[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30160.1

[Show Plain Result]


## Summary of Sequence Search
    1::403
    3::382     9e-94  46%  396 aa  RIBBA_THEPX RecName: Full=Riboflavin biosynthesis protein
    3::382     2e-92  46%  396 aa  RIBBA_THEP3 RecName: Full=Riboflavin biosynthesis protein
   10::395     9e-92  48%  406 aa  RIBBA_AQUAE RecName: Full=Riboflavin biosynthesis protein
    2::390     4e-91  48%  405 aa  RIBBA_CYTH3 RecName: Full=Riboflavin biosynthesis protein
    4::382     2e-88  44%  393 aa  RIBBA_STAAC RecName: Full=Riboflavin biosynthesis protein
    4::382     2e-87  44%  393 aa  RIBBA_STAAW RecName: Full=Riboflavin biosynthesis protein
    4::382     2e-87  44%  393 aa  RIBBA_STAAS RecName: Full=Riboflavin biosynthesis protein
    4::382     2e-87  44%  393 aa  RIBBA_STAAR RecName: Full=Riboflavin biosynthesis protein
    4::382     2e-87  44%  393 aa  RIBBA_STAAN RecName: Full=Riboflavin biosynthesis protein
    4::382     2e-87  44%  393 aa  RIBBA_STAAM RecName: Full=Riboflavin biosynthesis protein
    1::389     3e-87  44%  403 aa  RIBBA_UNCTG RecName: Full=Riboflavin biosynthesis protein
    2::389     4e-87  45%  404 aa  RIBBA_BACV8 RecName: Full=Riboflavin biosynthesis protein
    2::370     5e-87  47%  404 aa  RIBBA_BACTN RecName: Full=Riboflavin biosynthesis protein
    4::363     2e-86  46%  393 aa  RIBBA_STAEQ RecName: Full=Riboflavin biosynthesis protein
    3::384     2e-86  46%  397 aa  RIBBA_BACWK RecName: Full=Riboflavin biosynthesis protein
    3::384     4e-86  46%  399 aa  RIBBA_BREBN RecName: Full=Riboflavin biosynthesis protein
    1::384     4e-86  46%  397 aa  RIBBA_BACSK RecName: Full=Riboflavin biosynthesis protein
    4::363     5e-86  46%  393 aa  RIBBA_STAES RecName: Full=Riboflavin biosynthesis protein
    7::388     7e-86  46%  400 aa  RIBBA_SALTO RecName: Full=Riboflavin biosynthesis protein
    7::389     9e-86  45%  404 aa  RIBBA_BACFR RecName: Full=Riboflavin biosynthesis protein
    7::389     9e-86  45%  404 aa  RIBBA_BACFN RecName: Full=Riboflavin biosynthesis protein
    2::363     2e-85  47%  414 aa  RIBBA_CLONN RecName: Full=Riboflavin biosynthesis protein
   10::392     3e-85  44%  424 aa  RIBBA_CHLTR RecName: Full=Riboflavin biosynthesis protein
    5::385     3e-85  46%  398 aa  RIBBA_BACA2 RecName: Full=Riboflavin biosynthesis protein
    7::363     3e-85  48%  420 aa  RIBBA_SALAI RecName: Full=Riboflavin biosynthesis protein
    3::384     3e-85  46%  397 aa  RIBBA_BACCR RecName: Full=Riboflavin biosynthesis protein
    3::384     3e-85  46%  397 aa  RIBBA_BACCQ RecName: Full=Riboflavin biosynthesis protein
    3::384     3e-85  46%  397 aa  RIBBA_BACC7 RecName: Full=Riboflavin biosynthesis protein
    3::384     5e-85  46%  397 aa  RIBBA_BACHK RecName: Full=Riboflavin biosynthesis protein
    3::384     5e-85  46%  397 aa  RIBBA_BACC3 RecName: Full=Riboflavin biosynthesis protein
    3::384     5e-85  46%  397 aa  RIBBA_BACAN RecName: Full=Riboflavin biosynthesis protein
    3::384     5e-85  46%  397 aa  RIBBA_BACAH RecName: Full=Riboflavin biosynthesis protein
    3::384     5e-85  46%  397 aa  RIBBA_BACAC RecName: Full=Riboflavin biosynthesis protein
    3::384     5e-85  46%  397 aa  RIBBA_BACAA RecName: Full=Riboflavin biosynthesis protein
    5::385     8e-85  46%  398 aa  RIBBA_BACSU RecName: Full=Riboflavin biosynthesis protein
    3::384     8e-85  46%  397 aa  RIBBA_BACC2 RecName: Full=Riboflavin biosynthesis protein
    3::384     8e-85  46%  397 aa  RIBBA_BACC1 RecName: Full=Riboflavin biosynthesis protein
    3::384     1e-84  46%  397 aa  RIBBA_BACC4 RecName: Full=Riboflavin biosynthesis protein
    3::384     1e-84  46%  397 aa  RIBBA_BACC0 RecName: Full=Riboflavin biosynthesis protein
   15::397     2e-84  43%  418 aa  RIBBA_CHLPN RecName: Full=Riboflavin biosynthesis protein
    3::384     2e-84  46%  397 aa  RIBBA_BACCZ RecName: Full=Riboflavin biosynthesis protein
    7::388     5e-84  46%  401 aa  RIBBA_ACTP7 RecName: Full=Riboflavin biosynthesis protein
    5::385     7e-84  45%  398 aa  RIBBA_BACAM RecName: Full=Riboflavin biosynthesis protein
    4::382     1e-83  45%  393 aa  RIBBA_STAHJ RecName: Full=Riboflavin biosynthesis protein
    7::388     1e-83  45%  401 aa  RIBBA_ACTPL RecName: Full=Riboflavin biosynthesis protein
    7::388     1e-83  45%  401 aa  RIBBA_ACTP2 RecName: Full=Riboflavin biosynthesis protein
    2::390     2e-83  45%  405 aa  RIBBA_PORGI RecName: Full=Riboflavin biosynthesis protein
    2::390     2e-83  45%  405 aa  RIBBA_PORG3 RecName: Full=Riboflavin biosynthesis protein
    7::390     4e-83  45%  410 aa  RIBBA_PROVI RecName: Full=Riboflavin biosynthesis protein
    7::388     4e-83  45%  401 aa  RIBBA_ACTPJ RecName: Full=Riboflavin biosynthesis protein
    3::384     7e-83  44%  397 aa  RIBBA_BACCN RecName: Full=Riboflavin biosynthesis protein
    5::394     9e-83  46%  423 aa  RIBBA_MYCVP RecName: Full=Riboflavin biosynthesis protein
    5::384     1e-82  44%  397 aa  RIBBA_GEOSW RecName: Full=Riboflavin biosynthesis protein
    5::394     3e-82  46%  423 aa  RIBBA_MYCGI RecName: Full=Riboflavin biosynthesis protein
    5::394     4e-82  46%  425 aa  RIBBA_MYCUA RecName: Full=Riboflavin biosynthesis protein
    5::394     4e-82  45%  425 aa  RIBBA_MYCPA RecName: Full=Riboflavin biosynthesis protein
    3::384     5e-82  43%  398 aa  RIBBA_SYNWW RecName: Full=Riboflavin biosynthesis protein
   25::389     6e-82  49%  556 aa  RIBBA_SYNY3 RecName: Full=Riboflavin biosynthesis protein
    5::394     6e-82  46%  425 aa  RIBBA_MYCMM RecName: Full=Riboflavin biosynthesis protein
    5::394     6e-82  45%  425 aa  RIBBA_MYCA1 RecName: Full=Riboflavin biosynthesis protein
   10::392     8e-82  43%  424 aa  RIBBA_CHLMU RecName: Full=Riboflavin biosynthesis protein
    4::382     2e-81  41%  393 aa  RIBBA_STAS1 RecName: Full=Riboflavin biosynthesis protein
    5::394     3e-81  45%  425 aa  RIBBA_MYCTU RecName: Full=Riboflavin biosynthesis protein
    5::394     3e-81  45%  425 aa  RIBBA_MYCTA RecName: Full=Riboflavin biosynthesis protein
    5::394     3e-81  45%  425 aa  RIBBA_MYCBT RecName: Full=Riboflavin biosynthesis protein
    5::394     3e-81  45%  425 aa  RIBBA_MYCBP RecName: Full=Riboflavin biosynthesis protein
    5::394     3e-81  45%  425 aa  RIBBA_MYCBO RecName: Full=Riboflavin biosynthesis protein
    7::390     3e-80  44%  409 aa  RIBBA_PELLD RecName: Full=Riboflavin biosynthesis protein
    7::390     2e-79  44%  405 aa  RIBBA_PARD8 RecName: Full=Riboflavin biosynthesis protein
    1::392     7e-78  43%  421 aa  RIBBA_PROA2 RecName: Full=Riboflavin biosynthesis protein
  129::514     3e-75  41%  543 aa  RIBBA_ARATH RecName: Full=Riboflavin biosynthesis protein ribBA,
    7::390     7e-75  42%  419 aa  RIBBA_PELPB RecName: Full=Riboflavin biosynthesis protein
    5::394     8e-74  43%  417 aa  RIBBA_MYCA9 RecName: Full=Riboflavin biosynthesis protein
    5::394     1e-73  41%  424 aa  RIBBA_RHOE4 RecName: Full=Riboflavin biosynthesis protein
   12::373     2e-72  43%  422 aa  RIBBA_CORGL RecName: Full=Riboflavin biosynthesis protein
   12::373     2e-72  43%  422 aa  RIBBA_CORGB RecName: Full=Riboflavin biosynthesis protein
    5::390     3e-72  41%  414 aa  RIBBA_NOCFA RecName: Full=Riboflavin biosynthesis protein
    5::394     4e-72  40%  417 aa  RIBBA_RHOSR RecName: Full=Riboflavin biosynthesis protein
   31::399     1e-68  42%  423 aa  RIBBA_CORAM RecName: Full=Riboflavin biosynthesis protein
   17::210     4e-58  56%  218 aa  RIBB_VIBSL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::210     8e-58  56%  218 aa  RIBB_VIBVY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::210     8e-58  56%  218 aa  RIBB_VIBVU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     1e-57  56%  217 aa  RIBB_ECOSM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     1e-57  56%  217 aa  RIBB_ECOLU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     2e-57  56%  217 aa  RIBB_PECCP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::215     9e-57  54%  230 aa  RIBB_VIBHA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_SHISS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_SHIFL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_SHIF8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_SHIDS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_SHIBS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_SHIB3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  54%  219 aa  RIBB_EDWI9 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_ECOUT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_ECOSE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_ECOLI RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_ECOLC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_ECOL6 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_ECOL5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_ECOK1 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_ECOHS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_ECODH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_ECOBW RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_ECO8A RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_ECO81 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_ECO7I RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_ECO5E RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_ECO57 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_ECO55 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_ECO45 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_ECO27 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     9e-57  56%  217 aa  RIBB_ECO24 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     1e-56  54%  217 aa  RIBB_SHESH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     1e-56  56%  217 aa  RIBB_ESCF3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::354     2e-56  40%  363 aa  RIBB_NEIMB RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     2e-56  55%  217 aa  RIBB_SALTY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     2e-56  55%  217 aa  RIBB_SALTI RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     2e-56  55%  217 aa  RIBB_SALSV RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     2e-56  55%  217 aa  RIBB_SALPC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     2e-56  55%  217 aa  RIBB_SALPB RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     2e-56  55%  217 aa  RIBB_SALNS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     2e-56  55%  217 aa  RIBB_SALHS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     2e-56  55%  217 aa  RIBB_SALG2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     2e-56  55%  217 aa  RIBB_SALEP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     2e-56  55%  217 aa  RIBB_SALDC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     2e-56  55%  217 aa  RIBB_SALCH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     2e-56  55%  217 aa  RIBB_SALA4 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::210     3e-56  55%  218 aa  RIBB_VIBPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     3e-56  55%  217 aa  RIBB_SALPK RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     3e-56  55%  217 aa  RIBB_SALPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     3e-56  56%  228 aa  RIBB_CHLT3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     4e-56  55%  217 aa  RIBB_ERWCT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::354     6e-56  39%  363 aa  RIBB_NEIMA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     6e-56  54%  213 aa  RIBB_CLOBL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::210     8e-56  54%  218 aa  RIBB_SHEFN RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::213     8e-56  53%  218 aa  RIBB_ERWT9 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::212     8e-56  53%  213 aa  RIBB_CLOBH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::212     8e-56  53%  213 aa  RIBB_CLOB1 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     1e-55  55%  217 aa  RIBB_SALAR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     2e-55  54%  217 aa  RIBB_SERP5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     2e-55  53%  217 aa  RIBB_PROMH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     2e-55  54%  217 aa  RIBB_CITK8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     2e-55  54%  218 aa  RIBB_HAMD5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::215     3e-55  54%  215 aa  RIBB_HAEIN RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    1::368     3e-55  35%  388 aa  RIBBA_THEMA RecName: Full=Riboflavin biosynthesis protein
   16::213     5e-55  53%  217 aa  RIBB_ENT38 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::215     6e-55  53%  215 aa  RIBB_HAEI8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::212     8e-55  52%  217 aa  RIBB_SHEWM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::210     1e-54  51%  217 aa  RIBB_DESAD RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    9::211     1e-54  52%  217 aa  RIBB_SODGM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   26::219     2e-54  53%  223 aa  RIBB_RALEJ RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     2e-54  53%  217 aa  RIBB_KLEP7 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     2e-54  53%  217 aa  RIBB_SHELP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     2e-54  53%  212 aa  RIBB_SHEHH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    4::357     2e-54  36%  364 aa  RIBB_PHOLE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     2e-54  53%  217 aa  RIBB_KLEP3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    9::209     2e-54  51%  214 aa  RIBB_DESPS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     2e-54  54%  211 aa  RIBB_BAUCH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     3e-54  53%  217 aa  RIBB_SHESA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    4::286     3e-54  42%  369 aa  RIBB_PSESM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     4e-54  53%  217 aa  RIBB_SHESR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     4e-54  53%  217 aa  RIBB_SHESM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     5e-54  53%  217 aa  RIBB_YERE8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   18::212     7e-54  54%  234 aa  RIBB_PELPD RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     9e-54  53%  217 aa  RIBB_SHESW RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     9e-54  53%  217 aa  RIBB_SHEPC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     9e-54  54%  217 aa  RIBB_DESRM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     9e-54  52%  217 aa  RIBB_DESAH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    9::214     9e-54  51%  215 aa  RIBB_DESAA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::215     1e-53  52%  215 aa  RIBB_HAEIG RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::215     1e-53  52%  215 aa  RIBB_HAEIE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     3e-53  53%  228 aa  RIBB_PHOPR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     6e-53  53%  217 aa  RIBB_YERPY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     6e-53  53%  217 aa  RIBB_YERPS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     6e-53  53%  217 aa  RIBB_YERPP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     6e-53  53%  217 aa  RIBB_YERPN RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     6e-53  53%  217 aa  RIBB_YERPG RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     6e-53  53%  217 aa  RIBB_YERPE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     6e-53  53%  217 aa  RIBB_YERPB RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     6e-53  53%  217 aa  RIBB_YERPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     6e-53  53%  217 aa  RIBB_YERP3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   19::212     6e-53  54%  217 aa  RIBB_VIBFI RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     6e-53  52%  212 aa  RIBB_SHEPW RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    9::209     6e-53  51%  214 aa  RIBB_PASMU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     1e-52  52%  217 aa  RIBB_SHEON RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::215     2e-52  50%  218 aa  RIBB_VIBCM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::215     2e-52  50%  218 aa  RIBB_VIBCH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    4::338     2e-52  38%  363 aa  RIBB_PHOPO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    2::294     3e-52  42%  344 aa  RIBB_HELPY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    6::293     3e-52  40%  355 aa  RIBB_HELHP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::208     3e-52  51%  211 aa  RIBB_BUCBP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    9::208     4e-52  50%  217 aa  RIBB_PSEHT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    9::208     4e-52  51%  214 aa  RIBB_HAES2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     4e-52  52%  217 aa  RIBB_ENTS8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    9::208     7e-52  51%  212 aa  RIBB_HAES1 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    9::209     9e-52  51%  214 aa  RIBB_MANSM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::215     1e-51  50%  218 aa  RIBB_VIBC3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     1e-51  51%  212 aa  RIBB_SHEPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    4::255     1e-51  42%  365 aa  RIBB_PSEAE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    5::321     1e-51  39%  339 aa  RIBB_CAMJE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     2e-51  50%  219 aa  RIBB_DESDG RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     3e-51  52%  217 aa  RIBB_TOLAT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::311     3e-51  37%  356 aa  RIBB_DEHMU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     3e-51  51%  217 aa  RIBB_SHEB9 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     3e-51  51%  217 aa  RIBB_SHEB2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     3e-51  50%  215 aa  RIBB_BUCAT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     3e-51  50%  215 aa  RIBB_BUCAI RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     3e-51  50%  215 aa  RIBB_BUCA5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     4e-51  51%  217 aa  RIBB_SHEB8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     4e-51  51%  217 aa  RIBB_SHEB5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    2::290     4e-51  42%  344 aa  RIBB_HELPJ RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::217     7e-51  50%  217 aa  RIBB_PELCD RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::211     7e-51  47%  213 aa  RIBB_BLOFL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::209     1e-50  52%  222 aa  RIBB_CHLL2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     1e-50  49%  213 aa  RIBB_WIGBR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    1::340     5e-50  37%  378 aa  RIBA_ARCFU RecName: Full=GTP cyclohydrolase-2;       
