[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30141.1

[Show Plain Result]


## Summary of Sequence Search
    1::248
    9::267     2e-06  29%  270 aa  PYRD_THEP1 RecName: Full=Dihydroorotate dehydrogenase;       
    9::267     2e-06  29%  270 aa  PYRD_THEMA RecName: Full=Dihydroorotate dehydrogenase;       
  265::336     8e-06  39%  339 aa  PYRD_HAEIN RecName: Full=Dihydroorotate dehydrogenase;       
  265::336     8e-06  39%  339 aa  PYRD_HAEIG RecName: Full=Dihydroorotate dehydrogenase;       
  265::336     8e-06  39%  339 aa  PYRD_HAEIE RecName: Full=Dihydroorotate dehydrogenase;       
  265::336     8e-06  39%  339 aa  PYRD_HAEI8 RecName: Full=Dihydroorotate dehydrogenase;       
   69::282     3e-05  28%  303 aa  PYRD_NATTJ RecName: Full=Dihydroorotate dehydrogenase;       
  272::341     3e-05  36%  349 aa  PYRD_BORA1 RecName: Full=Dihydroorotate dehydrogenase;       
  211::337     4e-05  29%  345 aa  PYRD_BURTA RecName: Full=Dihydroorotate dehydrogenase;       
  259::330     6e-05  32%  335 aa  PYRD_HAEDU RecName: Full=Dihydroorotate dehydrogenase;       
   69::284     8e-05  26%  311 aa  PYRD_SULSY RecName: Full=Dihydroorotate dehydrogenase;       
   69::284     8e-05  28%  305 aa  PYRD_BACHD RecName: Full=Dihydroorotate dehydrogenase;       
  211::337     1e-04  28%  345 aa  PYRD_BURM1 RecName: Full=Dihydroorotate dehydrogenase;       
   68::286     2e-04  26%  306 aa  PYRD_AQUAE RecName: Full=Dihydroorotate dehydrogenase;       
  264::335     2e-04  32%  347 aa  PYRD_COXBU RecName: Full=Dihydroorotate dehydrogenase;       
  264::335     2e-04  32%  347 aa  PYRD_COXBR RecName: Full=Dihydroorotate dehydrogenase;       
  264::335     2e-04  32%  347 aa  PYRD_COXBN RecName: Full=Dihydroorotate dehydrogenase;       
  264::335     2e-04  32%  347 aa  PYRD_COXB2 RecName: Full=Dihydroorotate dehydrogenase;       
  264::335     2e-04  32%  347 aa  PYRD_COXB1 RecName: Full=Dihydroorotate dehydrogenase;       
   69::284     3e-04  27%  304 aa  PYRD_LISMF RecName: Full=Dihydroorotate dehydrogenase;       
   69::284     3e-04  27%  304 aa  PYRD_LISMC RecName: Full=Dihydroorotate dehydrogenase;       
  260::331     4e-04  31%  335 aa  PYRD_HAEPS RecName: Full=Dihydroorotate dehydrogenase;       
  272::342     5e-04  45%  349 aa  PYRD_BORPE RecName: Full=Dihydroorotate dehydrogenase;       
  272::342     5e-04  45%  349 aa  PYRD_BORPA RecName: Full=Dihydroorotate dehydrogenase;       
  272::342     5e-04  45%  349 aa  PYRD_BORBR RecName: Full=Dihydroorotate dehydrogenase;       
  213::333     7e-04  34%  337 aa  PYRD_THIDA RecName: Full=Dihydroorotate dehydrogenase;       
  260::339     7e-04  29%  362 aa  PYRD_BARBK RecName: Full=Dihydroorotate dehydrogenase;       
  278::326     7e-04  35%  356 aa  PYRD_ARTCA RecName: Full=Dihydroorotate dehydrogenase;       
  258::315     0.001  33%  349 aa  PYRD_NOVAD RecName: Full=Dihydroorotate dehydrogenase;       
   67::271     0.001  28%  305 aa  PYRD_LACPL RecName: Full=Dihydroorotate dehydrogenase;       
    1::248

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxIIISPPFGKYLKFKETSNVYGSFTVNRRWGLIKQAIKTIRKIDKNAWRNKIGLRNPGLANTN
PYRD_THEP1      --------VLLSGPFGEYLKLMDHRYVGGVLTVTLH---PKEGNPTPRMADSDFYVNRIGLENPGIHAFV
