------------------------------------------------------------------
3c1nB           ----------------------------------------------------------------------
3c1nA           ----------------------------------------------------------------------
3c1mD           ----------------------------------------------------------------------
3c1mC           ----------------------------------------------------------------------
3c1mA           ----------------------------------------------------------------------
2j0xB           ----------------------------------------------------------------------
2j0wA           ----------------------------------------------------------------------
2ji5B           YIEVAEKFNSSETDFIGIQITRANAMALREKAYPVVVEDFWEAWKAV--------------QLKKIPVM-
2j4lI           AREIG--IGEAYLDLLGIWASRLNAYLV------------MFSLQDLAYMHVPQSLEEFIQDWSHGKVVV


                         +         .         .         .         .         *         .:210
query           FAGGTGNPFVTTDTTASLRAVEIGADALLKATTVNGVYDKDPNKYSDAKRFDKVTFSEVVSKELNVMDLG
3ek6E           FAAGTGNPFFTTDSGAALRAIEIGADLLLKATKVDGVYDKDPKKHSDAVRYDSLTYDEVIMQGLEVMDTA
3ek6C           FAAGTGNPFFTTDSGAALRAIEIGADLLLKATKVDGVYDKDPKKHSDAVRYDSLTYDEVIMQGLEVMDTA
3ek6B           FAAGTGNPFFTTDSGAALRAIEIGADLLLKATKVDGVYDKDPKKHSDAVRYDSLTYDEVIMQGLEVMDTA
3ek6A           FAAGTGNPFFTTDSGAALRAIEIGADLLLKATKVDGVYDKDPKKHSDAVRYDSLTYDEVIMQGLEVMDTA
3ek5F           FAAGTGNPFFTTDSGAALRAIEIGADLLLKATKVDGVYDKDPKKHSDAVRYDSLTYDEVIMQGLEVMDTA
3ek5B           FAAGTGNPFFTTDSGAALRAIEIGADLLLKATKVDGVYDKDPKKHSDAVRYDSLTYDEVIMQGLEVMDTA
3ek5A           FAAGTGNPFFTTDSGAALRAIEIGADLLLKATKVDGVYDKDPKKHSDAVRYDSLTYDEVIMQGLEVMDTA
2a1fF           FSAGTGNPFFTTDSTACLRGIEIEADVVLKATKVDGVYD-------CAKLYKNLSYAEVIDKELKVMDLS
2a1fE           FSAGTGNPFFTTDSTACLRGIEIEADVVLKATKVDGVYD-------CAKLYKNLSYAEVIDKELKVMDLS
2a1fD           FSAGTGNPFFTTDSTACLRGIEIEADVVLKATKVDGVYD-------CAKLYKNLSYAEVIDKELKVMDLS
2a1fC           FSAGTGNPFFTTDSTACLRGIEIEADVVLKATKVDGVYD-------CAKLYKNLSYAEVIDKELKVMDLS
2a1fA           FSAGTGNPFFTTDSTACLRGIEIEADVVLKATKVDGVYD-------CAKLYKNLSYAEVIDKELKVMDLS
2v4yA           LSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLA
2bndA           LSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLA
2v4yF           LSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTKDPT----ATMYEQLTYSEVLEKELKVMDLA
2v4yD           LSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFAKDPT----ATMYEQLTYSEVLEKELKVMDLA
2bneA           LSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADP---PTATMYEQLTYSEVLEKELKVMDLA
2v4yE           LSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAD-PTATMYEQLTYSEVLEKELKVMDLA
2bneB           LSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLA
2bndB           LSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLA
2v4yB           LSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFT------PTATMYEQLTYSEVLEKELKVMDLA
2jjxA           FGGGNGQPFVTTDYPSVQRAIEMNSDAILVAKQVDGVFTSDPKHNKSAKMYRKLNYNDVVRQNIQVMDQA
2va1E           FVAGTGFPYFTTDSCAAIRAAETESSIILMGKNVDGVYDSDPKINPNAQFYEHITFNMALTQNLKVMDAT
2va1C           FVAGTGFPYFTTDSCAAIRAAETESSIILMGKNVDGVYD------SDAQFYEHITFNMALTQNLKVMDAT
2va1B           FVAGTGFPYFTTDSCAAIRAAETESSIILMGKNVDGVY--DPN----AQFYEHITFNMALTQNLKVMDAT
2va1D           FVAGTGFPYFTTDSCAAIRAAETESSIILMGKNVDGVYD-------SAQFYEHITFNMALTQNLKVMDAT