   16::213     6e-50  50%  217 aa  RIBB_PHOLL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    6::198     8e-50  47%  213 aa  RIBB_AGRT5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   21::210     1e-49  52%  230 aa  RIBB_BORPE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   21::210     1e-49  52%  230 aa  RIBB_BORPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   21::210     1e-49  52%  230 aa  RIBB_BORBR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    4::286     1e-49  39%  347 aa  RIBB_WOLSU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   34::217     3e-49  52%  227 aa  RIBB_RALSO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     2e-48  49%  214 aa  RIBB_RHORT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    9::209     1e-47  49%  214 aa  RIBB_DESVV RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     1e-47  48%  213 aa  RIBB_BUCAP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    9::209     3e-47  48%  214 aa  RIBB_DESVH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   12::204     4e-46  47%  210 aa  RIBB_CHRVO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   33::209     2e-45  52%  217 aa  RIBB_AERS4 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    5::203     8e-45  45%  219 aa  RIBB_METLZ RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   33::209     1e-44  50%  217 aa  RIBB_AERHH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    5::205     3e-43  45%  208 aa  RIB3_YEAST RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   18::211     3e-43  45%  223 aa  RIBB_DESDA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    5::199     1e-42  45%  207 aa  RIBB_OCEIH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::207     1e-42  45%  216 aa  RIBB_PSEPK RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    4::199     7e-41  44%  204 aa  RIB3_SCHPO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    8::201     3e-37  39%  204 aa  RIB3_CANAL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::156     8e-37  51%  192 aa  RIBA_PICTO RecName: Full=GTP cyclohydrolase-2;       
   15::181     2e-34  46%  192 aa  RIBA_HELPY RecName: Full=GTP cyclohydrolase-2;       
   15::181     2e-34  46%  192 aa  RIBA_HELP2 RecName: Full=GTP cyclohydrolase-2;       
   32::181     8e-34  49%  192 aa  RIBA_HELPH RecName: Full=GTP cyclohydrolase-2;       
   52::188     1e-33  51%  202 aa  RIBA_MARMS RecName: Full=GTP cyclohydrolase-2;       
   15::181     1e-33  45%  192 aa  RIBA_HELPS RecName: Full=GTP cyclohydrolase-2;       
   14::176     1e-33  43%  193 aa  RIBA_CAMHC RecName: Full=GTP cyclohydrolase-2;       
   15::181     2e-33  45%  192 aa  RIBA_HELAH RecName: Full=GTP cyclohydrolase-2;       
   15::181     2e-33  46%  192 aa  RIBA_HELPJ RecName: Full=GTP cyclohydrolase-2;       
  168::374     3e-33  38%  385 aa  RIBA_AZOBR RecName: Full=GTP cyclohydrolase-2;       
    6::183     2e-32  44%  209 aa  RIBA_SHEPA RecName: Full=GTP cyclohydrolase-2;       
   47::185     2e-32  49%  199 aa  RIBA_VIBF1 RecName: Full=GTP cyclohydrolase-2;       
   47::185     3e-32  49%  200 aa  RIBA_PSYIN RecName: Full=GTP cyclohydrolase-2;       
   47::185     3e-32  49%  199 aa  RIBA_VIBFM RecName: Full=GTP cyclohydrolase-2;       
   32::156     3e-32  52%  195 aa  RIBA_THEVO RecName: Full=GTP cyclohydrolase-2;       
   14::179     3e-32  43%  195 aa  RIBA_CAMFF RecName: Full=GTP cyclohydrolase-2;       
    6::184     3e-32  47%  200 aa  RIBA_ACIB5 RecName: Full=GTP cyclohydrolase-2;       
    6::184     3e-32  45%  200 aa  RIBA_ACIAD RecName: Full=GTP cyclohydrolase-2;       
    6::164     4e-32  49%  200 aa  RIBA_ACIBY RecName: Full=GTP cyclohydrolase-2;       
    6::164     4e-32  49%  200 aa  RIBA_ACIBT RecName: Full=GTP cyclohydrolase-2;       
    6::164     4e-32  49%  200 aa  RIBA_ACIBS RecName: Full=GTP cyclohydrolase-2;       
    6::164     4e-32  49%  200 aa  RIBA_ACIBC RecName: Full=GTP cyclohydrolase-2;       
    6::164     4e-32  49%  200 aa  RIBA_ACIB3 RecName: Full=GTP cyclohydrolase-2;       
    6::183     6e-32  43%  205 aa  RIBA_SHESH RecName: Full=GTP cyclohydrolase-2;       
    6::183     6e-32  44%  209 aa  RIBA_SHEHH RecName: Full=GTP cyclohydrolase-2;       
    6::183     1e-31  43%  205 aa  RIBA_SHEPW RecName: Full=GTP cyclohydrolase-2;       
   47::185     2e-31  48%  198 aa  RIBA_VIBPA RecName: Full=GTP cyclohydrolase-2;       
    8::184     2e-31  41%  197 aa  RIBA_NEIMF RecName: Full=GTP cyclohydrolase-2;       
    8::184     2e-31  41%  197 aa  RIBA_NEIMB RecName: Full=GTP cyclohydrolase-2;       
    8::184     2e-31  41%  197 aa  RIBA_NEIM0 RecName: Full=GTP cyclohydrolase-2;       
    3::183     2e-31  45%  207 aa  RIBA_HAHCH RecName: Full=GTP cyclohydrolase-2;       
   37::185     2e-31  46%  198 aa  RIBA_VIBCH RecName: Full=GTP cyclohydrolase-2;       
    6::183     3e-31  44%  203 aa  RIBA_SHEON RecName: Full=GTP cyclohydrolase-2;       
    6::183     4e-31  44%  203 aa  RIBA_SHESM RecName: Full=GTP cyclohydrolase-2;       
    6::183     4e-31  43%  205 aa  RIBA_SHEAM RecName: Full=GTP cyclohydrolase-2;       
   37::185     5e-31  46%  198 aa  RIBA_VIBVU RecName: Full=GTP cyclohydrolase-2;       
    6::183     6e-31  44%  203 aa  RIBA_SHESW RecName: Full=GTP cyclohydrolase-2;       
    6::183     6e-31  44%  203 aa  RIBA_SHEPC RecName: Full=GTP cyclohydrolase-2;       
   44::184     6e-31  46%  197 aa  RIBA_NEIMA RecName: Full=GTP cyclohydrolase-2;       
   15::182     6e-31  41%  202 aa  RIBA_COLP3 RecName: Full=GTP cyclohydrolase-2;       
    6::183     8e-31  44%  203 aa  RIBA_SHESR RecName: Full=GTP cyclohydrolase-2;       
   44::184     8e-31  47%  197 aa  RIBA_NEIG1 RecName: Full=GTP cyclohydrolase-2;       
   49::185     8e-31  49%  199 aa  RIBA_ALISL RecName: Full=GTP cyclohydrolase-2;       
    6::183     1e-30  43%  205 aa  RIBA_SHEWM RecName: Full=GTP cyclohydrolase-2;       
    3::183     1e-30  42%  202 aa  RIBA_SHEFN RecName: Full=GTP cyclohydrolase-2;       
    6::183     1e-30  44%  204 aa  RIBA_SHEB5 RecName: Full=GTP cyclohydrolase-2;       
    6::183     2e-30  44%  203 aa  RIBA_SHESA RecName: Full=GTP cyclohydrolase-2;       
    6::183     2e-30  44%  204 aa  RIBA_SHEB9 RecName: Full=GTP cyclohydrolase-2;       
    6::183     2e-30  44%  204 aa  RIBA_SHEB8 RecName: Full=GTP cyclohydrolase-2;       
    6::183     2e-30  44%  204 aa  RIBA_SHEB2 RecName: Full=GTP cyclohydrolase-2;       
   15::224     2e-30  38%  233 aa  RIB3_MAGGR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::183     5e-30  46%  199 aa  RIBA_TERTT RecName: Full=GTP cyclohydrolase-2;       
    3::183     7e-30  44%  205 aa  RIBA_PSEPW RecName: Full=GTP cyclohydrolase-2;       
    3::183     2e-29  44%  205 aa  RIBA_PSEPK RecName: Full=GTP cyclohydrolase-2;       
    3::183     2e-29  44%  205 aa  RIBA_PSEPG RecName: Full=GTP cyclohydrolase-2;       
    3::183     2e-29  44%  205 aa  RIBA_PSEP1 RecName: Full=GTP cyclohydrolase-2;       
    3::183     2e-29  44%  205 aa  RIBA_PSEE4 RecName: Full=GTP cyclohydrolase-2;       
   28::160     2e-29  47%  194 aa  RIBA_HELHP RecName: Full=GTP cyclohydrolase-2;       
    3::183     2e-29  42%  208 aa  RIBA_AZOVD RecName: Full=GTP cyclohydrolase-2;       
    9::185     4e-29  43%  216 aa  RIBA_HAEIN RecName: Full=GTP cyclohydrolase-2;       
    9::185     4e-29  43%  216 aa  RIBA_HAEIG RecName: Full=GTP cyclohydrolase-2;       
    9::185     4e-29  43%  216 aa  RIBA_HAEI8 RecName: Full=GTP cyclohydrolase-2;       
    4::184     4e-29  41%  197 aa  RIBA_AERHH RecName: Full=GTP cyclohydrolase-2;       
    3::183     5e-29  44%  205 aa  RIBA_PSESM RecName: Full=GTP cyclohydrolase-2;       
   45::182     5e-29  50%  198 aa  RIBA_BURMA RecName: Full=GTP cyclohydrolase-2;       
    6::183     6e-29  42%  205 aa  RIBA_SHELP RecName: Full=GTP cyclohydrolase-2;       
  181::334     1e-28  42%  398 aa  RIBA_XYLFA RecName: Full=GTP cyclohydrolase-2;       
   36::185     1e-28  44%  219 aa  RIBA_PASMU RecName: Full=GTP cyclohydrolase-2;       
    4::184     1e-28  40%  217 aa  RIBA_ACTSZ RecName: Full=GTP cyclohydrolase-2;       
    4::184     2e-28  42%  197 aa  RIBA_TOLAT RecName: Full=GTP cyclohydrolase-2;       
   30::185     2e-28  46%  200 aa  RIBA_PHOPO RecName: Full=GTP cyclohydrolase-2;       
   19::185     2e-28  41%  216 aa  RIBA_HAEIE RecName: Full=GTP cyclohydrolase-2;       
  181::354     3e-28  39%  398 aa  RIBA_XYLFT RecName: Full=GTP cyclohydrolase-2;       
    3::183     3e-28  41%  205 aa  RIBA_SHEDO RecName: Full=GTP cyclohydrolase-2;       
    3::183     5e-28  42%  205 aa  RIBA_PSEFS RecName: Full=GTP cyclohydrolase-2;       
    3::183     1e-27  44%  205 aa  RIBA_PSEAE RecName: Full=GTP cyclohydrolase-2;       
    3::183     1e-27  44%  205 aa  RIBA_PSEAB RecName: Full=GTP cyclohydrolase-2;       
    3::183     1e-27  44%  205 aa  RIBA_PSEA8 RecName: Full=GTP cyclohydrolase-2;       
    1::130     1e-27  45%  141 aa  RIBA_DEHMU RecName: Full=GTP cyclohydrolase-2;       
  163::285     1e-27  52%  326 aa  RIB1_SCHPO RecName: Full=Probable GTP cyclohydrolase-2;       
    3::183     2e-27  43%  200 aa  RIBA_SACD2 RecName: Full=GTP cyclohydrolase-2;       
    3::184     2e-27  38%  199 aa  RIBA_BUCBP RecName: Full=GTP cyclohydrolase-2;       
   44::186     3e-27  45%  219 aa  RIBA_MANSM RecName: Full=GTP cyclohydrolase-2;       
   31::173     3e-27  49%  221 aa  RIBA_STRCO RecName: Full=GTP cyclohydrolase-2;       
   16::183     3e-27  43%  196 aa  RIBA_SHISS RecName: Full=GTP cyclohydrolase-2;       
   16::183     3e-27  43%  196 aa  RIBA_SHIFL RecName: Full=GTP cyclohydrolase-2;       
   16::183     3e-27  43%  196 aa  RIBA_SHIF8 RecName: Full=GTP cyclohydrolase-2;       
   16::183     3e-27  43%  196 aa  RIBA_SHIDS RecName: Full=GTP cyclohydrolase-2;       
   16::183     3e-27  43%  196 aa  RIBA_SHIBS RecName: Full=GTP cyclohydrolase-2;       
    3::183     3e-27  42%  205 aa  RIBA_PSEA7 RecName: Full=GTP cyclohydrolase-2;       
   16::183     3e-27  43%  196 aa  RIBA_ECOSM RecName: Full=GTP cyclohydrolase-2;       
   16::183     3e-27  43%  196 aa  RIBA_ECOSE RecName: Full=GTP cyclohydrolase-2;       
   16::183     3e-27  43%  196 aa  RIBA_ECOLU RecName: Full=GTP cyclohydrolase-2;       
   16::183     3e-27  43%  196 aa  RIBA_ECOLI RecName: Full=GTP cyclohydrolase-2;       
   16::183     3e-27  43%  196 aa  RIBA_ECOLC RecName: Full=GTP cyclohydrolase-2;       
   16::183     3e-27  43%  196 aa  RIBA_ECOHS RecName: Full=GTP cyclohydrolase-2;       
   16::183     3e-27  43%  196 aa  RIBA_ECODH RecName: Full=GTP cyclohydrolase-2;       
   16::183     3e-27  43%  196 aa  RIBA_ECOBW RecName: Full=GTP cyclohydrolase-2;       
   16::183     3e-27  43%  196 aa  RIBA_ECO8A RecName: Full=GTP cyclohydrolase-2;       
   16::183     3e-27  43%  196 aa  RIBA_ECO7I RecName: Full=GTP cyclohydrolase-2;       
   16::183     3e-27  43%  196 aa  RIBA_ECO5E RecName: Full=GTP cyclohydrolase-2;       
   16::183     3e-27  43%  196 aa  RIBA_ECO57 RecName: Full=GTP cyclohydrolase-2;       
   16::183     3e-27  43%  196 aa  RIBA_ECO55 RecName: Full=GTP cyclohydrolase-2;       
   16::183     3e-27  43%  196 aa  RIBA_ECO27 RecName: Full=GTP cyclohydrolase-2;       
   16::183     3e-27  43%  196 aa  RIBA_ECO24 RecName: Full=GTP cyclohydrolase-2;       
   16::183     4e-27  43%  196 aa  RIBA_ECOL6 RecName: Full=GTP cyclohydrolase-2;       
   16::183     4e-27  43%  196 aa  RIBA_ECOL5 RecName: Full=GTP cyclohydrolase-2;       
   16::183     4e-27  43%  196 aa  RIBA_ECO81 RecName: Full=GTP cyclohydrolase-2;       
   16::183     4e-27  43%  196 aa  RIBA_ECO45 RecName: Full=GTP cyclohydrolase-2;       
    5::163     6e-27  41%  199 aa  RIBA_PROMH RecName: Full=GTP cyclohydrolase-2;       
   16::163     7e-27  45%  200 aa  RIBA_KLEP7 RecName: Full=GTP cyclohydrolase-2;       
   16::163     7e-27  45%  200 aa  RIBA_KLEP3 RecName: Full=GTP cyclohydrolase-2;       
   16::183     1e-26  42%  199 aa  RIBA_BLOFL RecName: Full=GTP cyclohydrolase-2;       
    5::183     2e-26  41%  196 aa  RIBA_SALTY RecName: Full=GTP cyclohydrolase-2;       
    5::183     2e-26  41%  196 aa  RIBA_SALTI RecName: Full=GTP cyclohydrolase-2;       
    5::183     2e-26  41%  196 aa  RIBA_SALPA RecName: Full=GTP cyclohydrolase-2;       
    5::183     2e-26  41%  196 aa  RIBA_SALCH RecName: Full=GTP cyclohydrolase-2;       
   48::184     2e-26  44%  216 aa  RIBA_HAES2 RecName: Full=GTP cyclohydrolase-2;       
   48::184     2e-26  44%  216 aa  RIBA_HAES1 RecName: Full=GTP cyclohydrolase-2;       
   16::183     2e-26  42%  196 aa  RIBA_ENT38 RecName: Full=GTP cyclohydrolase-2;       
   16::183     3e-26  42%  196 aa  RIBA_SHIB3 RecName: Full=GTP cyclohydrolase-2;       
   16::183     3e-26  42%  196 aa  RIBA_CITK8 RecName: Full=GTP cyclohydrolase-2;       
   41::161     4e-26  50%  194 aa  RIBA_BUCAI RecName: Full=GTP cyclohydrolase-2;       
  164::290     5e-26  48%  332 aa  RIB1_PICGU RecName: Full=GTP cyclohydrolase-2;       
   16::163     8e-26  44%  198 aa  RIBA_ESCF3 RecName: Full=GTP cyclohydrolase-2;       
   47::158     1e-25  50%  196 aa  RIBA_BUCAP RecName: Full=GTP cyclohydrolase-2;       
   16::183     3e-25  41%  197 aa  RIBA_ENTS8 RecName: Full=GTP cyclohydrolase-2;       
   16::183     5e-25  41%  197 aa  RIBA_ERWCT RecName: Full=GTP cyclohydrolase-2;       
   16::183     9e-25  41%  196 aa  RIBA_YERPS RecName: Full=GTP cyclohydrolase-2;       
   16::183     9e-25  41%  196 aa  RIBA_YERPE RecName: Full=GTP cyclohydrolase-2;       
   18::183     1e-24  41%  196 aa  RIBA_HAMD5 RecName: Full=GTP cyclohydrolase-2;       
   47::183     2e-24  44%  197 aa  RIBA_WIGBR RecName: Full=GTP cyclohydrolase-2;       
    2::221     3e-24  36%  227 aa  RIBB_METJA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   47::163     1e-22  47%  199 aa  RIBA_BAUCH RecName: Full=GTP cyclohydrolase-2;       
   85::260     4e-22  37%  345 aa  RIB1_YEAST RecName: Full=GTP cyclohydrolase-2;       
   23::183     2e-21  39%  199 aa  RIBA_BLOPB RecName: Full=GTP cyclohydrolase-2;       
    7::222     4e-20  31%  229 aa  RIBB_METTH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::237     1e-17  30%  247 aa  RIBB_METMA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::237     4e-17  29%  247 aa  RIBB_METAC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    6::227     6e-15  31%  238 aa  RIBB_ARCFU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
  236::329     8e-07  33%  444 aa  URC1_SACKL RecName: Full=Putative GTP cyclohydrolase URC1;AltName:
  267::329     7e-06  40%  439 aa  URG1_SCHPO RecName: Full=Uracil-regulated protein 1;       
    1::403

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MFEQIKNNVENAIEALKQGKPVVVLDDYDRENEGDLILPGQKATEENIAFMLEHTSGIICLAMDSKKARE
RIBBA_THEPX     ------DRIEDAIEDIKQGKMIIVVDDENRENEGDLVMAAEKVTGEHINFMIKYGRGLVCVPMTEKRLNE