PYRD_THEMA      --------VLLSGPFGEYLKLMDHRYVGGVLTVTLH---PKEGNPTPRMADSDFYVNRIGLENPGIHAFV
PYRD_HAEIN      ----------------------------------------------------------------------
PYRD_HAEIG      ----------------------------------------------------------------------
PYRD_HAEIE      ----------------------------------------------------------------------
PYRD_HAEI8      ----------------------------------------------------------------------
PYRD_NATTJ      --------------------------------------------------------NSIGLENPGIDNIL
PYRD_BORA1      ----------------------------------------------------------------------
PYRD_BURTA      ----------------------------------------------------------------------
PYRD_HAEDU      ----------------------------------------------------------------------
PYRD_SULSY      --------------------------------------------------------NSIGLQNPGINETL
PYRD_BACHD      --------------------------------------------------------NAIGLQNPGLNNVN
PYRD_BURM1      ----------------------------------------------------------------------
PYRD_AQUAE      --------------------------------------------------------NSIGLQNPGLKEIY
PYRD_COXBU      ----------------------------------------------------------------------
PYRD_COXBR      ----------------------------------------------------------------------
PYRD_COXBN      ----------------------------------------------------------------------
PYRD_COXB2      ----------------------------------------------------------------------
PYRD_COXB1      ----------------------------------------------------------------------
PYRD_LISMF      --------------------------------------------------------NAIGLQNPGLEHVL
PYRD_LISMC      --------------------------------------------------------NAIGLQNPGLEHVL
PYRD_HAEPS      ----------------------------------------------------------------------
PYRD_BORPE      ----------------------------------------------------------------------
PYRD_BORPA      ----------------------------------------------------------------------
PYRD_BORBR      ----------------------------------------------------------------------
PYRD_THIDA      ----------------------------------------------------------------------
PYRD_BARBK      ----------------------------------------------------------------------
PYRD_ARTCA      ----------------------------------------------------------------------
PYRD_NOVAD      ----------------------------------------------------------------------
PYRD_LACPL      ------------------------------------------------------WLNAIGLKNPGIDNVK


                         .         .         *         .         .         .         .:140
query           PPKRAQDIISLAALDMSDWHSFAETLKLPKFAQHRNIEINIGCPNASIVDFPAELAPLFEDRNISIKMPP
PYRD_THEP1      ENIPELPVPMIASLGGDSFEEYLEVARVFKKVADRAVEFNFSCPNVSIVKNAEEWKKLL---NTLRKELP
PYRD_THEMA      ENIPELPVPMIASLGGDSFEEYLEVARVFKKVADRAVEFNFSCPNVSIVKNAEEWKKLL---NTLRKELP
PYRD_HAEIN      ----------------------------------------------------------------------
PYRD_HAEIG      ----------------------------------------------------------------------
PYRD_HAEIE      ----------------------------------------------------------------------
PYRD_HAEI8      ----------------------------------------------------------------------
PYRD_NATTJ      PDLRQCDATTLINISGGNDEEYVETQKLNNCQGIAGLEVNISCPNIREGGLVYGVDPELTYRLVSVKLSP