2va1A           FVAGTGFPYFTTDSCAAIRAAETESSIILMGKNVDGVYDSD--------FYEHITFNMALTQNLKVMDAT
2va1F           FVAGTGFPYFTTDSCAAIRAAETESSIILMGKNVDGVY--------DSQFYEHITFNMALTQNLKVMDAT
2bnfA           LSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTA-TYEQLTYSEVLEKELKV-DLA
1ybdA           FAAGTGNPFFTTDTAAALRGAE-NCD-VLKATNVDGVYTADPKKDPSATRYETITFDEALLKNLKV-DAT
2bnfB           LSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTA-TYEQLTYSEVLEKELKV-DLA
1z9dA           FGAGIGSPYFSTDTTXXXXXXXXXXXXXXXKNGVDGVYNADPKKDANAVKFDELTHGEVIKRGLKI-DAT
2ij9A           VMGGTF-PGHTTDATAALLAEFIKADVFINATNVDGVYSADPKSDTSAVKYDRLSLVEIVSRGTNVIDLL
2ij9B           VMGGTF-PGHTTDATAALLAEFIKADVFINATNVDGVYSADPKSDTSAVKYDRLSLVEIVSRSSGVIDLL
2j4jC           TGGF--QPGQXXXXXXXXXXXXXXXKTLVVATNVDGVYEKDPRIYADVKLIPHLT-TQDLRKILELLDPL
2j4kB           TGGF--QPGQXXXXXXXXXXXXXXXKTLVVATNVDGVYEKDPRIYADVKLIPHLTTQDL--RKIELLDPL
2j4lJ           TGGF--QPGQXXXXXXXXXXXXXXXKTLVVATNVDGVYEKDPRIYADVKLIPHLTTQDL--RKILLLDPL
2j4jA           TGGF--QPGQXXXXXXXXXXXXXXXKTLVVATNVDGVYEKDPRIYADVKLIPHLTTQDLRKILEELLDPL
2j4lF           TGGF--QPGQXXXXXXXXXXXXXXXKTLVVATNVDGVYEKDPRIYADVKLIPHLTLRKILEGTYELLDPL
2j4lB           TGGF--QPGQXXXXXXXXXXXXXXXKTLVVATNVDGVYEKDPRIYADVKLIPHLTTQDL-----------
2j4kA           TGGF--QPGQXXXXXXXXXXXXXXXKTLVVATNVDGVYEKDPRIYADVKLIPHLTTQDL-----------
2j4jF           TGGF--QPGQXXXXXXXXXXXXXXXKTLVVATNVDGVYEKDPRIYADVKLIPHLTTQDL-----------
2j4kE           TGGF--QPGQXXXXXXXXXXXXXXXKTLVVATNVDGVYEKDPRIYADVKLIPHLTTQDL-----------
2j4kC           TGGF--QPGQXXXXXXXXXXXXXXXKTLVVATNVDGVYEKDPRIY----------IPHLTTQDLRLLDPL
2akoA           --------FGDNDSLSAYATHFFDADLLVILSDIDGFYDKNPSEFSDAKRLEKIT---------------
2j4lG           TGGF--QPGQXXXXXXXXXXXXXXXKTLVVATNVDGVYEKDPRIYA-VKLIPHLT-TQDLRKILELLDPL
2j4lE           TGGF--QPGQXXXXXXXXXXXXXXXKTLVVATNVDGVYEKDP---ADVKLIPHLTTQDL-----------
2hmfA           FIGTTEEGYITTDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAAKVLHPR
3c1nD           FIGTTEEGYITTDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAAKVLHPR
3c1nC           FIGTTEEGYITTDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAAKVLHPR
3c1nB           FIGTTEEGYITTDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAAKVLHPR
3c1nA           FIGTTEEGYITTDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAAKVLHPR
3c1mD           FIGTTEEGYITTDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAAKVLHPR
3c1mC           FIGTTEEGYITTDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAAKVLHPR
3c1mA           FIGTTEEGYITTDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAAKVLHPR
2j0xB           -----------SDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRIDEIAFAEAAEMAAKVLHPA
2j0wA           -----------SDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRIDEIAFAEAAEMAAKVLHPA
2ji5B           --GGT-HPGHTTDAVAALLAEFLKADLLVVITNVDGVYTAD-----TAKKIKKMKPEELLEIVGSVID--
2j4lI           TGGF--QPGQXXXXXXXXXXXXXXXKTLVVATNVDGVYEKDPVK--------------------------


                         .         .         .         +         .         .         .:280
query           AFTQCRDFGIPIYVFDLTQPNALVDAVLDSKYGTWVTLD
3ek6E           AFALARDSDLPLRIFGMSEPGVLLRILHGAQIGTLV---
3ek6C           AFALARDSDLPLRIFGMSEPGVLLRILHGAQIGTLV---
3ek6B           AFALARDSDLPLRIFGMSEPGVLLRILHGAQIGTLV---