RIBBA_THEP3     ------DRIEDAIEDIKQGKMIIVVDDENRENEGDLVMAAEKVTGEHINFMIKYGRGLVCVPMTEKRLNE
RIBBA_AQUAE     ------NTVEEAIEDIRQGKMVIVVDDPDRENEGDLVMAAEKVTPEAINFMAKYGRGLICLSLTPERCEQ
RIBBA_CYTH3     --EQIKDSIADAIEAIRKGEVIIVVDDEDRENEGDFICAAECVTPEIINFMSKEGRGLICAPISEARCTE
RIBBA_STAAC     ------DNIDSALMALKNGEPIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSKDIAQR
RIBBA_STAAW     ------DNIDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSKDIAQR
RIBBA_STAAS     ------DNIDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSKDIAQR
RIBBA_STAAR     ------DNIDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSKDIAQR
RIBBA_STAAN     ------DNIDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSKDIAQR
RIBBA_STAAM     ------DNIDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSKDIAQR
RIBBA_UNCTG     MKNKVFASIGDAVKDIKVGRMVIVVDDPGRENEGDLICAAEKASPEVINFMTKYARGLICVPMKHERLKE
RIBBA_BACV8     --EELKNTIEEAIADFREGKFVIVVDDEDRENEGDLIVAAEKITPEQVNFMLKHARGVLCAPITISRCKE
RIBBA_BACTN     --EEIKDRIEDAIADFKEGKFVIVVDDEDRENEGDLIIAAEKITPEKVNFMLKHARGVLCAPITVSRCKE
RIBBA_STAEQ     ------DTIELAIEALRNGESIIVVDDEDRENEGDLVAVTEWMDDNTINFMAREGRGLICAPIDKSIAER
RIBBA_BACWK     ------HRIEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEEYAER
RIBBA_BREBN     ------HSIEEALEDLRQGKAVIVVDDEDRENEGDFVCMAEAATPEMINFMVTHGRGLVCVPVTEEHATR
RIBBA_BACSK     MFESI----DEAITQLKAGGMILVVDDEDRENEGDFLALAETASPETINFMATHGRGLICVPLTEEQAER
RIBBA_STAES     ------DTIELAIEALRNGESIIVVDDEDRENEGDLVAVTEWMDDNTINFMAKEGRGLICAPIDKSIAER
RIBBA_SALTO     --------IEQAMAEILAGRPVVVVDDANRENEGDLIFAAELATPELVAFMVRYTSGYICASLTEDDCDR
RIBBA_BACFR     ------NTIEEAIADFKEGNFVIVVDDEDRENEGDFIIAAEKITPEKVNFMLTHGRGVLCAPITEERCAE
RIBBA_BACFN     ------NTIEEAIADFKEGNFVIVVDDEDRENEGDFIIAAEKITPEKVNFMLTHGRGVLCAPITEERCAE
RIBBA_CLONN     --EQFKNTIEEAIEDIKNGKMXXXXXXXXXXXXXXLLMAAEKVTPEAINFMAKYARGLICMPMTEEKLKE
RIBBA_CHLTR     -------SVQQAIKDVAEGKFVIVIDAASRENEGDLILAGEKVSTEKMSFLLSHTTGIVCASLSREQAKS
RIBBA_BACA2     --------IEEALEALKKGEVIIVVDDEDRENEGDFVALAEHATPEVVNFMATHGRGLICTPLSEDIAGR
RIBBA_SALAI     --------IEQAMAEIVAGRPVVVVDDANRENEGDLIFAAELATPELVAFMVRYTSGYICAPLTEDECDR
RIBBA_BACCR     ------HRIEEALEDLKKGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_BACCQ     ------HRIEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_BACC7     ------HRIEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_BACHK     ------HRIEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_BACC3     ------HRIEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_BACAN     ------HRIEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_BACAH     ------HRIEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_BACAC     ------HRIEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_BACAA     ------HRIEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_BACSU     --------IEEALDALKKGEVIIVVDDEDRENEGDFVALAEHATPEVINFMATHGRGLICTPLSEEIADR
RIBBA_BACC2     ------HRIEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_BACC1     ------HRIEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_BACC4     ------HRIEEALEDLKKGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_BACC0     ------HRIEEALEDLKQGKVVIVCDDENRENEGDFMALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_CHLPN     -------SLERAIEDLRAGKFVIVVDEASREDEGDLIIAGEKITVEKMTFLLQHTTGVVCAALSQERLLS
RIBBA_BACCZ     ------HRIEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_ACTP7     ------SKVEDAIEAIRQGKIILVTDDEDRENEGDFICAAEFATPENINFMATYGKGLICTPISTEIAKK
RIBBA_BACAM     --------IEEALEALKKGEVIIVVDDEDRENEGDFVALAEHATPEVVNFMATHGRGLICTPLSEDIAGR
RIBBA_STAHJ     ------DEIKDALNALKRGESIIVVDDEDRENEGDLVAITQWMNDNTINFMAKEGRGLICAPISKDLALK
RIBBA_ACTPL     ------SKVEDAIEAIRQGKIILVTDDEDRENEGDFICAAEFATPENINFMATYGKGLICTPISTEIAKK
RIBBA_ACTP2     ------SKVEDAIEAIRQGKIILVTDDEDRENEGDFICAAEFATPENINFMATYGKGLICTPISTEIAKK
RIBBA_PORGI     --EEIKNTIEEALEDFKEGKFLIVVDDEDRENEGDFIIAAEKITPDKVNFMMHHGRGVLCAPISEERAHE
RIBBA_PORG3     --EEIKNTIEEALEDFKEGKFLIVVDDEDRENEGDFIIAAEKITPDKVNFMMHHGRGVLCAPISEERAHE
RIBBA_PROVI     ------DTIESALEDIGQGKLVIVIDDEERENEGDFIAAADKVTTEMINFITKEARGLLCVAVTMDRAKE
RIBBA_ACTPJ     ------SKVEDAIEAIRQGKIILVTDDEDRENEGDFICAAEFATPENINFMATYGKGLICTPISTEIAKK
RIBBA_BACCN     ------HRIEEALEDLKQGKVIIVCDDKNRENEGDFLALAEYITPETINFMITHGRGLVCVPLPEHYAKR
RIBBA_MYCVP     ------DSVERAVADIAAGKAVVVIDDEDRENEGDLIFAAEKATPELVAFMVRYTSGYLCVPLAGDICDR
RIBBA_GEOSW     --------IEEAIYELMQGKVIIVCDDEDRENEGDFVALAEKATPEVINFMIKYGRGLVCVPITEELADK
RIBBA_MYCGI     ------DSVERAVADIAAGKAVVVIDDEDRENEGDLIFAAEKATPELVAFMVRYTSGYLCVPLAGEICDR
RIBBA_MYCUA     ------DSVERAVADIGAGKAVIVIDDEDRENEGDLIFAAEKATPELVAFMVRYTSGYLCVPLDGAVCDR
RIBBA_MYCPA     ------DSVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDR
RIBBA_SYNWW     ------SSIEEVIQDIKEGKMIVLVDDEDRENEGDVIIAAEKAGPEAINFMATHAKGLICMPIIGERLDE
RIBBA_SYNY3     ----------------------------NRENEGDLICAAQFATPALVNFMAVEARGLICLAMTGDRLDE
RIBBA_MYCMM     ------DSVERAVADIGAGKAVIVIDDEDRENEGDLIFAAEKATPELVAFMVRYTSGYLCVPLDGAVCDR
RIBBA_MYCA1     ------DSVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDR
RIBBA_CHLMU     -------SVQQAIKDIADGNFVIVIDRESRENEGDLILAGEKVSAEKMAFLLSHTTGIVCASVTREQARV
RIBBA_STAS1     ------DSIDTALQALKKGESIIVVDDENRENEGDLVAVTEWMNDNTVNFMATYGKGLICAPISNAIAEK
RIBBA_MYCTU     ------DSVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDR
RIBBA_MYCTA     ------DSVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDR
RIBBA_MYCBT     ------DSVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDR
RIBBA_MYCBP     ------DSVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDR
RIBBA_MYCBO     ------DSVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDR
RIBBA_PELLD     ------DTIESAVEDIRQGKLVIVIDDEDRENEGDFIAAADHVTTEMINFITREARGLLCVAVTMERARE
RIBBA_PARD8     ------NTIEEAIEDFREGKFLIVVDDEDRENEGDFIIAAEKVTPEKINFMLKNGRGVLCAPITEERCQE
RIBBA_PROA2     MSEKKIDSIESAIEDLKNGKLIIVIXXXXXXXXXXFIAAADKVTPEMVNFITKEARGLLCVAVTMDRAKE
RIBBA_ARATH     ------SSIPEAIEDIRQGKLXXXXXXXXXXXXXXLVMAAQLATPEAMAFIVRHGTGIVCVSMKEDDLER
RIBBA_PELPB     ------DTIDAALEDIRQGKLVIVIXXXXXXXXXXFIGAADKVTNEMVNFITREARGLLCVAVTMDRAKE
RIBBA_MYCA9     ------DSIERAVADIAAGKAXXXXXXXXXXXXXXLIFAAEKATPELVAFMVRYTSGYLCVPLAGEDCDR
RIBBA_RHOE4     ------DSIERAVADIAAGKAXXXXXXXXXXXXXXLIFAAEKATPELVAFMVRYTSGYLCVPLDGDDCDR
RIBBA_CORGL     ------DSVEEAIADIAAGKAXXXXXXXXXXXXXXIIFAAELATPELVAFMVRYSSGYICAPLTAKDADR
RIBBA_CORGB     ------DSVEEAIADIAAGKAXXXXXXXXXXXXXXIIFAAELATPELVAFMVRYSSGYICAPLTAKDADR
RIBBA_NOCFA     ------DTIERAVADIAAGKAXXXXXXXXXXXXXXLIFAAEKATPELVAFMIRYTSGYICVPLTGEDCDR
RIBBA_RHOSR     ------DSIERAVADIAAGKAXXXXXXXXXXXXXXLIFAAEKATPELVAFMVRYTSGYLCVPLDGADCDR
RIBBA_CORAM     -------------------------DNEDRENEGDLIFAAELATPELVAFMVRYSSGYICVPLLPEDCKR
RIBB_VIBSL      --------VENALQALREGRGVLLLDDEDRENEGDIIYSVEHLTNAQMALMIRECSGIVCLCLTDEQANQ
RIBB_VIBVY      --------VENALLALKEGRGVLLLDDEDRENEGDIIYSVEHLTNAQMALMIRECSGIVCLCLTDEHANK
RIBB_VIBVU      --------VENALLALKEGRGVLLLDDEDRENEGDIIYSVEHLTNAQMALMIRECSGIVCLCLTDEHANK
RIBB_ECOSM      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECOLU      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_PECCP      --------VERALDALRHGRGVLVLDDEDRENEGDMIFSAENMTVEQMALTIRHGSGIVCLCLTEERRQQ
RIBB_VIBHA      --------VERAIEALKNGLGVLLMDDEDRENEGDLIFSAQHLTEAQMALMIREGSGIVCLCLTEERANW
RIBB_SHISS      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SHIFL      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SHIF8      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SHIDS      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SHIBS      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SHIB3      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_EDWI9      --------VERALSALRDGRGVMVLDDENRENEGDMIFAAEKMTVEQMALTIRHGSGIVCLCITEARRQQ
RIBB_ECOUT      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITDDRRKQ
RIBB_ECOSE      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECOLI      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECOLC      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECOL6      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITDDRRKQ
RIBB_ECOL5      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECOK1      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITDDRRKQ
RIBB_ECOHS      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECODH      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECOBW      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECO8A      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECO81      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITDDRRKQ
RIBB_ECO7I      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECO5E      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECO57      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECO55      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECO45      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITDDRRKQ
RIBB_ECO27      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITDDRRKQ
RIBB_ECO24      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SHESH      --------VETALISLKQGRGVLVVDDEDRENEGDLIYSAETLTNEQMALLIREGSGIVCLCLPDERVKH
RIBB_ESCF3      --------VENALAALREGRGVMVLDDEDRENEGDMIFPAETMTIEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_NEIMB      ---------------IKAGKMVIITDAEDRENEGDLLMAAQFVTPEAINFMIKHARGLVCLPMDGEMVEK
RIBB_SALTY      --------VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALTI      --------VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALSV      --------VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALPC      --------VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALPB      --------VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALNS      --------VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALHS      --------VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALG2      --------VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALEP      --------VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALDC      --------VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALCH      --------VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALA4      --------VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_VIBPA      --------VENALIALKEGRGVLLLDDEDRENEGDIIYSVEHLTNEQMALMIRECSGIVCLCLTDAQADK
RIBB_SALPK      --------VELALDALREGRGVMVLDDEDRENEGDMIFPAEIMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALPA      --------VELALDALREGRGVMVLDDEDRENEGDMIFPAEIMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_CHLT3      --------VENALTALRSGKGILVSDSPDRENEADLIFSAEFLTETQMAMLIRECSGIVCLCLTTEKVQA
RIBB_ERWCT      --------VERALDALRHGRGVLVLDDEDRENEGDMIFSAESMTVEQMALTIRHGSGIVCLCLTEERRQQ
RIBB_NEIMA      ---------------IKVGKMVIITDAEDRENEGDLLMAAQFVTPEAINFMIKHARGLVCLPMDGEMVEK
RIBB_CLOBL      --------VEKALENLKNGKGVLLVDDENRENEGDLIFPAETITVPQMAMLIRECSGIVCLCLTDEKVKK
RIBB_SHEFN      --------VENALAALREGRGVLLLDDEDRENEGDIIYSVEHLTTAQMALMIRECSGIVCLCLTDEHANK
RIBB_ERWT9      -----EQRVTHAIEALRAGRGVMVLDDEDRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLNEERLEQ
RIBB_CLOBH      --------VEKALENLKNGKGVLLVDDENRENEGDLIFPAETITVPQMVMLIRECSGIVCLCLTDKKVKK
RIBB_CLOB1      --------VEKALENLKNGKGVLLVDDENRENEGDLIFPAETITVPQMVMLIRECSGIVCLCLTDKKVKK
RIBB_SALAR      --------VELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SERP5      --------VERALEALRNGRGVMVLDDENRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLTEERRQQ
RIBB_PROMH      --------VERALEALRAGKGVMVLDDENRENEGDMVFVAETMTTEQMAMSIRHGSGIVCVCITEERRQQ
RIBB_CITK8      --------VEHALSALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_HAMD5      --------VKKALENLKNGHGVMVLDDENRENEGDFVFAAETMTVEQMALTIRHGSGIVCLCLTEERCQQ
RIBB_HAEIN      -----EERVLNAINAFKNGTGVLVLDDEDRENEGDLIFPAETITPEQMAKLIRYGSGIVCLCITDERCQQ
RIBBA_THEMA     --------MEELREAFEEGKPVILIDR-NRENEADFVFPAQLITEDVVSFFVTYGKGLFCVTADEEDLLK
RIBB_ENT38      --------VEHALDALREGRGVMVLDDEHRENEGDMIFAAENMTVEQMALTIRHGSGIVCLCINEERRKQ
RIBB_HAEI8      -----EERVLNAINAFKHGTGVLVLDDEDRENEGDLIFPAETITSEQMAKLIRYGSGIVCLCITDERCQQ
RIBB_SHEWM      --------VEAALTSLRQGQGVLVVDDEDRENEGDLIYSAQSLTNEQMALLIRECSGIVCLCLTDERIKQ
RIBB_DESAD      --------VEKGLQALREGRGILVTDNESRENEGDLIFSAEKLSDEQMAMMIRECSGIVCLCLTDEKTEQ
RIBB_SODGM      -FGSPSQRVENALESLRNGRGVLVLDDEDRENEGDMIFAAQNMTVEQMALTIRYGSGIVCLCLTEERRQQ
RIBB_RALEJ      --------IAQALDAMREGRPVVLLDDDDRENEADLILAAECLTPSNMAMMIRECSGIVCLCLTTDKVRQ
RIBB_KLEP7      --------VEHALDALREGRGVMVLDDEDRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLTEERRKQ
RIBB_SHELP      --------VEAALTALRAGQGVLVVDDEDRENEGDLIYSAEHLTQEQMALLIRECSGIVCLCLTDERVKQ
RIBB_SHEHH      --------VNAALTALRQGKGVLVVDDEDRENEGDLIYSAETLTNEQMALLIRECSGIVCLCLTDERIEQ
RIBB_PHOLE      ------SSAKEIIDDIRQGRMVILMDDESRENEGDLIIASEMVTPEAINFMATHGRGLICLTLSKARCKT
RIBB_KLEP3      --------VEHALDALREGRGVMVLDDEDRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLTEDRRKQ
RIBB_DESPS      -FGDAQQRVEKSLQALRQGEGVLLVDDEDRENEGDLIYSAEHLTAKQMALMIREGSGIVCLCLTGEKVDE
RIBB_BAUCH      --------VEIALQALRHGRGVLVLDNEDRENEGDMIFAAEKMTIEQMALAIRYGSGIICLCLTEERRQQ
RIBB_SHESA      --------VEAGLEALRQGQGVLVVDDEDRENEGDLIFAAESLTNAQMAMLIRECSGIVCLCLPDEKVKA
RIBB_PSESM      ------DRIEDIIEDYRQGKMVLLVDDEDRENEGDLLLAADCCTAQAISFMAREARGLICLTLTDEHCKS
RIBB_SHESR      --------VEAGLEALRQGQGVLVVDDEDRENEGDLIFAAESLTNAQMAMLIRECSGIVCLCLPDEKVKA
RIBB_SHESM      --------VEAGLEALRQGQGVLVVDDEDRENEGDLIFAAESLTNAQMAMLIRECSGIVCLCLPDEKVKA
RIBB_YERE8      --------VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTVEQMALTIRHGSGIVCLCITDERRQQ
RIBB_PELPD      --------VEAALDALRAGQGVLVTDDEQRENEGDLIFAAQSLTREQVAMLIRECSGIVCLCLTDEAVRR
RIBB_SHESW      --------VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAQTLTNAQMAMLIRECSGIVCLCLPDEKVKA
RIBB_SHEPC      --------VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAQTLTNTQMAMLIRECSGIVCLCLPDEKVKA
RIBB_DESRM      --------VERALRSLRNGNGVLVTDDENRENEGDLIFPAQTLNEVQMAMLIRECSGIVCLCLTDEKVRS
RIBB_DESAH      --------VDRAIDALVSGRGVLLVDDEDRENEGDLIFPAGNITAEQVALLIRECSGIICLCLPPERIEQ
RIBB_DESAA      -FGNARERVEKGLQALRDGQGVLVADDENRENEGDLIFSAESLTEAQMAMLIRECSGIVCLCMPDEKIRS
RIBB_HAEIG      -----EERVLNAINAFKNGTGVLVLDDEDRENEGDLIFPAETITPEQMAKLIRYGSGIVCLCITDERCQQ
RIBB_HAEIE      -----EERVLNAINAFKNGNGVLVLDDEDRENEGDLIFPAETITPEQMAKLIRYGSGIVCLCITDERCQQ
RIBB_PHOPR      --------VEAGLTAIREGRGVLVVDDEDRENEGDIIFAAETLTSEQMALMIRECSGIVCLCLTDERVKQ
RIBB_YERPY      --------VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQ
RIBB_YERPS      --------VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQ
RIBB_YERPP      --------VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQ
RIBB_YERPN      --------VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQ
RIBB_YERPG      --------VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQ
RIBB_YERPE      --------VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQ
RIBB_YERPB      --------VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQ
RIBB_YERPA      --------VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQ
RIBB_YERP3      --------VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQ
RIBB_VIBFI      --------VEQAIKSVQQGNGVLLLDDESRENEGDLIYSVDHLTSEQMALMIRSCSGIVCLCLTEDKADY
RIBB_SHEPW      --------VNAALTALREGKGVLVVDDEDRENEGDLIYSAETLTNEQMALLIRECSGIVCLCLTDERITQ
RIBB_PASMU      -FGQSEERAIAAINAFKQGNGVLVLDDEDRENEGDLIFPAETITVEQMTMLIRYGSGIVCLCLSDEICQQ
RIBB_SHEON      --------VEAGLNALRQGLGVLVVDDEDRENEGDLIFAAESLTNAQMAMLIRECSGIVCLCLPDEKVKA
RIBB_VIBCM      --------VENALQALREGRGVLLLDDEDRENEGDIIYAVESLTTAQMALMIRECSGIVCLCLTEAQADR
RIBB_VIBCH      --------VENALQALREGRGVLLLDDEDRENEGDIIYAVESLTTAQMALMIRECSGIVCLCLTEAQADR
RIBB_PHOPO      ------STAQEIIEDIHQGKMVILMDDEDRENEGDLIIASDKVTPEAINFMATYGRGLICLTLNKERCLQ
RIBB_HELPY      ----ILKRVTEALEAYKNGEMLIVMDDEDRENEGDLVLAGIFSTPEKINFMATHARGLICVSLTKDLAKK
RIBB_HELHP      --------IKEAIEAIKQGEMIIIMDDEDRENEGDLVMAGIFSSPQKINFMAQEARGLICVSITQELAQK
RIBB_BUCBP      -----KTRVKNAISALRYGHGIIVLDNEDRENEGDLIFSGETMTTEQMALTIRYGSGIVCLCITESKRKQ
RIBB_PSEHT      -FGEPLTRVENAITALQQGQGVLVVDDENRENEGDFVFSAEHLTTAQMAEMIREGSGIVCLCMGEERIKQ
RIBB_HAES2      -FGTSEERVKRAIEAFKRGNGVLVLDDEDRENEGDLIFPAETITVEQMAKLIRYGSGIVCLCITDELCQQ
RIBB_ENTS8      --------VENAIAALREGRGVMVLDDENRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLTEERRKQ
RIBB_HAES1      -FGTSEERVKRAIEAFKRGNGVLVLDDEDRENEGDLIFPAETITVEQMAKLIRYGSGIVCLCITDELCQQ
RIBB_MANSM      -FGSSEERVIAALDTFKQGNGVLVLDDENRENEGDLIFPAETITTEQMAKLIRYGSGIVCLCITDELCQK
RIBB_VIBC3      --------VENALQALREGRGVLLLDDEDRENEGDIIYAVESLTTVQMALMIRECSGIVCLCLTEAQADR
RIBB_SHEPA      --------VNAALSALRQGKGVLVVDDEDRENEGDLIYSAETLTNQQMALLIRECSGIVCLCLTDERIKQ
RIBB_PSEAE      ------NTIDELIEDIRQGKMVILMDDEDRENEGDLIMAAECVRTEDINFMVKHARGLVCMPMTRERCER
RIBB_CAMJE      -------SVEQAIKDLQAGKMLVMVDAEDRENEGDLIFPAQFSTQEKVNFMIKEARGVVCVALDETLAKK
RIBB_DESDG      -----EERVEAALDALRRGHGVLVTDDEDRENEGDLIFAAETLSDSQMAMLIRECSGIVCLCLTDEKVRA
RIBB_TOLAT      --------VEQALSALQQGNGVLVVDDEDRENEGDLIFSAEKMTPQQMALMIRECSGIVCLCLTEERIRQ
RIBB_DEHMU      --------VNQAIEDIRQGKMVVMVDDEDRENEGDLVYAASFSTPQKVNFMASHAKGLICVAISKKIANR
RIBB_SHEB9      --------VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAETLTNAQMAMLIRECSGIVCLCLPDEKVKA
RIBB_SHEB2      --------VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAETLTNAQMAMLIRECSGIVCLCLPDEKVKA