PYRD_BORA1      ----------------------------------------------------------------------
PYRD_BURTA      --------------------------------------------HGKLVPLALKIAPDLDDEQVKDIAAT
PYRD_HAEDU      ----------------------------------------------------------------------
PYRD_SULSY      PKLKKYDTKIFANVDEDEYLAVAE--RLDKADGVHGLELNVSCPNVKKIAFGTDPEVLYNKKPLLVKLSP
PYRD_BACHD      ELARLADVANIAGSTVNDYVEVAEAIS--RVDNVHALELNISCPNGTVPDVAAQLTQ--EVKRVSVKLSP
PYRD_BURM1      --------------------------------------------HGKLVPLALKIAPDLDDEQVKAIADT
PYRD_AQUAE      PKIKDVDTHFIANVFGETEEEYVEVMALEDADKIVAYELNVSCPNVKKGGIPVILGNLVDRIKAKIKKPL
PYRD_COXBU      ----------------------------------------------------------------------
PYRD_COXBR      ----------------------------------------------------------------------
PYRD_COXBN      ----------------------------------------------------------------------
PYRD_COXB2      ----------------------------------------------------------------------
PYRD_COXB1      ----------------------------------------------------------------------
PYRD_LISMF      AHEETPIIANVAGATEDDYVQVCARIGESKAV--KAIELNISCPNVKHGGIAFGTDPDVAHRPVYVKLSP
PYRD_LISMC      AHEETPIIANVAGATEDDYVQVCARIGESKAV--KAIELNISCPNVKHGGIAFGTDPDVAHRPVYVKLSP
PYRD_HAEPS      ----------------------------------------------------------------------
PYRD_BORPE      ----------------------------------------------------------------------
PYRD_BORPA      ----------------------------------------------------------------------
PYRD_BORBR      ----------------------------------------------------------------------
PYRD_THIDA      ---------------------------------------------------------------IALKIAP
PYRD_BARBK      ----------------------------------------------------------------------
PYRD_ARTCA      ----------------------------------------------------------------------
PYRD_NOVAD      ----------------------------------------------------------------------
PYRD_LACPL      LPWLATHYPDLPIIGSVAGASFDEYVAVAKMASAPNVEINISCPNVAFGTDPATVTALTKDKPVFMKLTP


                         +         .         .         .         .         *         .:210
query           TVDHNAKIREYLAVGITTFHLCNTIPTAKGGISGYPLHKYSLPAIKKARQEFGDSXXXXXXXXXYTLDDA
PYRD_THEP1      DSFLIAKVEFVMKTGWDGITLVNTVTMILGGLSGPVLKPIALRAVYEVKKRFPE-LFVIASGGVYSVKDA
PYRD_THEMA      DSFLIAKVEFVMKTGWDGITLVNTVTMILGGLSGPVLKPIALRAVYEVKKRFPE-LFVIASGGVYSVKDA
PYRD_HAEIN      ----------------------------QGGLSGKPLQHKSTEIIKRLHQELKGQIPIIGSGGIDGLQNA
PYRD_HAEIG      ----------------------------QGGLSGKPLQHKSTEIIKRLHQELKGQIPIIGSGGIDGLQNA
PYRD_HAEIE      ----------------------------QGGLSGKPLQHKSTEIIKRLHQELKGQIPIIGSGGIDGLQNA
PYRD_HAEI8      ----------------------------QGGLSGKPLQHKSTEIIKRLHQELKGQIPIIGSGGIDGLQNA
PYRD_NATTJ      NVTDITEIAKACRAGADGLSLINTVDNISAGLSGPAIKPIALKAVYQVSQAV--DLPVMGMGGIYNYQDA
PYRD_BORA1      -----------------------------GGLSGAPVHELSLAVIERLRQRVGSALAIIGVGGILSGQQA
PYRD_BURTA      LLRHN--IEGVIATNTTLSRAVKGLPHADGGLSGRPVFDASNAVIRKLHAELGDAVPIIGVGGIFSGDDA
PYRD_HAEDU      ----------------------------QGGLSGKPLHTLSTKLISTLAKELKGKIPIIGSGGVHSIDSG
PYRD_SULSY      NVDGLVLINTLLGVAIDVEREKPILSTITGGLSGPAMLPIAVRMIWQVYQKYGSRIPIIGVGGISNYKDA
PYRD_BACHD      NVSDIVEMAQAVRAGADGLSMINTLANGTGGLSGPAIKPVAIRMIYQVSQAV--SIPIIGMGGIQSADDV
PYRD_BURM1      LLRH--KIEAVIATNTTLSRAAQGLPHADGGLSGRPVFDASNEVIRKLHAEVGSAVPIIGVGGIFSGDDA