3ek6A           AFALARDSDLPLRIFGMSEPGVLLRILHGAQIGTLV---
3ek5F           AFALARDSDLPLRIFGMSEPGVLLRILHGAQIGTLV---
3ek5B           AFALARDSDLPLRIFGMSEPGVLLRILHGAQIGTLV---
3ek5A           AFALARDSDLPLRIFGMSEPGVLLRILHGAQIGTLV---
2a1fF           AFTLARDHGMPIRVFNMGKPGALRQVV------------
2a1fE           AFTLARDHGMPIRVFNMGKPGALRQVV------------
2a1fD           AFTLARDHGMPIRVFNMGKPGALRQVV------------
2a1fC           AFTLARDHGMPIRVFNMGKPGALRQVV------------
2a1fA           AFTLARDHGMPIRVFNMGKPGAL----------------
2v4yA           AFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLIT--
2bndA           AFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLIT--
2v4yF           AFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLIT--
2v4yD           AFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLIT--
2bneA           AFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLIT--
2v4yE           AFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLIT--
2bneB           AFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLIT--
2bndB           AFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLIT--
2v4yB           AFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLIT--
2jjxA           ALLLARDYNLPAHVFNFDEPGVMRRICLGEHVGTLINDD
2va1E           ALALCQENNINLLVFNIDKPNAIVD-VLEKK--------
2va1C           ALALCQENNINLLVFNIDKPNAIVD-VLEKK--------
2va1B           ALALCQENNINLLVFNIDKPNAIVD-VLEKK--------
2va1D           ALALCQENNINLLVFNIDKPNAIVD-VLEKK--------
2va1A           ALALCQENNINLLVFNIDKPNAIVD-VLEKK--------
2va1F           ALALCQENNINLLVFNIDKPNAIVD-VLEKK--------
2bnfA           AFTLARDHKLPIRVFN-NKPGAL-RRVVGEKEGTLIT--
1ybdA           AFALCRERKLNIVVFGIAKEGSLKRVITGEDEGTLV---
2bnfB           AFTLARDHKLPIRVFN-NKPGAL-RRVVGEKEGTLIT--
1z9dA           AST-LSDNDIDLVVFN-----------------------
2ij9A           AAKIIERSKIKTYVI-LGTPENIMKAVKGEAVGT-----
2ij9B           AAKIIERSKIKTYVI-LGTPENIMKAVKGEAVGT-----
2j4jC           AIKIVERSKIRVIVMNYRKLNRIID--------------
2j4kB           AIKIVERSKIRVIVMNYRKLNRIID--------------
2j4lJ           AIKIVERSKIRVIVMNYRKLNRIID--------------
2j4jA           AIKIVERSKIRVIVMNYRKLNRIID--------------
2j4lF           AIKIVERSKIRVIVMNYRKLNRIID--------------
2j4lB           ---------------------------------------
2j4kA           ---------------------------------------
2j4jF           ---------------------------------------
2j4kE           ---------------------------------------
2j4kC           AIKIVERSKIRVIVMNYRKLNRIID--------------
2akoA           ---------------------------------------
2j4lG           AIKIVERSKIRVIVMNYRKLNRIID--------------
2j4lE           ---------------------------------------
2hmfA           TIEPAMEKGIPILVKNTFEPES-----------------
3c1nD           TIEPAMEKGIPILVKNTFEPES-----------------
3c1nC           TIEPAMEKGIPILVKNTFEPES-----------------
3c1nB           TIEPAMEKGIPILVKNTFEPES-----------------
3c1nA           TIEPAMEKGIPILVKNTFEPES-----------------
3c1mD           TIEPAMEKGIPILVKNTFEPES-----------------
3c1mC           TIEPAMEKGIPILVKNTFEPES-----------------
3c1mA           TIEPAMEKGIPILVKNTFEPES-----------------
2j0xB           TLLPAVRSDIPVFVGSSKDPRA-----------------
2j0wA           TLLPAVRSDIPVFVGSSKDPRA-----------------
2ji5B           ---------------------------------------
2j4lI           ---------------------------------------