RIBB_BUCAT      --------IKNAILALKSGQGVIILDDEERENEGDLVFACENMTVEQMALSIRYGSGIVCLCITESKRKQ
RIBB_BUCAI      --------IKNAILALKSGQGVIILDDEERENEGDLVFACENMTVEQMALSIRYGSGIVCLCITESKRKQ
RIBB_BUCA5      --------IKNAILALKSGQGVIILDDEERENEGDLVFACENMTVEQMALSIRYGSGIVCLCITESKRKQ
RIBB_SHEB8      --------VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAETLTNAQMAMLIRECSGIVCLCLPDEKIKA
RIBB_SHEB5      --------VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAETLTNAQMAMLIRECSGIVCLCLPDEKIKA
RIBB_HELPJ      ----ILRRVTEALEAYKNGEMLIVMDDEDRENEGDLVLAGIFSTPEKINFMATHARGLICVSLTKDLANK
RIBB_PELCD      --------VHLAIDRLRQGRGVLLVDDENRENEGDLIFPAETITPAQMAMMIRECSGIVCLCLTEDKLKQ
RIBB_BLOFL      --------VLNALDALSNGRGILVVDDENRENEGDMIFAAENMTVKQMALAIRYGSGIVCLCLTEEKCRQ
RIBB_CHLL2      ------NLVEKALAALRNGQGVLVADDPGRENEADLIFPAESVTIPQMALLIRECSGIVCLCMTDGKIRS
RIBB_WIGBR      --------VKNALQSLKRGNGILVLDDENRENEGDMIFAAENMTVNQMALAIRFGSGIVCICLTKEKCKI
RIBA_ARCFU      --------MEEVSSHVKSGKPVMILDS----EKSAICIPAEVVSGEILNFMMKNCDEIR-LALTWKQILN
RIBB_PHOLL      --------VEHAINALRDGKGVMVLDNEDRENEGDIIFAAETMTVEQMALTIRYGSGIVCLCLTEERRQQ
RIBB_AGRT5      --------IEDAIEAISRGEMVIVVDDEDRENEGDIIAASDSITPQQIAFMMNHARGLVCVAMPGERLDA
RIBB_BORPE      --------LERALQHLRIGRPVILMDDFDRENEADLIVAADKLTVPVMAQLIRDGSGIVCLCLPGETLDR
RIBB_BORPA      --------LERALQHLRIGRPVILMDDFDRENEADLIVAADKLTVPVMAQLIRDGSGIVCLCLPGETLDR
RIBB_BORBR      --------LERALQHLRIGRPVILMDDFDRENEADLIVAADKLTVPVMAQLIRDGSGIVCLCLPGETLDR
RIBB_WOLSU      ------NRVREAIEAIKKGEMIIMMDDEDRENEGDLVYAAAFSTPEKVNFMVSEAKGLVCVCVTSTCSDR
RIBB_RALSO      ------------------GIPVVVLDDADRENEADLIIAADRLTHAGMAMLIRECSGIVCLCLTAEKAAV
RIBB_RHORT      -----QERVSRAVDSLRQGQGVIVVDDEDRENEGDLIFAAETLTAEQMSRMIRDGSGIVCLILTDPDLDR
RIBB_DESVV      -FGTTHERVERGLAALRTGQGVLVADDADRENEGDLIFAAETLTPAQMAMMIRECSGIVCLCLPEERVSR
RIBB_BUCAP      --------VKKAISALQLGEGIIILDDEKRENEGDLVFSSETMTVEQMALTIRYGSGIVCLCITESKRKK
RIBB_DESVH      -FGTTHERVERGLAALRTGQGVLVADDADRENEGDLIFAAETLTPAQMAMMIRECSGIVCLCLPEERVSR
RIBB_CHRVO      --------VHAALDALRRGLPVIVADDADRENEADLILAADTLTVPEMARMIRDGSGIVCLCLTPERAER
RIBB_AERS4      -------------------------DDEDRENEGDLIFAAQTMTNEQMAMMIRECSGIVCLCLTDERVRQ
RIBB_METLZ      ------NTIEEALKSLQNGEMIIVTDDENRENEGDLICAAEYATTENVNFMAKYGRGLICMPMGRSLVEK
RIBB_AERHH      -------------------------DDEDRENEGDLIFAAESMTNEQMAMMIRECSGIVCLCLTDERVRQ
RIB3_YEAST      --------IDQAIEHFKQNKFVIVMDDAGRENEGDLICAAENVSTEQMAFLVRHSSGYVCAPMTNAIADK
RIBB_DESDA      --------VQKALASLRAGGGVLVVDDEDRENEGDLIFPAQTITVPQMAMLIRHCSGIVCLCLTDEYTRR
RIBB_OCEIH      ------SKIEQAIEDLRNGKLIIVADDADREAEGDLVGLSEFVTPEKVNFMTKYGRGLICVPITEERALE
RIBB_PSEPK      -------NVSAAIAAFQAGRPVXXXXXXXXXXXXXXXXXXXXXTLQTMAMMIRDCSGIVCLCLDEATVDE
RIB3_SCHPO      -------SIEEAVNDFRDGKFLIVLDDETRENEGDLIIAGCKVTTEQMAFLVRHSSGYVCVPMTGERLDS
RIB3_CANAL      --------IEEALEAYKNGEFLIVMDDEDRENEGDLIMAAELITQEKMAFLVRYSSGYVCVPLSEERANQ
RIBA_PICTO      ----------------------------------------------------------------------
RIBA_HELPY      ----------------------------------------------------------------------
RIBA_HELP2      ----------------------------------------------------------------------
RIBA_HELPH      ----------------------------------------------------------------------
RIBA_MARMS      ----------------------------------------------------------------------
RIBA_HELPS      ----------------------------------------------------------------------
RIBA_CAMHC      ----------------------------------------------------------------------
RIBA_HELAH      ----------------------------------------------------------------------
RIBA_HELPJ      ----------------------------------------------------------------------
RIBA_AZOBR      ----------------------------------------------------------------------
RIBA_SHEPA      ----------------------------------------------------------------------
RIBA_VIBF1      ----------------------------------------------------------------------
RIBA_PSYIN      ----------------------------------------------------------------------
RIBA_VIBFM      ----------------------------------------------------------------------
RIBA_THEVO      ----------------------------------------------------------------------
RIBA_CAMFF      ----------------------------------------------------------------------
RIBA_ACIB5      ----------------------------------------------------------------------
RIBA_ACIAD      ----------------------------------------------------------------------
RIBA_ACIBY      ----------------------------------------------------------------------
RIBA_ACIBT      ----------------------------------------------------------------------
RIBA_ACIBS      ----------------------------------------------------------------------
RIBA_ACIBC      ----------------------------------------------------------------------
RIBA_ACIB3      ----------------------------------------------------------------------
RIBA_SHESH      ----------------------------------------------------------------------
RIBA_SHEHH      ----------------------------------------------------------------------
RIBA_SHEPW      ----------------------------------------------------------------------
RIBA_VIBPA      ----------------------------------------------------------------------
RIBA_NEIMF      ----------------------------------------------------------------------
RIBA_NEIMB      ----------------------------------------------------------------------
RIBA_NEIM0      ----------------------------------------------------------------------
RIBA_HAHCH      ----------------------------------------------------------------------
RIBA_VIBCH      ----------------------------------------------------------------------
RIBA_SHEON      ----------------------------------------------------------------------
RIBA_SHESM      ----------------------------------------------------------------------
RIBA_SHEAM      ----------------------------------------------------------------------
RIBA_VIBVU      ----------------------------------------------------------------------
RIBA_SHESW      ----------------------------------------------------------------------
RIBA_SHEPC      ----------------------------------------------------------------------
RIBA_NEIMA      ----------------------------------------------------------------------
RIBA_COLP3      ----------------------------------------------------------------------
RIBA_SHESR      ----------------------------------------------------------------------
RIBA_NEIG1      ----------------------------------------------------------------------
RIBA_ALISL      ----------------------------------------------------------------------
RIBA_SHEWM      ----------------------------------------------------------------------
RIBA_SHEFN      ----------------------------------------------------------------------
RIBA_SHEB5      ----------------------------------------------------------------------
RIBA_SHESA      ----------------------------------------------------------------------
RIBA_SHEB9      ----------------------------------------------------------------------
RIBA_SHEB8      ----------------------------------------------------------------------
RIBA_SHEB2      ----------------------------------------------------------------------
RIB3_MAGGR      --------IPDVIQAFKNGEFVVVLDDPSRENEADLIIAAESVTTEQMAFMVRHSSGLICAPLTPERTTA
RIBA_TERTT      ----------------------------------------------------------------------
RIBA_PSEPW      ----------------------------------------------------------------------
RIBA_PSEPK      ----------------------------------------------------------------------
RIBA_PSEPG      ----------------------------------------------------------------------
RIBA_PSEP1      ----------------------------------------------------------------------
RIBA_PSEE4      ----------------------------------------------------------------------
RIBA_HELHP      ----------------------------------------------------------------------
RIBA_AZOVD      ----------------------------------------------------------------------
RIBA_HAEIN      ----------------------------------------------------------------------
RIBA_HAEIG      ----------------------------------------------------------------------
RIBA_HAEI8      ----------------------------------------------------------------------
RIBA_AERHH      ----------------------------------------------------------------------
RIBA_PSESM      ----------------------------------------------------------------------
RIBA_BURMA      ----------------------------------------------------------------------
RIBA_SHELP      ----------------------------------------------------------------------
RIBA_XYLFA      ----------------------------------------------------------------------
RIBA_PASMU      ----------------------------------------------------------------------
RIBA_ACTSZ      ----------------------------------------------------------------------
RIBA_TOLAT      ----------------------------------------------------------------------
RIBA_PHOPO      ----------------------------------------------------------------------
RIBA_HAEIE      ----------------------------------------------------------------------
RIBA_XYLFT      ----------------------------------------------------------------------
RIBA_SHEDO      ----------------------------------------------------------------------
RIBA_PSEFS      ----------------------------------------------------------------------
RIBA_PSEAE      ----------------------------------------------------------------------
RIBA_PSEAB      ----------------------------------------------------------------------
RIBA_PSEA8      ----------------------------------------------------------------------
RIBA_DEHMU      ----------------------------------------------------------------------
RIB1_SCHPO      ----------------------------------------------------------------------
RIBA_SACD2      ----------------------------------------------------------------------
RIBA_BUCBP      ----------------------------------------------------------------------
RIBA_MANSM      ----------------------------------------------------------------------
RIBA_STRCO      ----------------------------------------------------------------------
RIBA_SHISS      ----------------------------------------------------------------------
RIBA_SHIFL      ----------------------------------------------------------------------
RIBA_SHIF8      ----------------------------------------------------------------------
RIBA_SHIDS      ----------------------------------------------------------------------
RIBA_SHIBS      ----------------------------------------------------------------------
RIBA_PSEA7      ----------------------------------------------------------------------
RIBA_ECOSM      ----------------------------------------------------------------------
RIBA_ECOSE      ----------------------------------------------------------------------
RIBA_ECOLU      ----------------------------------------------------------------------
RIBA_ECOLI      ----------------------------------------------------------------------
RIBA_ECOLC      ----------------------------------------------------------------------
RIBA_ECOHS      ----------------------------------------------------------------------
RIBA_ECODH      ----------------------------------------------------------------------
RIBA_ECOBW      ----------------------------------------------------------------------
RIBA_ECO8A      ----------------------------------------------------------------------
RIBA_ECO7I      ----------------------------------------------------------------------
RIBA_ECO5E      ----------------------------------------------------------------------
RIBA_ECO57      ----------------------------------------------------------------------
RIBA_ECO55      ----------------------------------------------------------------------
RIBA_ECO27      ----------------------------------------------------------------------
RIBA_ECO24      ----------------------------------------------------------------------
RIBA_ECOL6      ----------------------------------------------------------------------
RIBA_ECOL5      ----------------------------------------------------------------------
RIBA_ECO81      ----------------------------------------------------------------------
RIBA_ECO45      ----------------------------------------------------------------------
RIBA_PROMH      ----------------------------------------------------------------------
RIBA_KLEP7      ----------------------------------------------------------------------
RIBA_KLEP3      ----------------------------------------------------------------------
RIBA_BLOFL      ----------------------------------------------------------------------
RIBA_SALTY      ----------------------------------------------------------------------
RIBA_SALTI      ----------------------------------------------------------------------
RIBA_SALPA      ----------------------------------------------------------------------
RIBA_SALCH      ----------------------------------------------------------------------
RIBA_HAES2      ----------------------------------------------------------------------
RIBA_HAES1      ----------------------------------------------------------------------
RIBA_ENT38      ----------------------------------------------------------------------
RIBA_SHIB3      ----------------------------------------------------------------------
RIBA_CITK8      ----------------------------------------------------------------------
RIBA_BUCAI      ----------------------------------------------------------------------
RIB1_PICGU      ----------------------------------------------------------------------
RIBA_ESCF3      ----------------------------------------------------------------------
RIBA_BUCAP      ----------------------------------------------------------------------
RIBA_ENTS8      ----------------------------------------------------------------------
RIBA_ERWCT      ----------------------------------------------------------------------
RIBA_YERPS      ----------------------------------------------------------------------
RIBA_YERPE      ----------------------------------------------------------------------
RIBA_HAMD5      ----------------------------------------------------------------------
RIBA_WIGBR      ----------------------------------------------------------------------
RIBB_METJA      ------NNVEKAIEALKKGEIILVYDSDEREGETDMVVASQFITPEHIRIMRKDAGGLICTALHPDICNK
RIBA_BAUCH      ----------------------------------------------------------------------
RIB1_YEAST      ----------------------------------------------------------------------
RIBA_BLOPB      ----------------------------------------------------------------------
RIBB_METTH      --------IQEALKALRRGEIVLVFDADNRERETDMIVAAEKIKPEHIRIMRNDAGGLICVPVSWENSEK
RIBB_METMA      -------NINRALEALRAGKMIQIYDSDSREGETDLVIPAKAVTYTDVKWMRKDAGGLICVAVDPVASKQ
RIBB_METAC      -------NINRALEVLRAGKMIQIYDSDSREGETDLVIPAKAVTYKDVKWMRKDAGGLICVAVDPVASKQ
RIBB_ARCFU      ---------EESLRAFRKGSPVLIYDFEDREGETDIAIPAIHVGKDEVAMMRIDGGGLICVAIHPVAAEK
URC1_SACKL      ----------------------------------------------------------------------
URG1_SCHPO      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LNLTPMVAADQNNSTFTTPFTVTIEAKEGVTTGVSAKDRAHTIQVASKADAKTEELARPGHIFPLIANDK
RIBBA_THEPX     LGIYQMV--ENNTDHKETAFTVSVDYKE-CTTGISAFERALTVKKLVDDNSKPEDFTKPGHIFPLRAKDG
RIBBA_THEP3     LGIYQMV--ENNTDHKETAFTVSVDYKE-CTTGISAFERALTVKKLVDDNSKPEDFTKPGHIFPLRAKDG
RIBBA_AQUAE     LDLHPM--TPMNTDPKGTYFCVSIDAKHGTTTGISAYDRALTIKLAISPDAKPSDFVRPGHVFPLKARPG
RIBBA_CYTH3     LKLDLMVGS--NTATHETPFTVSVDLLNGCTTGISASDRSKTIRALVDPDTKPEDLGRPGHIFPLKAKDE
RIBBA_STAAC     LDLVQMV--DDNSDIFGTQFTVSIDHVD-TTTGISAYERTLTAKKLIDPSSEAKDFNRPGHLFPLVAQDK
RIBBA_STAAW     LDLVQMV--DDNSDIFGTQFTVSIDHVD-TTTGISAYERTLTAKKLIDPSSEAKDFNRPGHLFPLVAQDK
RIBBA_STAAS     LDLVQMV--DDNSDIFGTQFTVSIDHVD-TTTGISAYERTLTAKKLIDPSSEAKDFNRPGHLFPLVAQDK
RIBBA_STAAR     LDLVQMV--DDNSDIFGTQFTVSIDHVD-TTTGISAYERTLTAKKLIDPSSEAKDFNRPGHLFPLVAQDK
RIBBA_STAAN     LDLVQMV--DDNSDIFGTQFTVSIDHVD-TTTGISAYERTLTAKKLIDPSSEAKDFNRPGHLFPLVAQDK
RIBBA_STAAM     LDLVQMV--DDNSDIFGTQFTVSIDHVD-TTTGISAYERTLTAKKLIDPSSEAKDFNRPGHLFPLVAQDK
RIBBA_UNCTG     LEIENMVEKPTEKKGCS--FTVSVDYKIGTTTGISAYDRSVTVRKLIDKTAKHEDFARPGHIFPLRCKEG
RIBBA_BACV8     LELPHQV--DTNTSVLGTPFTVTVDKLEGCSTGVSIHDRAATIRALADPTSTPETFGRPGHVNPLYAQDK
RIBBA_BACTN     LDLPHQVS--DNTSVLGTPFTVTIDKLEGCSTGVSASDRAATIQALADPASTPATFGRPGHINPLYAQEK
RIBBA_STAEQ     LKLQSM---EQNNTDYGTHFTVSIDHYK-TTTGISAHERTQTARALIDENTNPEDFHRPGHLFPLIAKEN
RIBBA_BACWK     LQLEPMVS--HNTDSHHTAFTVSID-HVSTTTGISAHERATTIQELLNPASKGSDFNRPGHIFPLIAKEG
RIBBA_BREBN     LQLAPMVNA--NTDKQGTAFTVSID--EGSTTGISAHERSQTVLAMLDEQKDADDFRRPGHIFPLIAKAG
RIBBA_BACSK     LQLGQMVS--HSTDPHGTAFTVSVDHSH-TTTGISAFERAETVRALADANAQPSDFKRPGHVFPLVAKNG
RIBBA_STAES     LKLQSM---EQNNTDYGTHFTVSIDHYK-TTTGISAHERTQTARALIDENTNPEDFHRPGHLFPLIAKEN
RIBBA_SALTO     LDLPPMHHTNQDRRG--TAYMVTVDARKGVSTGISAADRARVIRLLADPSTTPDDLARPGHVVPLRAREG
RIBBA_BACFR     LELDMQVSS--NTSIYETPFTVTVDLLEGCTTGVSMHDRAMTIRALADPKTKPADLGRPGHINPLRARSR
RIBBA_BACFN     LELDMQVSS--NTSIYETPFTVTVDLLEGCTTGVSMHDRAMTIRALADPKTKPADLGRPGHINPLRARSR
RIBBA_CLONN     LDLYQMVI--NNTDTKETAFTVSIDSVE-TTTGISAFERALTITKAVEKGAKAKDFQRPGHIFPLRARKG
