[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30153.1

[Show Plain Result]


## Summary of Sequence Search
    1::118
   22::110     5e-11  29%  176 aa  OMLA_PSEAE RecName: Full=Outer membrane lipoprotein omlA;Flags:
    2::110     5e-10  26%  175 aa  OMLA_PSEFL RecName: Full=Outer membrane lipoprotein omlA;Flags:
    8::115     7e-10  27%  119 aa  SMPA_VIBCH RecName: Full=Small protein A homolog;Flags: Precursor;
    8::115     7e-10  27%  119 aa  SMPA_VIBC3 RecName: Full=Small protein A homolog;Flags: Precursor;
   13::80      7e-08  32%  137 aa  SMPA_HAEIN RecName: Full=Small protein A homolog;Flags:
   28::113     8e-06  31%  113 aa  SMPA_SHIFL RecName: Full=Small protein A;Flags: Precursor;
   28::113     8e-06  31%  113 aa  SMPA_ECOLI RecName: Full=Small protein A;Flags: Precursor;
   28::113     8e-06  31%  113 aa  SMPA_ECOL6 RecName: Full=Small protein A;Flags: Precursor;
    1::118

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxKNLCLLIAAFSLSACGIIQPYTAPVPQGKEIKDKKLFEIKPNMTKSEVTYILGSPDIIDTFNPN
OMLA_PSEAE      --------------------CSFPGVYKIDIQQGNVVTQDMIDQLRPGMTRRQVRFIMGNPLIVDTFHAN
OMLA_PSEFL      ------QNTKLLLTSFTLAGCSFPGVYKIDIQQGNVVTQDMIDQLRPGMTRRQVRFIMGNALLTDTFHAD
SMPA_VIBCH      --------IALPLAVTALSGCSLLERYRIDINQGNYVDQQSVDQLKFGMSKDQVRFVLGSPMLVENGYPD
SMPA_VIBC3      --------IALPLAVTALSGCSLLERYRIDINQGNYVDQQSVDQLKFGMSKDQVRFVLGSPMLVENGYPD
SMPA_HAEIN      --------------ALSLASCSTVEKYRIDVPQGNYLEATTVAQVKEGMTAQQVQYLLGTPVLVDPYNSQ
SMPA_SHIFL      --------------------------YRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTN
SMPA_ECOLI      --------------------------YRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTN
SMPA_ECOL6      --------------------------YRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTN


                         .         .         *         .         .         .         .:140
query           QYVYINTYKRNMQDTQFSESKLILTFNNQDRLIGISGNYAPPTKDPVF
OMLA_PSEAE      RWDYL--YSIQPGGGRRQQERVSLFFNDSDQLAGLNGDFMP-------
OMLA_PSEFL      RWDYLYSLQPGGGERQ--QERVSVIFNGNDQLVSLSGDFMP-------
SMPA_VIBCH      TWYYIYHHTQGHNDP--VQKNLIVKFNDGGKLVNVAGDF--PAGDSFF
SMPA_VIBC3      TWYYIYHHTQGHNDP--VQKNLIVKFNDGGKLVNVAGDF--PAGDSFF
SMPA_HAEIN      TWYYVFLQQR--------------------------------------
SMPA_SHIFL      TWFYV--FRQQPGHEGVTQQTLTLTFNNIDNKPALSGN----------
SMPA_ECOLI      TWFYV--FRQQPGHEGVTQQTLTLTFNNIDNKPALSGN----------
SMPA_ECOL6      TWFYV--FRQQPGHEGVTQQTLTLTFNNIDNKPALSGN----------