PYRD_AQUAE      LVKLSPNVTDVIENGADGLVLINTLATKTGGLSGPAILPIAVRMIYQVYEKFGDRIPIIGVGGITTWEDA
PYRD_COXBU      -----------------------------GGLSGKPLFPMTLQVVKQLHSFLGDEIPIVAVGGIFSGENA
PYRD_COXBR      -----------------------------GGLSGKPLFPMTLQVVKQLHSFLGDEIPIVAVGGIFSGENA
PYRD_COXBN      -----------------------------GGLSGKPLFPMTLQVVKQLHSFLGDEIPIVAVGGIFSGENA
PYRD_COXB2      -----------------------------GGLSGKPLFPMTLQVVKQLHSFLGDEIPIVAVGGIFSGENA
PYRD_COXB1      -----------------------------GGLSGKPLFPMTLQVVKQLHSFLGDEIPIVAVGGIFSGENA
PYRD_LISMF      NVADIVSIAQAIAAGADGLTMINTIANGTGGLSGPAIKPVAIRMIHQVREV--SNIPIIGMGGVQTVDDV
PYRD_LISMC      NVADIVSIAQAIAAGADGLTMINTIANGTGGLSGPAIKPVAIRMIHQVREV--SNIPIIGMGGVQTVDDV
PYRD_HAEPS      ----------------------------QGGLSGKPLNALSTQLISQLSQELNGKLPIIGSGGIHSVQSG
PYRD_BORPE      -----------------------------GGVSGAPVHELSLRVIERLRSRLGDXXXXXXXXXXLSGRQA
PYRD_BORPA      -----------------------------GGVSGAPVHELSLRVIERLRSRLGDXXXXXXXXXXLSGRQA
PYRD_BORBR      -----------------------------GGVSGAPVHELSLRVIERLRSRLGDXXXXXXXXXXLSGRQA
PYRD_THIDA      DLDE-AQIAAIAALGIDAVIATNTLPNANGGLSGAPVREASTRVVRTLAQHLGGALPIIGVGGILSGDDA
PYRD_BARBK      -----------------------------GGLSGRPLFERSTIVLAKMRQKLGKDIAIIGVGGVWDAQTA
PYRD_ARTCA      -----------------------------GGLSGAPLKKRSLEVLRRLKQATGDALTLIAVGGVETAQDV
PYRD_NOVAD      -----------------------------GGLSGAPLRELALQRLRDFRKASGGAIPLVGVGGIATVDDA
PYRD_LACPL      NVXXXTMINTLTGMGIDLATRQPILAHGTGGLSGKAIHPLAVRMIHDVRQH--TKLPIIGVGGVFTPADV


                         .         .         .         +         .         .         .:280
query           KKYIEAGADHLSLSSIMFNPIRGKKLVKEIVKFWLDDx
PYRD_THEP1      EEFLKVGADVIGVGSALF---KDPGVVEEIGKYLLE--
PYRD_THEMA      EEFLKVGADVIGVGSALF---KDPGVVEEIGKYLLE--
PYRD_HAEIN      QEKIEAGAELLQVYSGLI--YHGPKLVKELVK------
PYRD_HAEIG      QEKIEAGAELLQVYSGLI--YHGPKLVKELVK------
PYRD_HAEIE      QEKIEAGAELLQVYSGLI--YHGPKLVKELVK------
PYRD_HAEI8      QEKIEAGAELLQVYSGLI--YHGPKLVKELVK------
PYRD_NATTJ      IEFILAGATSVALGTVNFEPTAAKSIIQGI--------
PYRD_BORA1      REKIAAGADAVQLYTGLI--YRGPALVGECV-------
PYRD_BURTA      RAKLAAGASLVQLYTGFI--YRGPALVAECVK------
PYRD_HAEDU      QQKIDAGAHLLQLYSAMI--YQGPTLIQELAK------
PYRD_SULSY      LQHILAGASAIQVGTANFDPLSPLKIIEDL--------
PYRD_BACHD      LEFMLAGADAVAVGTANFDPYVCPTIIDELPK------
PYRD_BURM1      RAKLAAGASLVQLYTGFI--YRGPALVAECVK------
PYRD_AQUAE      MEHVMAGASAVQVGTANFEPLAPLKVIEGIENF-----
PYRD_COXBU      QTLINAGARLVQLYTGLI--YEGPELVKNIVEF-----
PYRD_COXBR      QTLINAGARLVQLYTGLI--YEGPELVKNIVEF-----
PYRD_COXBN      QTLINAGARLVQLYTGLI--YEGPELVKNIVEF-----
PYRD_COXB2      QTLINAGARLVQLYTGLI--YEGPELVKNIVEF-----
PYRD_COXB1      QTLINAGARLVQLYTGLI--YEGPELVKNIVEF-----
PYRD_LISMF      LEFLIAGADAVAVGTMNFDPFICPKLISELPK------
PYRD_LISMC      LEFLIAGADAVAVGTMNFDPFICPKLISELPK------
PYRD_HAEPS      QEKINAGASLLQLYSAMI--YQGPDLVRQLVR------
PYRD_BORPE      SEKMAAGAQAVQLYTGLI--YRGPALVGECVR------
PYRD_BORPA      SEKMAAGAQAVQLYTGLI--YRGPALVGECVR------
PYRD_BORBR      SEKMAAGAQAVQLYTGLI--YRGPALVGECVR------
PYRD_THIDA      RAKIAAGASLVQLYSGLI--YRGPGLVRECVE------
PYRD_BARBK      LEKIKAGADLVQFYSGMVGPDLAKNITKDVLQMMQQD-
PYRD_ARTCA      QDRLDAGA------------------------------
PYRD_NOVAD      WERIRAGASLIQIYSAM---------------------
PYRD_LACPL      LEFYLAGANAVQVGAATY--------------------