RIBBA_CHLTR     LDLPAMV--QDNQCAFKTAFTVSVDASSGVTTGVSASDRTRTVQLLADPAATAESFVRPGHVFPLISQPG
RIBBA_BACA2     LDLHPMV--DHNTDSHETAFTVSIDHRL-TKTGISAQERSFTIQALLNEESVSDDFQRPGHIFPLIAKKG
RIBBA_SALAI     LDLPPMHHTNQDRRG--TAYTVTVDAREGVSTGISAADRAHTIRLLADPRTGPADLARPGHVVPLRARQG
RIBBA_BACCR     LQLEPMVS--HNTDSHHTAFTVSID-HVSTTTGISAHERATTIQELLNPASKGADFNRPGHIFPLIAKEG
RIBBA_BACCQ     LQLEPMVA--HNTDSHHTAFTVSID-HVSTTTGISAHERATTIREMLNPASKGADFNRPGHIFPLIAKEG
RIBBA_BACC7     LQLEPMVA--HNTDSHHTAFTVSID-HVSTTTGISAHERATTIREMLNPASKGADFNRPGHIFPLIAKEG
RIBBA_BACHK     LQLEPMVS--HNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAKEG
RIBBA_BACC3     LQLEPMVS--HNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAKEG
RIBBA_BACAN     LQLEPMVS--HNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAKEG
RIBBA_BACAH     LQLEPMVS--HNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAKEG
RIBBA_BACAC     LQLEPMVS--HNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAKEG
RIBBA_BACAA     LQLEPMVS--HNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAKEG
RIBBA_BACSU     LDLHPMV--EHNTDSHHTAFTVSIDHRE-TKTGISAQERSFTVQALLDSKSVPSDFQRPGHIFPLIAKKG
RIBBA_BACC2     LQLEPMVS--HNTDSHHTAFTVSID-HVSTTTGISAHERATTIQELLNPASKGTDFNRPGHIFPLIAKEG
RIBBA_BACC1     LQLEPMVA--HNTDSHHTAFTVSID-HVSTTTGISAHERATTIREMLNPASKGADFNRPGHIFPLIAKEG
RIBBA_BACC4     LQLEPMVS--HNTDSHHTAFTVSID-HVSTTTGISAHERATTIQELLNPASKGADFNRPGHIFPLIAKEG
RIBBA_BACC0     LQLEPMVS--HNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAKEG
RIBBA_CHLPN     LDLPPMVK--DNRCRFKTPFTVSVDAAHGVTTGVSAADRTKVVQLLADPKSKPEDFISPGHFFPLASSPG
RIBBA_BACCZ     LQLEPMVS--HNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAKEG
RIBBA_ACTP7     LNFHPMVAVNQDNHE--TAFTVSVDHID-TGTGISAFERSITAMKIVDDNAKATDFRRPGHMFPLIAKDG
RIBBA_BACAM     LDLHPMV--DHNTDSHETAFTVSIDHKL-TKTGISAQERSFTIQALLDEESVPGDFQRPGHIFPLIAKKG
RIBBA_STAHJ     FNLMPMV--EHNTDGFGTNFTVSIDHAT-TSTGISAFDRMATARALINPESTPEDFHKPGHLFPLIAKEN
RIBBA_ACTPL     LNFHPMVAVNQDNHE--TAFTVSVDHID-TGTGISAFERSITAMKIVDDNAKATDFRRPGHMFPLIAKEG
RIBBA_ACTP2     LNFHPMVAVNQDNHE--TAFTVSVDHID-TGTGISAFERSITAMKIVDDNAKATDFRRPGHMFPLIAKEG
RIBBA_PORGI     LELEMQVP--DNTSVHETPFTVTVDRLNGCTTGVSMYDRAQTILALADPNTRPSDLGRPGHICPLRARSR
RIBBA_PORG3     LELEMQVP--DNTSVHETPFTVTVDRLNGCTTGVSMYDRAQTILALADPNTRPSDLGRPGHICPLRARSR
RIBBA_PROVI     LQLEPMV--QRNTSQHETNFTVSVDAAEGVTTGISVYDRAMTIKMLGDETSHADSFSRPGHIFPLRAMDG
RIBBA_ACTPJ     LNFHPMVAVNQDNHE--TAFTVSVDHID-TGTGISAFERSITAMKIVDDNAKATDFRCPGHMFPLIAKDG
RIBBA_BACCN     LQLEPMVS--QNTDSHHTAFTVSID-HISTTTGISAHERATTVRELLNPSSKGSDFNRPGHIFPLIAKDG
RIBBA_MYCVP     LGLLPMYAVNQDKHG--TAYTVTVDAKKGVGTGISAMDRATTMRLLADPDAVADDFTKPGHVVPLRAKDG
RIBBA_GEOSW     LDLAPMV--NHNTDSHGTAFTVSIDYKS-TTTGISAYERSMTIQALLDPNAKASDFKRPGHVFPLVAKKG
RIBBA_MYCGI     LGLLPMYAVNQDKHG--TAYTVTVDAKVGVGTGISASDRATTMRLLADPDSVADDFTKPGHVVPLRAKDG
RIBBA_MYCUA     LGLLPMYAVNQDKHG--TAYTVTVDAKNGVGTGISASDRATTMRLLADPASVAEDFTRPGHVVPLRAKDG
RIBBA_MYCPA     LGLLPMYAVNQDKHG--TAYTVTVDARNGVGTGISASDRATTMRLLADPTSIAEDFTRPGHVVPLRAKDG
RIBBA_SYNWW     LEIHDMVT--ENTDNHETAFTVTVDYR-GTTTGISAFERAATVKALIDSVSKPSDFRKPGHIFPLRYREG
RIBBA_SYNY3     LDLPLMVS--KNTDSNQTAFTVSIDAAPGVTTGISAEDRARTIQIAINPVTRPEDLSRPGHIFPLRAKTG
RIBBA_MYCMM     LGLLPMYAVNQDKHG--TAYTVTVDAKNGVGTGISASDRATTMRLLADPASVAEDFTRPGHVVPLRAKDG
RIBBA_MYCA1     LGLLPMYAVNQDKHG--TAYTVTVDARNGVGTGISASDRATTMRLLADPTSIAEDFTRPGHVVPLRAKDG
RIBBA_CHLMU     LDLPAMV--QENQCAFKTAFTVSVDASSGITTGVSAADRTRTVQLLSDPTSISQSFVRPGHVFPLVSQPG
RIBBA_STAS1     LDLNPMVT--HNSDVYGTQFTVSVDHIQ-TTTGISADERTMTARALIDEQATGSDFNKPGHLFPLIAQDN
RIBBA_MYCTU     LGLLPMYAVNQDKHG--TAYTVTVDARNGIGTGISASDRATTMRLLADPTSVADDFTRPGHVVPLRAKDG
RIBBA_MYCTA     LGLLPMYAVNQDKHG--TAYTVTVDARNGIGTGISASDRATTMRLLADPTSVADDFTRPGHVVPLRAKDG
RIBBA_MYCBT     LGLLPMYAVNQDKHG--TAYTVTVDARNGIGTGISASDRATTMRLLADPTSVADDFTRPGHVVPLRAKDG
RIBBA_MYCBP     LGLLPMYAVNQDKHG--TAYTVTVDARNGIGTGISASDRATTMRLLADPTSVADDFTRPGHVVPLRAKDG
RIBBA_MYCBO     LGLLPMYAVNQDKHG--TAYTVTVDARNGIGTGISASDRATTMRLLADPTSVADDFTRPGHVVPLRAKDG
RIBBA_PELLD     LQLDPMV--QRNTSQHETNFTVSVDAAEGVTTGISVYDRATTIKMLGDPASHADSFSRPGHIFPLRAMDG
RIBBA_PARD8     LELDMQVA--NNTSLLGTPFTITVDKLGGCTTGVSMYDRAETILALADPKTKPSDLGRPGHINPLRARSR
RIBBA_PROA2     LQLDPMV--QRNTSQHETNFTVSVDAAEGVTTGISAFDRYMTIKMLADPVSHADNFSRPGHIFPLRAMDG
RIBBA_ARATH     LHLPLMVNQKENEEKLSTAFTVTVDAKHGTTTGVSARDRATTILSLASRDSKPEDFNRPGHIFPLKYREG
RIBBA_PELPB     LQLDPMV--QRNTSQHETNFTVSVDAAEGVTTGISVYDRAMTIKMLGDLSSTADDFSRPGHIFPLRAMDG
RIBBA_MYCA9     LGLLPQYAVNQDKHG--TAYTVTVDAKNGIGTGISASDRAATMRLLADAASTADDFTKPGHVVPLRAKDG
RIBBA_RHOE4     LGLPPMYATNQDKHG--TAYTVTVDAREGIGTGISASDRAATMRLLANPESGANDFTRPGHVVPLRAKEG
RIBBA_CORGL     LDLPPMTA--HNQDARGTAYTVTVDANTG-TTGISATDRAHTLRLLADPEADRTDFTRPGHVVPLRAREG
RIBBA_CORGB     LDLPPMTA--HNQDARGTAYTVTVDANTG-TTGISATDRAHTLRLLADPEADRTDFTRPGHVVPLRAREG
RIBBA_NOCFA     LGLPPMYATNQDKHG--TAYTVSVDAREGITTGISAADRATTMRXXXXXXXXXXXXTRPGHVVPLRAKDG
RIBBA_RHOSR     LGLPPMYATNQDKHG--TAYTVTVDAREGIGTGISASDRAATMRLLADPSSGAQDFTRPGHVVPLRAKEG
RIBBA_CORAM     LNLPPMMG--RNEDVRGTAYTVTVDANTG-TTGISATSRAETMLRLADPMSVVDDFTRPGHVVPLAARPN
RIBB_VIBSL      LELPPMVV--DNNSANQTAFTVTIEAKVGVTTGVSAADRVTTIKTAANPTAKPTDLARPGHVFPLRARKG
RIBB_VIBVY      LELPPMVV--NNNSANQTAFTVSIEAKQGVTTGVSAQDRVTTIKTAANPSAKADDLARPGHVFPLRARPG
RIBB_VIBVU      LELPPMVV--NNNSANQTAFTVSIEAKQGVTTGVSAQDRVTTIKTAANPSAKADDLARPGHVFPLRARPG
RIBB_ECOSM      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADDAKPSDLNRPGHVFPLRAQAG
RIBB_ECOLU      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADDAKPSDLNRPGHVFPLRAQAG
RIBB_PECCP      LELPMMV--EKNSSHYQTAFTVTIEAAEGVTTGVSAADRLTTIRAAIADNAKPSDLNRPGHVFPLRAQPG
RIBB_VIBHA      LDLPPMVK--DNCSKNQTAFTVSIEAKEGVTTGVSAKDRVTTVKTATYFDAQPEDLARPGHVFPLVAKTN
RIBB_SHISS      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_SHIFL      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_SHIF8      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_SHIDS      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_SHIBS      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_SHIB3      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_EDWI9      LDLPMMVS--NNTSHYGTAFTVTIEAAEGVTTGVSAQDRLTTVRAAIADDAKPGDLHRPGHVFPLRARPG
RIBB_ECOUT      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_ECOSE      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_ECOLI      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_ECOLC      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_ECOL6      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_ECOL5      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_ECOK1      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_ECOHS      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_ECODH      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_ECOBW      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_ECO8A      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_ECO81      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_ECO7I      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_ECO5E      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_ECO57      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_ECO55      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_ECO45      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_ECO27      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_ECO24      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_SHESH      LALPPMV--ENNSSQYGTAFTVSIEAKEGVTTGVSAADRVTTIKTAIADDAQPDDLARPGHVYPLRAQPG
RIBB_ESCF3      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_NEIMB      LGLPMMT--QKNGAQYGTNFTVSIEAAHGITTGISAADRALTIQTAVSPTAKPEDIVQPGHIFPLRAQKG
RIBB_SALTY      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAG
RIBB_SALTI      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAG
RIBB_SALSV      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAG
RIBB_SALPC      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAG
RIBB_SALPB      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAG
RIBB_SALNS      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAG
RIBB_SALHS      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAG
RIBB_SALG2      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAG
RIBB_SALEP      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAG
RIBB_SALDC      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAG
RIBB_SALCH      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAG
RIBB_SALA4      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAG
RIBB_VIBPA      LELPPMVV--NNNSANQTAFTVSIEAKVGVTTGVSAADRVTTIKTAANPHAKPEDLARPGHVFPLRARPG
RIBB_SALPK      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAG
RIBB_SALPA      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAG
RIBB_CHLT3      LALPMMVS--ENTSGFQTAFTVSIEAKTGVKTGVSAADRVRTVKTAIAADAKPEELARPGHVFPLRARTG
RIBB_ERWCT      LELPMMV--EKNSSHYQTAFTVTIEAAEGVTTGVSAADRLTTIRAAIADNARPSDLNRPGHVFPLRAQPG
RIBB_NEIMA      LGLPMMT--QKNGAQYGTNFTVSIEAAHGITTGISAADRALTIQTAVSPTAKPEDIVQPGHIFPLRAQKG
RIBB_CLOBL      LGLTQMVS--NNTCTYETAFTISIEAKEGVTTGVSAADRVTTILTAVKDDCKPEDLCHPGHVFPLRARAG
RIBB_SHEFN      LQLPPMVI--NNNSANQTAFTISIEAKHGVTTGVSAQDRVTTIKTAANRDAKASDLAHPGHVFPLRARAG
RIBB_ERWT9      LDLPMMV--QNNTSAYGTGFTVTIEAAEGVTTGVSATDRLTTIRAAIADDARPSDLNRPGHVFPLRARSG
RIBB_CLOBH      LGLTQMV--HNNTCTYETAFTISIEAKEGVTTGVSAADRVTTILTAVKDDCKPEDLCHPGHVFPLRARAG
RIBB_CLOB1      LGLTQMV--HNNTCTYETAFTISIEAKEGVTTGVSAADRVTTILTAVKDDCKPEDLCHPGHVFPLRARAG
RIBB_SALAR      LDLPMMV--QNNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIADGAKPSDLNRPGHVFPLRAQAG
RIBB_SERP5      LELPMMVT--NNSSQFQTAFTVTIEAAQGVTTGVSASDRLTTIRAAVADNAKPSDLNRPGHVFPLRAQPG
RIBB_PROMH      LDLPMMV--ENNTSHFHTAFTVTIEAAQGVTTGVSAADRLTTVRAAAADNAKPSDLNRPGHVFPLRAQPG
RIBB_CITK8      LDLPMMV--ENNTSAYGTGFTVTIEAAKGVTTGVSAADRVTTVRAAIADGAKPADLHRPGHVFPLRAQPG
RIBB_HAMD5      LELPMMV--EKNSSTFQTPFTVSIEAAKGVTTGVSASDRITTIKAAISQTAKPADLHRPGHVFPLKGHPK
RIBB_HAEIN      LDLPPMV--EHNNSVNKTAFTVTIEAAKGVSTGVSAADRVTTIQTAIADNAVLTDLHRPGHVFPLRAANG
RIBBA_THEMA     RGFVKL------SSNYGANYFVPVDW--GTGTGISALERAETCRKLAEG-RYFHEFRYPGHV--TVIGGI
RIBB_ENT38      LDLPMMV--ENNTSAFGTGFTVTIEAAHGVTTGVSAADRLTTVRAAIADGAKPSDLHRPGHVFPLRAQAG
RIBB_HAEI8      LDLPPMV--EHNNSVNKTAFTVTIEAAKGVSTGVSAADRVTTIQTAIADNAVPTDLHRPGHVFPLRAANG
RIBB_SHEWM      LDLPPMV--EDNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKAAIADNAVPEDLARPGHVYPLRAQSG
RIBB_DESAD      LGLPMMV--ESNSSRYQTGFTVTIEAAEGVTTGVSAADRVTTVKAAIADGAKPADLHRPGHVFPLRAREG
RIBB_SODGM      LALPMMV--ERNSSHYQTAFTVTIEAAEGVSTGVSAADRLTTIRAAIKDNAKPTDLNRPGHVFPLCAQPG
RIBB_RALEJ      LGLRPMV--ENNRSQYGTAFTVSIEAREGVTTGVSAVDRITTIRAAIAKDAGTDAVVSPGHVFPLVAVDG
RIBB_KLEP7      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIADGAKPSDLNRPGHVFPLRAQPG
RIBB_SHELP      LELPPMV--EDNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKAAIADDAKPSDLARPGHVYPLRAQPG
RIBB_SHEHH      LQLPPMVS--DNNSQYGTAFTVSIEAKQGVTTGVSAADRVTTIKTAIADNAKPDDLARPGHVYPLRARPG
RIBB_PHOLE      LNLPLMVQG--NNDNFSTPFTISIEAAKYVTTGISASDRAKTVLAAVAPNAKSTDIVMPGHIFPLMAQDG
RIBB_KLEP3      LDLPMMV--ENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIADGAKPSDLNRPGHVFPLRAQPG
RIBB_DESPS      LKLPQMVT--NNNSRHGTGFTISIEARDGVTTGVSAADRTQTVKAAIAEGAVAEDLCQPGHVFPLRARDN
RIBB_BAUCH      LELPMMV--EHNTSHYQTAFTVTIEAAEGVTTGVSAADRITTIRTAIKNDAIPEDLNRPGHVFPLLAQPG
RIBB_SHESA      LELPPMV--ENNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKTAIADNAKPSDLARPGHVYPLRAQPG
RIBB_PSESM      LGLEQMVPS--NGSVFATAFTVSIEATTGVTTGISAADRARTVQAAVNPGAVPDDLVQPGHIFPLRARDG
RIBB_SHESR      LELPPMV--ENNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKAAIADNAKPSDLARPGHVYPLRAQPG
RIBB_SHESM      LELPPMV--ENNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKAAIADNAKPSDLARPGHVYPLRAQPG
RIBB_YERE8      LDLPMMVA--NNSSQFQTAFTVTIEAAKGVTTGVSAADRLTTIRAAIADNAKPTDLNRPGHVFPLRGQPG
RIBB_PELPD      LDLPLMVS--DNSSRYQTAFTVSIEAAEGVTTGVSAADRLTTIRAAIADDAGPLCLSRPGHVFPLRARPG
RIBB_SHESW      LELPPMV--ENNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKAAIADGAKPSDLARPGHVYPLRAQPG
RIBB_SHEPC      LELPPMV--ENNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKAAIADGAKPSDLARPGHVYPLRAQPG
RIBB_DESRM      LGLPMMV--ENNSSRFKTAFTVTIEAAHGVTTGVSAADRVKTVKTAVAENAKPEDLNRPGHVFPLRACPG
RIBB_DESAH      LGLPQMVTC--NTSAYQTAFTISIEAAEGVTTGVSAADRATTIRCAAALDARPEDIHSPGHVFPLRAVEQ
RIBB_DESAA      LELPMMV--EDNSSRYGTAFTVSIEAAQGVTTGVSAKDRVTTVKTAAADGAKPADLSKPGHVFPLRARPG
RIBB_HAEIG      LDLPSMV--EHNNSVNKTAFTVTIEAAKGVSTGVSAADRVTTIQTAIADNAVPTDLHRPGHVFPLRAVNG
RIBB_HAEIE      LDLPSMV--EHNNSVNKTAFTVTIEAAKGVSTGVSAADRVTTIQTAIADNAVPTDLHRPGHVFPLRAANG
RIBB_PHOPR      LELPMMV--ENNTSANETGFTVTIEAAKGVTTGVSAADRVTTIKTAIADGAVPADLNHPGHVFPLKANAD
RIBB_YERPY      LDLPMMVT--HNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQPG
RIBB_YERPS      LDLPMMVT--HNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQPG
RIBB_YERPP      LDLPMMVT--HNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQPG
RIBB_YERPN      LDLPMMVT--HNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQPG
RIBB_YERPG      LDLPMMVT--HNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQPG
RIBB_YERPE      LDLPMMVT--HNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQPG
RIBB_YERPB      LDLPMMVT--HNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQPG
RIBB_YERPA      LDLPMMVT--HNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQPG
RIBB_YERP3      LDLPMMVT--HNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQPG
RIBB_VIBFI      LELSPMV--EHNESVNQTAFTISIEAKKGVTTGVSATDRVTTIKTACKNGALPHELAKPGHVFPLRAKDG
RIBB_SHEPW      LELPPMVV--DNNSQYGTAFTVSIEAKEGVTTGVSAADRVTTVKAAIADGAKPGDLARPGHVYPLRARPG
RIBB_PASMU      LDLPPMVT--ENTSVNKTAFTVTIEAAKGVSTGVSATDRVTTIRAAVADNAKPSDLSRPGHIFPLRAMTG
RIBB_SHEON      LALPPMV--ENNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKTAIADHAKPSDLARPGHVYPLRAQPG
RIBB_VIBCM      LALPPMVV--NNNSANQTAFTVSIEAKHGVTTGVSAQDRVTTIKTAANPQAKPEDLARPGHVFPXXXXXX
RIBB_VIBCH      LALPPMVV--NNNSANQTAFTVSIEAKHGVTTGVSAQDRVTTIKTAANPQAKPEDLARPGHVFPXXXXXX
RIBB_PHOPO      LELPMMVKS--NTDKFATPFTISIEAASGVTTGISVNDRXXXXXXXXXXXXXXKDIVMPGHIFPLMAQDG
RIBB_HELPY      FELPPMVSV--NDSNHETAFTVSIDAKEA-RTGISAFERHLTIELLCKDTTKPSDFVRPGHIFPLIAKDG
RIBB_HELHP      LDLPPMV--QKNDSNHETAFTISIDAKEA-KTGISAFERDMTIRLMCESNTKPSDFVRPGHIFPLIAKEG
RIBB_BUCBP      LKLPMMV--QNNTSKFGTNFTVTIEAAEGISTGVSAKDRLTTIRAAINDNAKPSDLNRPGHIFPLQAHKN
RIBB_PSEHT      LDLPQMVT--HNTSQNNTAYTITIEAKEGVTTGVSAADRVTTIKAATADNAKPEDLSRPGHVFGLKAKTG
RIBB_HAES2      LDLPPMV---QNNTSINTAFTVSIEAAQGVSTGVSAQDRVTTIQVAIADNAKPQDLSRPGHVFPLRAKKG
RIBB_ENTS8      LDLPMMV--ENNTSAFGTGFTVTIEAAHGVTTGVSXXXXXXXXXXXXXXXXKPSDLHRPGHVFPLRAQPG
RIBB_HAES1      LDLSPMV---QNNTSINTAFTVSIEAAQGVSTGVSAQDRVTTIQAAIADNAKPQDLSRPGHVFPLRAKKG
RIBB_MANSM      LELPPMVAA--NTSVNKTAFTVTIEAAEGVSTGVSAADRVTTVKVAVADNAKPSDLHHPGHVFPLRAAEN
RIBB_VIBC3      LALPLMVV--NNNSANQTAFTVSIEAKHGVTTGVSAQDRVTTIKTAANPQAKPEDLARPGHVFPXXXXXX
RIBB_SHEPA      LQLPPMVS--DNNSQYGTAFTVSIEAKQGVTTGVSAADRVTTXXXXXXXXXXXXXLARPGHVYPLRARPG
RIBB_PSEAE      LGLPLMV--QRNGSGFGTKFTVSIEAAEGVTTGISXXXXXXXXXXXXXXXXXXXXIVSPGHIFPLMAQPG
RIBB_CAMJE      FELPLMVP--KNTSNHETAFTITVDAKDA-TTGVSAYERNMTIQIFADDNAKASDFVRPGHINPLIAKKG
RIBB_DESDG      LGLPMMV--ENNSSQYQTAFTVSIEASCGVSTGVSAADRVCTIQAAIADDACPSDLCRPGHVFPLRARPG
RIBB_TOLAT      LALPMMV--EHNTSANQTGFTVTIEAARGVTTGVSAQDRITTIRTAIADGAVASDLNRPGHVFPLRARAG
RIBB_DEHMU      LQLEPMVK--KNDSSYETAFTITVDARTAAT-GISAGERDMTIKILADGGSHESELVRPGHIFPLIAKEG
RIBB_SHEB9      LELPAMV--EHNSSQYGTAFTVSIEATVGVTTGVSAADRVTTIKAAIADNAKPSDLARPGHVYPLRAQPG
RIBB_SHEB2      LELPAMV--EHNSSQYGTAFTVSIEATVGVTTGVSAADRVTTIKAAIADNAKPSDLARPGHVYPLRAQPG
RIBB_BUCAT      LNLPMMVK--KNTSAYRTGFTVTIEASKGISTGVSAKDRLTTIKTAIADDAKPSDLNRPGHVFPLRAHKG
RIBB_BUCAI      LNLPMMVK--KNTSAYRTGFTVTIEASKGISTGVSAKDRLTTIKTAIADDAKPSDLNRPGHVFPLRAHKG
RIBB_BUCA5      LNLPMMVK--KNTSAYRTGFTVTIEASKGISTGVSAKDRLTTIKTAIADDAKPSDLNRPGHVFPLRAHKG
RIBB_SHEB8      LELPAMV--EHNSSQYGTAFTVSIEATVGVTTGVSAADRVTTIKAAIADNAKPSDLARPGHVYPLRAQPG
RIBB_SHEB5      LELPAMV--EHNSSQYGTAFTVSIEATVGVTTGVSAADRVTTIKAAIADNAKPSDLARPGHVYPLRAQPG
RIBB_HELPJ      FELPPMVSV--NDSNHETAFTVSIDAKEA-KTGISAFERHLTIELLCKDTTKPSDFVRPGHIFPLIAKDG
RIBB_PELCD      LELPQMVS--DNTSANQTAFTLSIEARQGVTTGVSAADRVTTIRTAVADDCRPDDLARPGHVFPLRARPG
RIBB_BLOFL      LKLPMMVKNNSNH--YKTAFTVTIEASKGITTGVSAKDRLTTIKTSIEDYAKPSDLNRPGHVFPLRAHNG
RIBB_CHLL2      LELPMMV--ENNTSGFQTAFTVSIEAAEGVTTGVSAADRVKTVRTAVSENARPSDLRHPGHIFPLRARPG
RIBB_WIGBR      LNLPMMVK--KNNSKYKTAFTVSIESAYGITTGVSAYDRIITIKTAIKDNAKPDDLNRPGHVFPLQAHPG
RIBA_ARCFU      LGLNRFRFQNGN----LIPIDPNLEK-------ISAEERAKFIRELVSGNAG--DIKYPGRIFVEETKEM
RIBB_PHOLL      LQLPMMV--ENNSSPFQTAFTVTIEAAQGVTTGVSXXXXXXXXXXXXXXNAKPSDLNRPGHVFPLRAQPG
RIBB_AGRT5      LDIPLMVS--RNTESLKTAFTVSVDYIPGTTTGISAADRAKTVRALVSEGSRPEDFARPGHIFPLRANPE
RIBB_BORPE      LELPPMV--DSNRSRYSTAFTVSIEAREGVTTGVSAVDRVTTIRAAIAPGARSGDVVSPGHVFPLRAQPG
RIBB_BORPA      LELPPMV--DSNRSRYSTAFTVSIEAREGVTTGVSAVDRVTTIRAAIAPGARSGDVVSPGHVFPLRAQPG
RIBB_BORBR      LELPPMV--DSNRSRYSTAFTVSIEAREGVTTGVSAVDRVTTIRAAIAPGARSGDVVSPGHVFPLRAQPG
RIBB_WOLSU      LGLAPMVR--ENNSQHETAFTVSIDARE-CSTGISAFERDLTIRKMVDGTSKPEDFVRPGHIFPLIAKEG
RIBB_RALSO      LGLRPMV--EHNRSQYGTAFTVSIEARVGVSTGVSAADRITTIRAAVAPDADAQSVVSPGHVFPLVAQAG
RIBB_RHORT      LALPPMVA--HNTSRNGTGFTVSIEAREGVTTGVSAADRVTTIRAAIDPASTADDLARPGHVFPLRAHAD
RIBB_DESVV      LGLPMMVA--HNTSSMGTAFTISIEAAEGVTTGVSAADRVRTVQAAIDDAACPGCLRSPGHVFPLRASPG
RIBB_BUCAP      LNLPMMVK--HNTSTYRTGFTVTIEASKGVSTGVSAKDRLTTIKTATADDAQPSDLNRPGHVFPLRANGG
RIBB_DESVH      LGLPMMVA--HNTSSMGTAFTISIEAAEGVTTGVSAADRVRTVKAAIDDAACPGCLRSPGHVFPLRASPG
RIBB_CHRVO      LQLPPMAA--ENGSRYGTAFTVAIEAAQGVTTGVSXXXXXXXXXXXXHPDAKPGDLVRPGHVYPIXXXXX
RIBB_AERS4      LALPMMVEA--NSSHYQTAFTVTIEAAQGVTTGVSXXXXXXXXXXXXXXGAKPSDLHRPGHVFPLRARTG
RIBB_METLZ      LCLPPMVL--KNTDNHETAFTVSIDHVD-TTTGISAVERGITARKCIDPNARPEDFRRPGHMFPLQAKDN
RIBB_AERHH      LELPMMVEA--NSSHYQTAFTVTIEAAQGVTTGVSXXXXXXXXXXXXXXXXXPSDLHRPGHVFPLRARTG
RIB3_YEAST      LDLTGMKFESNDDDRHGTAYTITVDVAQGTTTGISAHDRSMTCRALADSSSTPKSFLKPGHICPLRAADG
RIBB_DESDA      LDLPMMT--ERNTNTQQTAFTISIEXXXXXXXXXXXXDRVATIQAAVAENASPENLRRPGHVFPLRAKPG
RIBB_OCEIH      LDLHAM--ATNNTDTYGTQFTVSVDYYTN-STGISTADRADTIRALAEPLSKAADFKRPGHMFPLIAKNA
RIBB_PSEPK      LQLAPMV--QNNQARHGTGFTVTIEAAEGITTGVSAQDRITTIDAALRSSAEQRHIVSPGHVFPLRARNG
RIB3_SCHPO      LEIPMMV--DNNEDRMRTAYAVTLDYANGTTTGISAHDRALTTQLANPEVTSPREFNRPGHIVPLRARDG
RIB3_CANAL      LELPPMLA--NRSDRHGTAYTITCDFAEGTTTGISAHDRALTTRSLANPNSKPQDFIKPGHILPLRAVPG
RIBA_PICTO      ----------------------------------------------------------------------
RIBA_HELPY      ----------------------------------------------------------------------
RIBA_HELP2      ----------------------------------------------------------------------
RIBA_HELPH      ----------------------------------------------------------------------
RIBA_MARMS      ----------------------------------------------------------------------
RIBA_HELPS      ----------------------------------------------------------------------
RIBA_CAMHC      ----------------------------------------------------------------------
RIBA_HELAH      ----------------------------------------------------------------------
RIBA_HELPJ      ----------------------------------------------------------------------
RIBA_AZOBR      ----------------------------------------------------------------------
RIBA_SHEPA      ----------------------------------------------------------------------
RIBA_VIBF1      ----------------------------------------------------------------------
RIBA_PSYIN      ----------------------------------------------------------------------
RIBA_VIBFM      ----------------------------------------------------------------------
RIBA_THEVO      ----------------------------------------------------------------------
RIBA_CAMFF      ----------------------------------------------------------------------
RIBA_ACIB5      ----------------------------------------------------------------------
RIBA_ACIAD      ----------------------------------------------------------------------
RIBA_ACIBY      ----------------------------------------------------------------------
RIBA_ACIBT      ----------------------------------------------------------------------
RIBA_ACIBS      ----------------------------------------------------------------------
RIBA_ACIBC      ----------------------------------------------------------------------
RIBA_ACIB3      ----------------------------------------------------------------------
RIBA_SHESH      ----------------------------------------------------------------------
RIBA_SHEHH      ----------------------------------------------------------------------
RIBA_SHEPW      ----------------------------------------------------------------------
RIBA_VIBPA      ----------------------------------------------------------------------
RIBA_NEIMF      ----------------------------------------------------------------------
RIBA_NEIMB      ----------------------------------------------------------------------
RIBA_NEIM0      ----------------------------------------------------------------------
RIBA_HAHCH      ----------------------------------------------------------------------
RIBA_VIBCH      ----------------------------------------------------------------------
RIBA_SHEON      ----------------------------------------------------------------------
RIBA_SHESM      ----------------------------------------------------------------------
RIBA_SHEAM      ----------------------------------------------------------------------
RIBA_VIBVU      ----------------------------------------------------------------------
RIBA_SHESW      ----------------------------------------------------------------------
RIBA_SHEPC      ----------------------------------------------------------------------
RIBA_NEIMA      ----------------------------------------------------------------------
RIBA_COLP3      ----------------------------------------------------------------------
RIBA_SHESR      ----------------------------------------------------------------------
RIBA_NEIG1      ----------------------------------------------------------------------
RIBA_ALISL      ----------------------------------------------------------------------
RIBA_SHEWM      ----------------------------------------------------------------------
RIBA_SHEFN      ----------------------------------------------------------------------
RIBA_SHEB5      ----------------------------------------------------------------------
RIBA_SHESA      ----------------------------------------------------------------------
RIBA_SHEB9      ----------------------------------------------------------------------
RIBA_SHEB8      ----------------------------------------------------------------------
RIBA_SHEB2      ----------------------------------------------------------------------
RIB3_MAGGR      LDLPQMVT--HNADPRGTAYTVSVDAEHSTTTGISAHDRALACRMLAAPDAQPSHFRRPGHVFPLXXXXX
RIBA_TERTT      ----------------------------------------------------------------------
RIBA_PSEPW      ----------------------------------------------------------------------
RIBA_PSEPK      ----------------------------------------------------------------------
RIBA_PSEPG      ----------------------------------------------------------------------
RIBA_PSEP1      ----------------------------------------------------------------------
RIBA_PSEE4      ----------------------------------------------------------------------
RIBA_HELHP      ----------------------------------------------------------------------
RIBA_AZOVD      ----------------------------------------------------------------------
RIBA_HAEIN      ----------------------------------------------------------------------
RIBA_HAEIG      ----------------------------------------------------------------------
RIBA_HAEI8      ----------------------------------------------------------------------
RIBA_AERHH      ----------------------------------------------------------------------
RIBA_PSESM      ----------------------------------------------------------------------
RIBA_BURMA      ----------------------------------------------------------------------
RIBA_SHELP      ----------------------------------------------------------------------
RIBA_XYLFA      ----------------------------------------------------------------------
RIBA_PASMU      ----------------------------------------------------------------------
RIBA_ACTSZ      ----------------------------------------------------------------------
RIBA_TOLAT      ----------------------------------------------------------------------
RIBA_PHOPO      ----------------------------------------------------------------------
RIBA_HAEIE      ----------------------------------------------------------------------
RIBA_XYLFT      ----------------------------------------------------------------------
RIBA_SHEDO      ----------------------------------------------------------------------
RIBA_PSEFS      ----------------------------------------------------------------------
RIBA_PSEAE      ----------------------------------------------------------------------
RIBA_PSEAB      ----------------------------------------------------------------------
RIBA_PSEA8      ----------------------------------------------------------------------
RIBA_DEHMU      ----------------------------------------------------------------------
RIB1_SCHPO      ----------------------------------------------------------------------
RIBA_SACD2      ----------------------------------------------------------------------
RIBA_BUCBP      ----------------------------------------------------------------------
RIBA_MANSM      ----------------------------------------------------------------------
RIBA_STRCO      ----------------------------------------------------------------------
RIBA_SHISS      ----------------------------------------------------------------------
RIBA_SHIFL      ----------------------------------------------------------------------
RIBA_SHIF8      ----------------------------------------------------------------------
RIBA_SHIDS      ----------------------------------------------------------------------
RIBA_SHIBS      ----------------------------------------------------------------------
RIBA_PSEA7      ----------------------------------------------------------------------
RIBA_ECOSM      ----------------------------------------------------------------------
RIBA_ECOSE      ----------------------------------------------------------------------
RIBA_ECOLU      ----------------------------------------------------------------------
RIBA_ECOLI      ----------------------------------------------------------------------
RIBA_ECOLC      ----------------------------------------------------------------------
RIBA_ECOHS      ----------------------------------------------------------------------
RIBA_ECODH      ----------------------------------------------------------------------
RIBA_ECOBW      ----------------------------------------------------------------------
RIBA_ECO8A      ----------------------------------------------------------------------
RIBA_ECO7I      ----------------------------------------------------------------------
RIBA_ECO5E      ----------------------------------------------------------------------
RIBA_ECO57      ----------------------------------------------------------------------
RIBA_ECO55      ----------------------------------------------------------------------
RIBA_ECO27      ----------------------------------------------------------------------
RIBA_ECO24      ----------------------------------------------------------------------
RIBA_ECOL6      ----------------------------------------------------------------------
RIBA_ECOL5      ----------------------------------------------------------------------
RIBA_ECO81      ----------------------------------------------------------------------
RIBA_ECO45      ----------------------------------------------------------------------
RIBA_PROMH      ----------------------------------------------------------------------
RIBA_KLEP7      ----------------------------------------------------------------------
RIBA_KLEP3      ----------------------------------------------------------------------
RIBA_BLOFL      ----------------------------------------------------------------------
RIBA_SALTY      ----------------------------------------------------------------------
RIBA_SALTI      ----------------------------------------------------------------------
RIBA_SALPA      ----------------------------------------------------------------------
RIBA_SALCH      ----------------------------------------------------------------------
RIBA_HAES2      ----------------------------------------------------------------------
RIBA_HAES1      ----------------------------------------------------------------------
RIBA_ENT38      ----------------------------------------------------------------------
RIBA_SHIB3      ----------------------------------------------------------------------
RIBA_CITK8      ----------------------------------------------------------------------
RIBA_BUCAI      ----------------------------------------------------------------------
RIB1_PICGU      ----------------------------------------------------------------------
RIBA_ESCF3      ----------------------------------------------------------------------
RIBA_BUCAP      ----------------------------------------------------------------------
RIBA_ENTS8      ----------------------------------------------------------------------
RIBA_ERWCT      ----------------------------------------------------------------------
RIBA_YERPS      ----------------------------------------------------------------------
RIBA_YERPE      ----------------------------------------------------------------------
RIBA_HAMD5      ----------------------------------------------------------------------
RIBA_WIGBR      ----------------------------------------------------------------------
RIBB_METJA      LGIPFMVDASQKFKVLRSSFSITINHRK-TFTGITDNDRAFTIKKLAELVKEGKEFRSPGHVTLLRAAEG
RIBA_BAUCH      ----------------------------------------------------------------------
RIB1_YEAST      ----------------------------------------------------------------------
RIBA_BLOPB      ----------------------------------------------------------------------
RIBB_METTH      LGIPYMTDIMEEASDEKSAFSITVNHRK-TFTGITDNDRALTIELADRHESFGDLFRSPGHVTLLRAADG
RIBB_METMA      LKL-PFMADLVREASKTSDSLGEVVEKDGTRTGIPDIERALTIRKIGEITEESNEFRTPGHVALLRAAEG
RIBB_METAC      LKL-PFMADLVREASRTSESLGEVVEKDGTRTGIPDLERALTIRKIGEITEKSNEFRTPGHVALLRAAEG
RIBB_ARCFU      LGLPFMADADDIKYDSRSSFSLWVNHRD-TFTGITDVDRALTIRMGKKVDF-GREFRSPGHVALLRAADK
URC1_SACKL      ----------------------------------------------------------------------
URG1_SCHPO      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GVLGRNGHTEATVDLMKLSGFNSAGVLCELMNKDGTMMKAAELEAFAKKHDLPLLTIAELYQYRLATEIF
RIBBA_THEPX     GVLVRAGHTEAAVDLAVLAGLKPAGVICEIIKDDGNMARLPDLLEFAKKFGLRIISIEDLIKYRMKNEIL
RIBBA_THEP3     GVLVRAGHTEAAVDLAVLAGLKPAGVICEIIKDDGNMARLPDLLEFAKKFGLRIISIEDLIKYRMKNEIL
RIBBA_AQUAE     GVLERAGHTEASVDLARLAGLYPAGVICEIMKDDGTMARVPDLMEFAKKHNLKIITIADLIKYRLRRETL
RIBBA_CYTH3     GVLRRVGHTEAAVDLARLAGFKPAGVLIEIMSEDGSMARLPELKQIATKFNLKLISIKDLIEYRLTHESL
RIBBA_STAAC     GVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQKFKEKHQLKMITIDDLIEYRKKLEPE
RIBBA_STAAW     GVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQKFKEKHQLKMITIDDLIEYRKKLEPE
RIBBA_STAAS     GVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQKFKEKHQLKMITIDDLIEYRKKLEPE
RIBBA_STAAR     GVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQKFKEKHKLKMITIDDLIEYRKKLEPE
RIBBA_STAAN     GVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQNFKEKHQLKMITIDDLIEYRKKLEPE
RIBBA_STAAM     GVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQNFKEKHQLKMITIDDLIEYRKKLEPE
RIBBA_UNCTG     GVLARTGHTEAAVDLVRLAGFYPAGIICEIMNNDGTMARMSDLIKFAKKHDLHIITIGELVNYRRRTEKF
RIBBA_BACV8     GVLRRAGHTEACIDMARLAGLYPAAALMEIMSEDGTMARLPELRKMADEWGLKLISIRDLIAYRLKQESL
RIBBA_BACTN     GVLRRAGHTEATIDMARLAGLYPAGALMEIMSDDGTMARLPELRAMADEHGLKLISIHDLIAYRLKQESI
RIBBA_STAEQ     GVLTRNGHTEAAVDLARLTGAQPAGVICEIMNDDGTMAKGEDLQSFKERHHLKMITIKSLVAFRKAVELN
RIBBA_BACWK     GVLRRAGHTEAAVDLAKLCGAEPAGVICEIINEDGTMARVPDLLECAKQFDIKMITIEDLIAYRRHHETL
RIBBA_BREBN     GVLRRAGHTEAAVDLARLAGGIPAGVICEIMNEDGSMARLPQLVEIARRFDLKLITIADLIAYRMRTESM
RIBBA_BACSK     GVLRRAGHTEAAVDFAKLCGAKPAGVICEVMNEDGSMARVPELRIIADQHNLPLVTIKDLIAYRRKTEKV
RIBBA_STAES     GVLTRNGHTEAAVDLARLTGAQPAGVICEIMNDDGTMAKGEDLQSFKERHHLKMITIKSLVAFRKAVELN
RIBBA_SALTO     GVLRRTGHTEAATDLTRLAGLRPAGVLCELVNDDGTMMRVPDLERFCAEHSLVLVTIADLVMYRRRTEKQ
RIBBA_BACFR     GVLRRAGHTEASVDLAKLAGLYPAAALIEIINEDGTMARLPQLVEVARRFGLKIISIKDLIAYRLQMESI
RIBBA_BACFN     GVLRRAGHTEASVDLAKLAGLYPAAALIEIINEDGTMARLPQLVEVARRFGLKIISIKDLIAYRLQMESI
RIBBA_CLONN     GVLKRAGHTEAAVDLATLAGLTPAGTICEIMNEDGTMARVPDLMKYVKVHNLKIVTIADLIEYRRKTESF
RIBBA_CHLTR     GAVQRPGHTEAAMDLMRLAGMQPCGIFAELVNPDHSMMRQQQVLAFAEQHDLTVITVDDLITYRYTYDSL
RIBBA_BACA2     GVLKRAGHTEAAVDLAKACGSQGAGVICEIMNEDGTMARVPELAEIAERHQLKMITIKDLIEYRYNITTL
RIBBA_SALAI     GVLRRPGHTEAAIDLTRLAGLRPAGVLCELVNDDGTMMRVPDLERFCAEHSLVLITIADLVAYRRRTEKQ
RIBBA_BACCR     GVLRRAGHTEAAVDLAKLCGAEPAGVICEIINEDGTMARVPDLIECAKQFDIKMITIEDLIAYRRHHETL
RIBBA_BACCQ     GVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMITIEDLIAYRRHHETL
RIBBA_BACC7     GVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMITIEDLIAYRRHHETL
RIBBA_BACHK     GVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMITIEDLIAYRRHHETL
RIBBA_BACC3     GVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMITIEDLIAYRRHHETL
RIBBA_BACAN     GVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMITIEDLIAYRRHHETL
RIBBA_BACAH     GVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMITIEDLIAYRRHHETL
RIBBA_BACAC     GVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMITIEDLIAYRRHHETL
RIBBA_BACAA     GVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMITIEDLIAYRRHHETL
RIBBA_BACSU     GVLKRAGHTEAAVDLAEACGSPGAGVICEIMNEDGTMARVPELIEIAKKHQLKMITIKDLIQYRYNLTTL
RIBBA_BACC2     GVLRRAGHTEAAVDLAKLCGAEPAGVICEIINEDGTMARVPDLIECAKQFDIKMITIEDLIAYRRHHETL
RIBBA_BACC1     GVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMITIEDLIAYRRHHETL
RIBBA_BACC4     GVLRRAGHTEAAVDLAKLCGAEPAGVICEIINEDGTMARVPDLIECAKQFDIKMITIEDLIAYRRHHETL
RIBBA_BACC0     GVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMITIEDLIAYRRHHETL
RIBBA_CHLPN     GVLKRAGHTESTVDLMELAGLQPCGVLAELVNEDYSMMRLPQILEFARKHNIAVIPVTSIIAHRMLSDRL
RIBBA_BACCZ     GVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGAMARVPDLLQCAKQFDIKMITIEDLIAYRRHHETL
RIBBA_ACTP7     GVLVRNGHTEATVDLARLAGLKHAGLCCEIMADDGTMMTMPDLQKFAVEHNMPFITIQQLQEYRRKHDSL
RIBBA_BACAM     GVLKRAGHTEAAVDLAKACGSQGADVICEIMNEDGTMARVPEISEIAKSHQLKMITIKDLIEYRYNITTL
RIBBA_STAHJ     GVLERTGHTEAAVDLAKLTKAAPAGVICEIMNEDGTMAKGEQLEAFKHQHGLKMITIESLVNYQKDKDTS
RIBBA_ACTPL     GVLVRNGHTEATVDLARLAGLKHAGLCCEIMADDGTMMTMPDLQKFAVEHNMPFITIQQLQEYRRKHDSL
RIBBA_ACTP2     GVLVRNGHTEATVDLARLAGLKHAGLCCEIMADDGTMMTMPDLQKFAVEHNMPFITIQQLQEYRRKHDSL
RIBBA_PORGI     GVLRRAGHTEAAVDLARLCGMQPAAALIEIINEDGTMARLPQLWEVSKRFGLKIIAIKDLIAYRLKQESI
RIBBA_PORG3     GVLRRAGHTEAAVDLARLCGMQPAAALIEIINEDGTMARLPQLWEVSKRFGLKIIAIKDLIAYRLKQESI
RIBBA_PROVI     GVLRRVGHTEAAVDLARLAGCSPVGLLCEILHEDGSMARLADLMTIKEKFGLKLITIKDLVAFQMRRSKL
RIBBA_ACTPJ     GVLVRNGHTEATVDLARLAGLKHAGLCCEIMADDGTMMTMPDLQKFAVEHNMPFITIQQLQEYRRKHDSL
RIBBA_BACCN     GVLRRAGHTEAAVDLAKLCGTEPVGVICEIIKEDGTMARVPDLIQVAKQFDIKMITIEDLIAYRRHHETF
RIBBA_MYCVP     GVLRRPGHTEAAVDLARLAGLQPAGAICEIVSQEGAMAQTDELRIFADEHDLALISIADLIEWRRKHEKH
RIBBA_GEOSW     GVLRRAGHTEAAVDLARLCGAKPAGVICEIIKEDGTMARVSDLRKIADEFDLKMITIKDLIEYXXXXXXX
RIBBA_MYCGI     GVLRRPGHTEAAVDLARLAGLQAAGTICEIVSQEGAMAQTDELRIFADEHDLALISIADLIEWRRKHEKH
RIBBA_MYCUA     GVLRRPGHTEAAVDLARMAGLQPAGAICEIVSREGSMAQTDELRVFADEHGLALITIADLIEWRRKHEKH
RIBBA_MYCPA     GVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQEGSMAQTDELRVFADEHDLAMITIADLIEWRRKHEKH
RIBBA_SYNWW     GVLRRAGHTEGSIDLTRLAGLYPAAVICEVMNEDGTMARLPQLLEFARQHNLKLASIADLIEYRRRKEKL
RIBBA_SYNY3     GVLKRAGHTEAAVDLSRLAGLYPAGVICEIQNADGSMARLPELVEYARKYDLKLISIADLISYRLQHDRF
RIBBA_MYCMM     GVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQEGSMAQTDELRVFADEHGLALITIADLIEWRRKHEKH
RIBBA_MYCA1     GVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQEGSMAQTDELRVFADEHDLAMITIADLIEWRRKHEKH
RIBBA_CHLMU     GVVKRPGHTEASMDLMRLAGMYPCGIFAELVNADHSMMRQQQILDFAEQHGFTVITVDDLITYRWTFDSL
RIBBA_STAS1     GVLSRRGHTEASVDLAKLTGAKPAALICEIMDEDGTMAKGASLEAFKETHGLVMISIEDLEKYRKSSISK
RIBBA_MYCTU     GVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQEGSMAHTDELRVFADEHGLALITIADLIEWRRKHEKH
RIBBA_MYCTA     GVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQEGSMAHTDELRVFADEHGLALITIADLIEWRRKHEKH
RIBBA_MYCBT     GVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQEGSMAHTDELRVFADEHGLALITIADLIEWRRKHEKH
RIBBA_MYCBP     GVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQEGSMAHTDELRVFADEHGLALITIADLIEWRRKHEKH
RIBBA_MYCBO     GVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQEGSMAHTDELRVFADEHGLALITIADLIEWRRKHEKH
RIBBA_PELLD     GVLRRVGHTEAAVDLARLAGCSPVGLLCEILHDDGSMARLPXXXXXXXXXXXXXITIKDLVAYRMQRNKL
RIBBA_PARD8     GVLRRAGHTEAAVDLARLAGLYPAGALIEIINEDGTMARLPQLIEVAXXXXXXXXXXXXXXAYRLRTESI
RIBBA_PROA2     GVLRRVGHTEAAVDLAELAGSTPVGLLCEILHDDGSMARLPELLKIKEKFDLKLITIKDLVAYQMKRKKL
RIBBA_ARATH     GVLKRAGHTEASVDLTVLAGLDPVGVLCEIVDDDGSMARLPKLREFAAENNLKVVSIADLIRYRRKRDKL
RIBBA_PELPB     GVLRRVGHTEAAVDLARLAGCSPTGLLCEILNDDGSMARLPQLIKLKAKFGLKLITIKELVAYQMQRNKL
RIBBA_MYCA9     GVLRRPGHTEASVDLAKLAGLRPAAVICEIVSQEGAMAQTEELRVFADEHNLALVSIADLIEWRRKHEKH
RIBBA_RHOE4     GVLRRPGHTEAAVDLARMADLRPAGVICEIVSQEGAMAQTDELRVFADEHNLALISIADLIAWRRKHEKH
RIBBA_CORGL     GVLVRAGHTEAAVDLARAAGLRPAGVICEVVSEEDPMARVPELRRFCDEHDLKLISIEQLIEWRRKNEIL
RIBBA_CORGB     GVLVRAGHTEAAVDLARAAGLRPAGVICEVVSEEDPMARVPELRRFCDEHDLKLISIEQLIEWRRKNEIL
RIBBA_NOCFA     GVLRRPGHTEAAVDLARMAGLRPAGVICEIVSQEGHMARTEELRVFADDHDLALISIADMIAWRRKHEKQ
RIBBA_RHOSR     GVLRRPGHTEAAVDLARMADLRPAGVICEIVSQEGHMAQTDELRVFADDHNLALISIADLIAWRRKHEKH
RIBBA_CORAM     GVLERDGHTEAAIDLARLAGLRPAGVLCEIVSEEDTMARSEELRRFSDEHDLKMISIEQLIEWRRHNETQ
RIBB_VIBSL      GVLARRGHTEGTVDLMQMAGLQSAGVLCEVTNPDGTMAKAPEIVAFGKMHNMPVLTIEDMVMYR------
RIBB_VIBVY      GVLARRGHTEGTVDLMQMAGLQPAGVLCELTNPDGTMAKTPEIIAFGKQHNMPVLTIEDMVMYR------
RIBB_VIBVU      GVLARRGHTEGTVDLMQMAGLQPAGVLCELTNPDGTMAKTPEIIAFGKQHNMPVLTIEDMVMYR------
RIBB_ECOSM      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_ECOLU      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_PECCP      GVLTRGGHTEATVDLMTLAGLKPSGVLCELTNDDGSMAHAPEVIAFAKQHDMPVLTIEDLVAYRVAAE--
RIBB_VIBHA      GVLARRGHTEGTIDLMYLANLVPSGILCELTNPDGTMAKLPETIEFARRHGMPVLTIEDIVDYRTGIDL-
RIBB_SHISS      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_SHIFL      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_SHIF8      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_SHIDS      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_SHIBS      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_SHIB3      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_EDWI9      GVLARRGHTEATIDLVSLAGFRPAGVLCELTNDDGTMARAPQVMAFARQHEMPVVTIEDLVAYRQARE--
RIBB_ECOUT      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_ECOSE      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_ECOLI      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_ECOLC      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_ECOL6      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_ECOL5      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_ECOK1      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_ECOHS      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_ECODH      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_ECOBW      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_ECO8A      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_ECO81      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_ECO7I      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_ECO5E      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_ECO57      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_ECO55      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_ECO45      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_ECO27      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_ECO24      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_SHESH      GVMTRRGHTEGTIDLMILAGLKPAGVLCEITNPDGTMARLAEIISFGAKHDLPVLTIEDIVEYR------
RIBB_ESCF3      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYRQAHE--
RIBB_NEIMB      GVLVRAGHTEAGVDLAQMNGLIPASVICEIINDDGTMARMPELMKFAEEHKLKIGTIADLIEYRSRTESL
RIBB_SALTY      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYRQAHE--
RIBB_SALTI      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYRQAHE--
RIBB_SALSV      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYRQAHE--
RIBB_SALPC      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYRQAHE--
RIBB_SALPB      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYRQAHE--
RIBB_SALNS      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYRQAHE--
RIBB_SALHS      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYRQAHE--
RIBB_SALG2      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYRQAHE--
RIBB_SALEP      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYRQAHE--
RIBB_SALDC      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYRQAHE--
RIBB_SALCH      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYRQAHE--
RIBB_SALA4      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYRQAHE--
RIBB_VIBPA      GVMTRRGHTEGTIDLMQMAGLQPAGVLCEVTNPDGTMAKAPEIVAFGHLHNMPVLTIEDMVAYR------
RIBB_SALPK      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYRQAHE--
RIBB_SALPA      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYRQAHE--
RIBB_CHLT3      GVLERPGHTEATVDLMRLAGLSPYGVLCELTNPDGTMANLDEAIAFAEKHDFPVLTVEDVINYRLEKE--
RIBB_ERWCT      GVLTRGGHTEATVDLMTLAGLKPSGVLCELTNDDGSMAHAPEVIAFAKQHDMLVLTIEDLVAYRIAAE--
RIBB_NEIMA      GVLVRAGHTEAGVDLAQMNGLIPAAVICEIINDDGTMARMPELMKFAEEHKLKIGTITDLIEYRSRTESL
RIBB_CLOBL      GVLTRPGHTEGTVDLMRLAGYNPAGILCELTNPDGTMARLPQIINFAKKHNLTILSIEDIIKYK------
RIBB_SHEFN      GVMSRRGHTEGTVDLMQMAGLMPAGVLCELANEDGSMAKTPEIIAFGLKHNMPVLTIEDMVMYR------
RIBB_ERWT9      GVLTRGGHTEATLDLVTLAGFKPAGVLCELTNDDGSMAHAPEVIVFARQHDMPVVTIEDLVSYRRSRE--
RIBB_CLOBH      GVLTRPGHTEGTVDLMRLAGYNPAGILCELTNPDGTMARLPQIINFAKKHNLAVLSIEDIIKYKKIT---
RIBB_CLOB1      GVLTRPGHTEGTVDLMRLAGYNPAGILCELTNPDGTMARLPQIINFAKKHNLAVLSIEDIIKYKKIT---
RIBB_SALAR      GVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDNGTMARAPECIAFAGQHNMAVVTIEDLVAYRLAHE--
RIBB_SERP5      GVLSRRGHTEATIDLVSMAGFKPAGVLCELTNDDGSMAHAPEVILFAKQHDMTVLTIEDLVAYRQAHE--
RIBB_PROMH      GVLTRGGHTEASIDLATLAGFKPVAVLCELTNDDGTMARAPEVVTFAKQHDMPVLTIEDLVAYRLREE--
RIBB_CITK8      GVLTRGGHTEATIDLVTLAGFKPAGVLCELTNDDGTMARAPECIAFAGKHNMAVVTIEDLVAYRQAHE--
RIBB_HAMD5      GVLGRSGHTEAAIDLARLAGLKPAGVLCELTNDNGTMARAPEVIAFAKKHKMTVLSIEDLIEYR------
RIBB_HAEIN      GVLTRRGHTEASVDLARLAGFKEAGVICEITNDDGTMARAPEIVEFAKKFGYSVLTIEDLVEYRLAHNI-
RIBBA_THEMA     GFQRRKGHTEASLEISELAGFSRHAVIVEILDEKGNSHNLDYVLKLSEKFSLPVLEMDDVWREFVKRKLL
RIBB_ENT38      GVLTRGGHTEATLDLVTLAGFKPAGVLCELTNDDGTMARAPECVTFARLHNMPVVTIEDLVEYRQAHE--
RIBB_HAEI8      GVLTRRGHTEASVDLARLAGFKEAGVICEITNDDGTMARTPEIVEFAKKFGYSVLTIEDLVEYRLAHNI-
RIBB_SHEWM      GVFSRRGHTEGTIDLMLLAGLKPAGVLCEITNPDGTMARLPEIIQFGQQHNLPVLTIEDIVEYRKVT---
RIBB_DESAD      GVLEREGHTEATVDMMTLAGLNPCGVLCELTNPDGTMARLPEIVEFGQKHDMPVLTVDDIINYRI-----
RIBB_SODGM      GVLVRGGHTEAAVDLTTLAGLKPAGVLCEVTNDDGSMAHAPEIIAFGRRHNMPVLTIEDLVAYRRA----
RIBB_RALEJ      GVLVRRGHTEGSVELARMAGLSPAAVLCELMNPDGTMARRPEALSFAEMYRLPILTIADLVAWR------
RIBB_KLEP7      GVLTRGGHTEATIDLVTLAGFKPAGVLCELTNDDGTMARAPECIKFAQQHNMAVVTIEDLVAYR------
RIBB_SHELP      GVLTRRGHTEGTIDLMKLAGLKPAGVLCEVTNVNGTMARLPEIIAFGEQHKMPVLTIEDIVCYR------
RIBB_SHEHH      GVLERRGHTEGTVDLMKLAGLKPYGVLCEVTLVDGTMARLPEIIEFGQQHDMPVLTIEDIVAYR------
RIBB_PHOLE      GVLIRAGHTEAGCDVARLAGLEPSSVIVEILNEDGSMARRPQLEIFAEKHGLKLGTIADLIEYRTQQESH
RIBB_KLEP3      GVLTRGGHTEATIDLVTLAGFKPAGVLCELTNDDGTMARAPECIKFAQQHNMAIVTIEDLVAYR------
RIBB_DESPS      GVLDRRGHTEGTVDLMKLSGLAPAGLLCELTNVDGTMARLPEIVDFARKRDMQVLSIEDIAQYR------
RIBB_BAUCH      GVLNRGGHTEAAIDLTLLAGLKPAGVLCEVTNEDGSMARALEIIAFSNQHNMPVLTINDLVAYR------
RIBB_SHESA      GVLTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGAEHNMPVLTIEDIVIYR------
RIBB_PSESM      GVLTRAGHTEAGCDLARMAGFTPASVIVEVMNDDGTMARRPDLELFAEKHGIRIGTIADLIHYRLSTEHT
RIBB_SHESR      GVLTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGAAHNMPVLTIEDIVVYR------
RIBB_SHESM      GVLTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGAAHNMPVLTIEDIVVYR------
RIBB_YERE8      GVLSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIEFAKLHDMPVVTIDDLAEYRQSQE--
RIBB_PELPD      GVLERRGHTEATVDLMRLAGLKPCGVLCELTNPDGSMARMPEIVAFSRKHGFPLITVEELVQYRI-----
RIBB_SHESW      GVLTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGAQHNIPVLTIEDIVLYR------
RIBB_SHEPC      GVLTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGAQHNIPVLTIEDIVLYR------
RIBB_DESRM      GVLERQGHTEATVDLMKLAGLQPYGVLCELTNIDGTMARLPEVVTFANKNNIPVVTIDDLIMYR------
RIBB_DESAH      GVLGRRGHTEGTVDLMRLAGLAPAGVLCELTNVDGTMARLPQIITFADEHGFPVLSIEDIAAYR------
RIBB_DESAA      GVLERRGHTEATVDMMRLAGLNPCGVLCELTNPDGTMARLPQLADFAKKHGMVLLTVEDLAAYRESQE--
RIBB_HAEIG      GVLTRRGHTEASVDLARLAGFKEAGVICEITNDDGTMARTPDIVEFAKKFGYSVLTIEDLVEYRLANNI-
RIBB_HAEIE      GVLTRRGHTEASVDLARLAGFKEAGVICEITNDDGTMARTPDIVEFAKKFGYSVLTIEDLVEYRLAHNI-
RIBB_PHOPR      GVLGRRGHTEATIDLMRLSGLKPYGVLCELTNIDGTMARLPEVIVFGKKFNMPVLTIEDLAAYRLAKE--
RIBB_YERPY      GVLSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVTIDDLAAY-------
RIBB_YERPS      GVLSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVTIDDLAAY-------
RIBB_YERPP      GVLSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVTIDDLAAY-------
RIBB_YERPN      GVLSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVTIDDLAAY-------
RIBB_YERPG      GVLSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVTIDDLAAY-------
RIBB_YERPE      GVLSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVTIDDLAAY-------
RIBB_YERPB      GVLSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVTIDDLAAY-------
RIBB_YERPA      GVLSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVTIDDLAAY-------
RIBB_YERP3      GVLSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVTIDDLAAY-------
RIBB_VIBFI      GVLTRRGHTEGTVDLMRLAELTPAGVLCEVTNSDGSMAKTPEIIIFAEQHHLPVLTVNDIALYR------
RIBB_SHEPW      GVLERRGHTEGTVDLMKLAGLKPFGVLCEVTLPDGTMARLPEIVEFGQQHNMPVLTIEDIVAYR------
RIBB_PASMU      GVLKRRGHTEASVDLARLAGYKAAGVICEITNDDGSMARAPEIVTFAQKFGFPVVTIEDLVAYR------
RIBB_SHEON      GVLTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGALHNMPVLTIEDIVVYR------
RIBB_VIBCM      XXXXXXXHTEGTVDLMQMAGLQPAGVLCELTNPDGSMAKTPEIIEFGKLHNMPVLTIEDMVQYRIQFDL-
RIBB_VIBCH      XXXXXXXHTEGTVDLMQMAGLQPAGVLCELTNPDGSMAKTPEIIEFGKLHNMPVLTIEDMVQYRIQFDL-
RIBB_PHOPO      GVLARAGHTEAGCDVARLAGLEPSSVIVEILNDDGTMARRPQLEVFAKKHGLKLGTVADLIEYRNKYETM
RIBB_HELPY      GVLARTGHTEASVDLCKLAGLKPVSVICEIMKEDGSMARRGDLSDFALKHNLKTLYVSDLISYRLENESL
RIBB_HELHP      GVLVRTGHTEASVDICRLAGVAPISVICEIMKKDGTMAGRGDLLDFASQHHLKILYVSDIIQYRLNFENL
RIBB_BUCBP      GILGRIGHTEAAIEFVTLAGFKPAGIICELTNRNGTMSKVPDIIKFSKLKKMTIVTIRDLIQY-------
RIBB_PSEHT      GVLVRRGHTEASVDLMQLAGLKPFGVICELTNPDGSMARLPEVSGYANKHNMPVVSIEDLVQY-------
RIBB_HAES2      GVLARRGHTEAAVDLASWAGHKPAGVICEITNDDGSMARTLEIVEFGKKFNYPVVTIEDLVRY-------
RIBB_ENTS8      GVLTRGGHTEATIDLVSLAGFKPAGVLCELTNDDGTMARAPECIAFAREHNMPVVTIEDLVSYRQAQE--
RIBB_HAES1      GVLARRGHTEAAVDLASWAGHKPAGVICEITNDDGSMARTPEIVEFGKKFNYPVVTIEDLVRY-------
RIBB_MANSM      GVLARPGHTEAAVDLARLCGYKPAGVICEITNDDGTMARTPELVAFAQKFGYAVVTIEDLIAYR------
RIBB_VIBC3      XXXXXXXHTEGTVDLMQMAGLQPAGVLCELTNPDGSMAKTPEIIAFGKLHNMPVLTIEDMVQYRIQFDL-
RIBB_SHEPA      GVLERRGHTEGTVDLMKLAGLQPFGVLCEVTLPDGTMARLPEIVEFAQQHDMPVLTIEDIVAYR------
RIBB_PSEAE      GTLARAGHTEAACDLARMAGFEPSGVICEVMNDDGSMARRPELEAFAAEHGIKIGTIADLIHYRLIHERT
RIBB_CAMJE      GVLERTGHTEGTVDLCKLAGLKGACVICEIVKDNGDMARREDLEIFCQKHDLNMIAVSDLIEYRLKHESL
RIBB_DESDG      GVLERRGHTEATVDLMRLAGLKPCGVLCEVTNPDGTMARLPQIVDFGRKHDMVVLTVDDLVRYR------
RIBB_TOLAT      GVLTRRGHTEATIDLMKLAGLKPYGVLCEVQNEDGSMARLPGIVEFANKHNMPVLCIEDLVAY-------
RIBB_DEHMU      GALVRIGHTEGSVDLCRLAGQGDSAVICEIMKEDGTMARRPDLDIFCAKHELNIVYISDIVEYRMMNESL
RIBB_SHEB9      GVLTRRGHTEGTIDLVQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGALHNMPVLTIEDIVVYR------
RIBB_SHEB2      GVLTRRGHTEGTIDLVQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGALHNMPVLTIEDIVVYR------
RIBB_BUCAT      GVLSRPGHTEAAIEIVSLAGFKPAGVICELTNKDGTMARTPEIIKFSENKKMQVLTIQDLIFY-------
RIBB_BUCAI      GVLSRPGHTEAAIEIVSLAGFKPAGVICELTNKDGTMARTPEIIKFSENKKMQVLTIQDLIFY-------
RIBB_BUCA5      GVLSRPGHTEAAIEIVSLAGFKPAGVICELTNKDGTMARTPEIIKFSENKKMQVLTIQDLIFY-------
RIBB_SHEB8      GVLTRRGHTEGTIDLVQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGALHNMPVLTIEDIVVYR------
RIBB_SHEB5      GVLTRRGHTEGTIDLVQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGALHNMPVLTIEDIVVYR------
RIBB_HELPJ      GVLARTGHTEASVDLCKLAGLKPVSVICEIMKEDGSMARRGDLSDFAIKHNLKTLYVSDLISYRLENESL
RIBB_PELCD      GVLTRRGHTEGTVDLMRMAGYKPAGVLCELTNEDGTMARLPEIITFAERHYLSVVSIEDL---ALALESH
RIBB_BLOFL      GVLSRSGHTEAAVDLTTLAGLKPFGVICEVTNEDGSMARTTEIIKFSKQYDMPVLTISDVIAYRMS----
RIBB_CHLL2      GVLERPGHTEATVDLMRLAGLSPAGVLCELTNPDGSMAGIEETFAFSVQHGFPVLSIGDIVAYR------
RIBB_WIGBR      GILSRAGHTEAAVDLTKLAGLKPAGVICEVMNDDGSMARMPEIINFSKKYNMPVLIIKDIIEY-------
RIBA_ARCFU      GVLERPGIAEACVDLARMAGFAPSAVYAPLMTAEGGVAGEDYALKFAKEHSMPVFRIKDMIEFRIKSEKI
RIBB_PHOLL      GVLVRQGHTEAAIDLVSLAGFKPAGVLCELTNDDGSMARTLEVVQFAKLHNMPVVTIEDLVIYRQAIE--
RIBB_AGRT5      GVLGRTGHTEAAVDLCRLAGKFPSGTICEVANDDGTMARLPQLEIFAERHGLLVVTIKDLVSY-------
RIBB_BORPE      GVLTRRGHTEGSVDLAALAGLRPAGVLCELMNADGTMMRGASLERYAAKEGLVALAIDEL----------
RIBB_BORPA      GVLTRRGHTEGSVDLAALAGLRPAGVLCELMNADGTMMRGASLERYAAKEGLVALAIDEL----------
RIBB_BORBR      GVLTRRGHTEGSVDLAALAGLRPAGVLCELMNADGTMMRGASLERYAAKEGLVALAIDEL----------
RIBB_WOLSU      GVLVRTGHTEGSVDICKLAGVAPVAVICEIIKKDGHMARRDDLMEFAKEHHLKIVYISDLIEYRMQNEML
RIBB_RALSO      GVLARRGHTEGSVDLARLAGLSPAGVLCELMLPDGTMARRDDAVRFADQHGLPVLTIEDIARYR------
RIBB_RHORT      GLSARRGHTEATIALMRLAGLRPAGVLCEVMNPDGTMARLPTLIGYGQAHGLPIVSIEDL----------
RIBB_DESVV      GVLERRGHTEATVDLMRLAGLKPYGVLCELTNPDGTMARLPQLVDFAQRNRMTVLTVEDLVAYR------
RIBB_BUCAP      GILARAGHTEAAIEIVSLAGFKPYGVICELTNKDGSMSRTPEXXXXXXXXXXXXLTIKDLILY-------
RIBB_DESVH      GVLERRGHTEATVDLMRLAGLKPYGVLCELTNPDGTMARLPQLVDFAQRNRMTVLTVEDLVAYR------
RIBB_CHRVO      XXXXXXXHTEASVELARLAGFSPAGVLCELMNPDGTMMRGQQVQDYAERHDLPQLSVAELAEW-------
RIBB_AERS4      GVLTRRGHTEATVDLMQLAGLKPFGVLCELTKEDGSMARLPDLVAFGRLHQMPVLTIEDLVQYR------
RIBB_METLZ      GVFEREGHTEATVDLMKLAGLREAGLCCEIMADNGEMMRTPELISMAKQYNLTFVTIKDLQAYRRKQE--
RIBB_AERHH      GVLTRRGHTEATVDLMQLAGLKPFGVLCELTKEDGSMARLPDLVAFGRQHQMPVLTIEDLVQYR------
RIB3_YEAST      GVLQRRGHTEAGVDLCKLSGLSPVAVIGELVNDDGTMMRLNDCQAFGKKHGIPLISIEELAQY-------
RIBB_DESDA      GVLERRGHTEATVDLMRLAGHAPCGVLCELTLDDGSMARLPQVAAFAVAHAIPLCSVEDLVAWR------
RIBB_OCEIH      GVLERRGHTEAAVDLARLSNSIPSAYICEILNDDGTMARYPALETLAKDWDLTLITVEDLVQYR------
RIBB_PSEPK      GVLTRRGHTEGSVDLARLAGLRPAAVLCELMNPDGSMARGEQVAVYARQYNLPVLTIEELARYREA----
RIB3_SCHPO      GVLERDGHTEAAVDLCKLAGLPPVGAICELVEEDGLMSRFDDCISFGKKWGIKVITIESLKSY-------
RIB3_CANAL      LLKKRRGHTEAAVQLSTLAGLQPAGVICELVDEDGLMMRLDDCIQFXXXXXXXXXXXXQLVEY-------
RIBA_PICTO      ----------------------------------------------------------------------
RIBA_HELPY      ----------------------------------------------------------------------
RIBA_HELP2      ----------------------------------------------------------------------
RIBA_HELPH      ----------------------------------------------------------------------
RIBA_MARMS      ----------------------------------------------------------------------
RIBA_HELPS      ----------------------------------------------------------------------
RIBA_CAMHC      ----------------------------------------------------------------------
RIBA_HELAH      ----------------------------------------------------------------------
RIBA_HELPJ      ----------------------------------------------------------------------
RIBA_AZOBR      ---------------------------------------------WAAEHDLLLVRARDIADYRVHVVRT
RIBA_SHEPA      ----------------------------------------------------------------------
RIBA_VIBF1      ----------------------------------------------------------------------
RIBA_PSYIN      ----------------------------------------------------------------------
RIBA_VIBFM      ----------------------------------------------------------------------
RIBA_THEVO      ----------------------------------------------------------------------
RIBA_CAMFF      ----------------------------------------------------------------------
RIBA_ACIB5      ----------------------------------------------------------------------
RIBA_ACIAD      ----------------------------------------------------------------------
RIBA_ACIBY      ----------------------------------------------------------------------
RIBA_ACIBT      ----------------------------------------------------------------------
RIBA_ACIBS      ----------------------------------------------------------------------
RIBA_ACIBC      ----------------------------------------------------------------------
RIBA_ACIB3      ----------------------------------------------------------------------
RIBA_SHESH      ----------------------------------------------------------------------
RIBA_SHEHH      ----------------------------------------------------------------------
RIBA_SHEPW      ----------------------------------------------------------------------
RIBA_VIBPA      ----------------------------------------------------------------------
RIBA_NEIMF      ----------------------------------------------------------------------
RIBA_NEIMB      ----------------------------------------------------------------------
RIBA_NEIM0      ----------------------------------------------------------------------
RIBA_HAHCH      ----------------------------------------------------------------------
RIBA_VIBCH      ----------------------------------------------------------------------
RIBA_SHEON      ----------------------------------------------------------------------
RIBA_SHESM      ----------------------------------------------------------------------
RIBA_SHEAM      ----------------------------------------------------------------------
RIBA_VIBVU      ----------------------------------------------------------------------
RIBA_SHESW      ----------------------------------------------------------------------
RIBA_SHEPC      ----------------------------------------------------------------------
RIBA_NEIMA      ----------------------------------------------------------------------
RIBA_COLP3      ----------------------------------------------------------------------
RIBA_SHESR      ----------------------------------------------------------------------
RIBA_NEIG1      ----------------------------------------------------------------------
RIBA_ALISL      ----------------------------------------------------------------------
RIBA_SHEWM      ----------------------------------------------------------------------
RIBA_SHEFN      ----------------------------------------------------------------------
RIBA_SHEB5      ----------------------------------------------------------------------
RIBA_SHESA      ----------------------------------------------------------------------
RIBA_SHEB9      ----------------------------------------------------------------------
RIBA_SHEB8      ----------------------------------------------------------------------
RIBA_SHEB2      ----------------------------------------------------------------------
RIB3_MAGGR      XXXXXXXHTEAGVELCRLAGKRPVAVISEIVD-DGQMLRGDECVAFARRWGLKVCTIEDMIAHVEKTE--
RIBA_TERTT      ----------------------------------------------------------------------
RIBA_PSEPW      ----------------------------------------------------------------------
RIBA_PSEPK      ----------------------------------------------------------------------
RIBA_PSEPG      ----------------------------------------------------------------------
RIBA_PSEP1      ----------------------------------------------------------------------
RIBA_PSEE4      ----------------------------------------------------------------------
RIBA_HELHP      ----------------------------------------------------------------------
RIBA_AZOVD      ----------------------------------------------------------------------
RIBA_HAEIN      -------------------------------------------------------------QANLPTEYG
RIBA_HAEIG      -------------------------------------------------------------QANLPTEYG
RIBA_HAEI8      -------------------------------------------------------------QANLPTEYG
RIBA_AERHH      ----------------------------------------------------------------------
RIBA_PSESM      ----------------------------------------------------------------------
RIBA_BURMA      ----------------------------------------------------------------------
RIBA_SHELP      ----------------------------------------------------------------------
RIBA_XYLFA      ----------------------------------------------------------------------
RIBA_PASMU      ----------------------------------------------------------------------
RIBA_ACTSZ      ----------------------------------------------------------------------
RIBA_TOLAT      ----------------------------------------------------------------------
RIBA_PHOPO      ----------------------------------------------------------------------
RIBA_HAEIE      ----------------------------------------------------------------------
RIBA_XYLFT      ----------------------------------------------------------------------
RIBA_SHEDO      ----------------------------------------------------------------------
RIBA_PSEFS      ----------------------------------------------------------------------
RIBA_PSEAE      ----------------------------------------------------------------------
RIBA_PSEAB      ----------------------------------------------------------------------
RIBA_PSEA8      ----------------------------------------------------------------------
RIBA_DEHMU      ----------------------------------------------------------------------
RIB1_SCHPO      ----------------------------------------------------------------------
RIBA_SACD2      ----------------------------------------------------------------------
RIBA_BUCBP      ----------------------------------------------------------------------
RIBA_MANSM      ----------------------------------------------------------------------
RIBA_STRCO      ----------------------------------------------------------------------
RIBA_SHISS      ----------------------------------------------------------------------
RIBA_SHIFL      ----------------------------------------------------------------------
RIBA_SHIF8      ----------------------------------------------------------------------
RIBA_SHIDS      ----------------------------------------------------------------------
RIBA_SHIBS      ----------------------------------------------------------------------
RIBA_PSEA7      ----------------------------------------------------------------------
RIBA_ECOSM      ----------------------------------------------------------------------
RIBA_ECOSE      ----------------------------------------------------------------------
RIBA_ECOLU      ----------------------------------------------------------------------
RIBA_ECOLI      ----------------------------------------------------------------------
RIBA_ECOLC      ----------------------------------------------------------------------
RIBA_ECOHS      ----------------------------------------------------------------------
RIBA_ECODH      ----------------------------------------------------------------------
RIBA_ECOBW      ----------------------------------------------------------------------
RIBA_ECO8A      ----------------------------------------------------------------------
RIBA_ECO7I      ----------------------------------------------------------------------
RIBA_ECO5E      ----------------------------------------------------------------------
RIBA_ECO57      ----------------------------------------------------------------------
RIBA_ECO55      ----------------------------------------------------------------------
RIBA_ECO27      ----------------------------------------------------------------------
RIBA_ECO24      ----------------------------------------------------------------------
RIBA_ECOL6      ----------------------------------------------------------------------
RIBA_ECOL5      ----------------------------------------------------------------------
RIBA_ECO81      ----------------------------------------------------------------------
RIBA_ECO45      ----------------------------------------------------------------------
RIBA_PROMH      ----------------------------------------------------------------------
RIBA_KLEP7      ----------------------------------------------------------------------
RIBA_KLEP3      ----------------------------------------------------------------------
RIBA_BLOFL      ----------------------------------------------------------------------
RIBA_SALTY      ----------------------------------------------------------------------
RIBA_SALTI      ----------------------------------------------------------------------
RIBA_SALPA      ----------------------------------------------------------------------
RIBA_SALCH      ----------------------------------------------------------------------
RIBA_HAES2      ----------------------------------------------------------------------
RIBA_HAES1      ----------------------------------------------------------------------
RIBA_ENT38      ----------------------------------------------------------------------
RIBA_SHIB3      ----------------------------------------------------------------------
RIBA_CITK8      ----------------------------------------------------------------------
RIBA_BUCAI      ----------------------------------------------------------------------
RIB1_PICGU      ----------------------------------------------------------------------
RIBA_ESCF3      ----------------------------------------------------------------------
RIBA_BUCAP      ----------------------------------------------------------------------
RIBA_ENTS8      ----------------------------------------------------------------------
RIBA_ERWCT      ----------------------------------------------------------------------
RIBA_YERPS      ----------------------------------------------------------------------
RIBA_YERPE      ----------------------------------------------------------------------
RIBA_HAMD5      ----------------------------------------------------------------------
RIBA_WIGBR      ----------------------------------------------------------------------
RIBB_METJA      LVKNRQGHTEMTVALAELANLVPITTICEMMGDDGNAMSKNETKRYAEKHNLIYLSGEEIINYYL-----
RIBA_BAUCH      ----------------------------------------------------------------------
RIB1_YEAST      ----------------------------------------------------------ETQQDRMIRGAY
RIBA_BLOPB      ----------------------------------------------------------------------
RIBB_METTH      HVLRRGGHTEMSIALMEMAGLTGVAVCCEMMDRTGNSLSTEDAMKYAREHDLIFMSGAELIE--------
RIBB_METMA      LLDERMGQTELSVALARMAGITPAMVVCEMLDDDGKALSKEKSKEYGKEHGLVFLEGREIVE--------
RIBB_METAC      LLDERMGQTELSVALARMAGITPAMVVCEMLDESGRALSKENSKDYGKDHGLVFLEGQEILE--------
RIBB_ARCFU      LTYERVGQTELSVALAEMAGIAPAVAICEMLDAEGKALTKEKAMEYAEEKGIPFITIVEHYR--------
URC1_SACKL      ----------------------------------------------------------------------
URG1_SCHPO      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VTKMASSTIPFKKIGELEMSVYKDNFSGDEVVVLSKPYSGNNPLVRMHSSCMTGDIFGSLRCDCQDQLHK
RIBBA_THEPX     VRRVAQAKLP-TKYGNFEIVGYEEILTGKQHVALIKGDVNKEPLVRIHSECLTGDILGSLRCDCGDQLHA
RIBBA_THEP3     VRRVAQAKLP-TKYGNFEIVGYEEILTRKQHVALIKGDINKEPLVRIHSECLTGDILGSLRCDCGDQLHA
RIBBA_AQUAE     VEKVASAHLP-TPWGVFKIHAYRHKLTGEEQVALTMEWKEDEPLVRVHSECLTGDVFRSFRCDCRPQLEK
RIBBA_CYTH3     VKREIGVDMP-TNLGDFDLIAFRQISTGEVHLALIKTWEKDEPMVRVHSSCVTGDIFGSCRCDCGPQLHK
RIBBA_STAAC     IEFKAKVKMP-TDFGTFDMYGFKATYTDEEIVVLTKGAIRQHENVRLHSACLTGDIFHSQRCDCGAQLES
RIBBA_STAAW     IEFKAKVKMP-TDFGTFDMYGFKATYTDEEIVVLTKGAIRQHENVRLHSACLTGDIFHSQRCDCGAQLES
RIBBA_STAAS     IEFKAKVKMP-TDFGTFDMYGFKATYTDEEIVVLTKGAIRQHENVRLHSACLTGDIFHSQRCDCGAQLES
RIBBA_STAAR     IEFKAKVKMP-TDFGTFDMYGFKATYTDEEIVVLTKGAIRQHENVRLHSACLTGDIFHSQRCDCGAQLES
RIBBA_STAAN     IEFKAKVKMP-TDFGTFDMYGFKATYTDEEIVVLTKGAIRQHENVRLHSACLTGDIFHSQRCDCGAQLES
RIBBA_STAAM     IEFKAKVKMP-TDFGTFDMYGFKATYTDEEIVVLTKGAIRQHENVRLHSACLTGDIFHSQRCDCGAQLES
RIBBA_UNCTG     ISEIVNVDLP-TRYGDFKLVLFEDLITKDSHIAVVKGVVKNNVLVRVHSSCETGDIFHSLRCDCGDQLET
RIBBA_BACV8     VEKGVEVDMP-TEYGHFRLIPFRQKSNGLEHIAIIKGKEGEPVLVRVHSSCATGDIFGSMRCDCGEQLHK
RIBBA_BACTN     VEKGVEVNMPTEH-GMFRLIPFRQKSNGEHMAIFKGTWNEDEPLVRVHSSCATGDILGSHRCDCGEQLHK
RIBBA_STAEQ     VNLKAKVKMP-TDFGHFDMYGFTTNYSDEEIVAIVKGDLKSNPNVRMHSACLTGDIFHSQRCDCGAQLEA
RIBBA_BACWK     VTREVEITLP-TDFGTFHAIGYSNSLDMKEHIALVKGSTGEPVLVRVHSECLTGDVFGSCRCDCGPQLHA
RIBBA_BREBN     VKKEIEVQLP-TAYGDFRIAAYTNELDGKEHVALIKGEIGPDELVRVHSECLTGDIFGSYRCDCGPQLHA
RIBBA_BACSK     VTREVAISLP-TEYGDFKAVGYTNTIDGKESVALVKGDVGNGELVRVHSECLTGDVFGSKRCDCGPQLHA
RIBBA_STAES     VNLKAKVKMP-TDFGHFDMYGFTTDYSDEEIVAIVKGDLKSNPNVRMHSACLTGDIFHSQRCDCGAQLEA
RIBBA_SALTO     VELVAEARLPTRH-GDFRVAGYRGDYDSAEALVMGDLGDGRDVLVRAHSECLTGDVFGSLRCDCGLQLDT
RIBBA_BACFR     VDRGVEVDMP-TQFGHFRLIPFRQKSNGMEHIALIKTWDTDEPLVRVHSSCMTGDIFGSCRCECGEQLHK
RIBBA_BACFN     VDRGVEVDMP-TQFGHFRLIPFRQKSNGMEHIALIKTWDTDEPLVRVHSSCMTGDIFGSCRCECGEQLHK
RIBBA_CLONN     IERQGSASLP-TKYGEFEIIGYEDKLTGKEHVALVKGKNGEPVLIRVHSECLTGDVLGSLRCDCGDQLAQ
RIBBA_CHLTR     VTKISSARLP-TKYGDFSIHVYESIIDGTQHFALVKGHEQEAVPVRVHSECLTGDILGSCRCDCGAQLDM
RIBBA_BACA2     VNREVDITLP-TDFGTFRVYGYTNEVDGKEFVMGDVPFNSEPVLVRVHSECLTGDVFASHRCDCGPQLHA
RIBBA_SALAI     VELVAEARMPTRH-GVFRAFGYRSDYDSAEALVMGDLGDGRDVLVRVHSECLTGDVLGSLRCDCGPQLNA
RIBBA_BACCR     VTREAEITLP-TDFGTFHAIGYSNSLDTKEHIALVKGSTGEPVLVRVHSECLTGDVFGSHRCDCGPQLHA
RIBBA_BACCQ     VTREVEITLP-TDFGTFHAIGYSNSLDSKEHIALVKGSTGDPVLVRVHSECLTGDVFGSCRCDCGPQLHA
RIBBA_BACC7     VTREVEITLP-TDFGTFHAIGYSNSLDSKEHIALVKGSTGDPVLVRVHSECLTGDVFGSCRCDCGPQLHA
RIBBA_BACHK     VTREVEITLP-TDFGTFQAIGYSNSLDTKEHIALVKGSTGEPVLVRVHSECLTGDVFGSCRCDCGPQLHA
RIBBA_BACC3     VTREVEITLP-TDFGTFQAIGYSNSLDTKEHIALVKGSTGEPVLVRVHSECLTGDVFGSCRCDCGPQLHA
RIBBA_BACAN     VTREVEITLP-TDFGTFQAIGYSNSLDTKEHIALVKGSTGEPVLVRVHSECLTGDVFGSCRCDCGPQLHA
RIBBA_BACAH     VTREVEITLP-TDFGTFQAIGYSNSLDTKEHIALVKGSTGEPVLVRVHSECLTGDVFGSCRCDCGPQLHA
RIBBA_BACAC     VTREVEITLP-TDFGTFQAIGYSNSLDTKEHIALVKGSTGEPVLVRVHSECLTGDVFGSCRCDCGPQLHA
RIBBA_BACAA     VTREVEITLP-TDFGTFQAIGYSNSLDTKEHIALVKGSTGEPVLVRVHSECLTGDVFGSCRCDCGPQLHA
RIBBA_BACSU     VEREVDITLP-TDFGTFKVYGYTNEVDGKEHVAFDVPFGEEPVLVRVHSECLTGDVFGSHRCDCGPQLHA
RIBBA_BACC2     VTREVEITLP-TDFGTFHAIGYSNSLDTKEHIALVKGSIGEPVLVRVHSECLTGDVFGSHRCDCGPQLHA
RIBBA_BACC1     VTREVEITLP-TDFGTFHAIGYSNSLDTKEHIALVKGSTGEPVLVRVHSECLTGDVFGSCRCDCGPQLHA
RIBBA_BACC4     VTREVEITLP-TDFGTFHAIGYSNSLDTKEHIALVKGSTGEPVLVRVHSECLTGDVFGSHRCDCGPQLHA
RIBBA_BACC0     VTREVEITLP-TDFGTFQAIGYSNSLDTKEHIALVKGSTGEPVLVRVHSECLTGDVFGSCRCDCGPQLHA
RIBBA_CHLPN     VSKISSARLP-TIYGDFTIHVYESLLEGMQHLALVKVAGKSNVLVRVHSECVTGDILGSKRCDCGEQLSS
RIBBA_BACCZ     VTREVEITLP-TDFGTFQAIGYSNSLDTKEHIALVKGSTGEPVLVRVHSECLTGDVFGSCRCDCGPQLHA
RIBBA_ACTP7     VKQISVVKMP-TKYGEFMAHSFVEVISGKEHVALVKGTDGEQVLARIHSECLTGDAFGSQRCDCGQQFAA
RIBBA_BACAM     VNREVDITLP-TDFGTFRVYGYTNEVDGKEFVMGDVPFNSGPVLVRVHSECLTGDVFASHRCDCGPQLHA
RIBBA_STAHJ     VELKAKVNMPTDH-GAFEMYGFESSLTKEEIVVLAKGEPRVTENVRIHSACLTGDIFHSQRCDCGAQLES
RIBBA_ACTPL     VKQISVVKMP-TKYGEFMAHSFVEVISGKEHVALVKGTDGEQVLARIHSECLTGDAFGSQRCDCGQQFAA
RIBBA_ACTP2     VKQISVVKMP-TKYGEFMAHSFVEVISGKEHVALVKGTDGEQVLARIHSECLTGDAFGSQRCDCGQQFAA
RIBBA_PORGI     VEKGVEVDMP-TEYGHFRLIPFRQKSNGLEHIALFKTWDENEPLVRMHSSCATGDIFGSMRCDCGGQLLQ
RIBBA_PORG3     VEKGVEVDMP-TEYGHFRLIPFRQKSNGLEHIALFKTWDENEPLVRMHSSCATGDIFGSMRCDCGGQLLQ
RIBBA_PROVI     VQRAVESNIP-TAYGEFRLMAY-ESFTDQQMAFVKGDVSTDEPLVRVHSQCATGDTFASLRCDCGNQLAS
RIBBA_ACTPJ     VKQISVVKMP-TKYGEFMAHSFVEVISGKEHVALVKGTDGEQVLARIHSECLTGDAFGSQRCDCGQQFAA
RIBBA_BACCN     VTKEVEITLP-TEFGTFHAIGYTNSLDQKEHIALIKDVSTDEPLVRVHSECLTGDVFGSCRCDCGPQLHA
RIBBA_MYCVP     IARVAEARIPTRH-GEFRAVGYTSIYEDVEHVALVKPHSGHDVLVRVHSECLTGDVFGSRRCDCGPQLDA
RIBBA_GEOSW     XXXXXXXMLP-TEFGKFKAIGYTNIVDGKEHVALVKGIPDEPTLVRVHSECLTGDVFGSCRCDCGPQLHA
RIBBA_MYCGI     IARVAEARIPTRH-GEFRAVGYTSIYEDVEHVALVKPHDGHDVLVRVHSECLTGDVFGSRRCDCGPQLDA
RIBBA_MYCUA     IERVAEARIPTRR-GEFRAIGYTSIYENVEHVALVRPNSGDDVLVRVHSECLTGDVFGSRRCDCGSQLDA
RIBBA_MYCPA     IERIAEARIPTRH-GEFRAIGYTSIYEEVEHVALVRPNSGDDVLVRVHSECLTGDVFGSRRCDCGPQLDA
RIBBA_SYNWW     VVRVTDAQLP-TMYGDFVAVAYESLLDNKGHIALVKEWEEDEPLVRVHSECLTGDVFGSRRCDCGEQLET
RIBBA_SYNY3     VQRETICEFP-SQFGEFKLYAYRNLLDQTEHIAIVKSEFGQQPMVRMHSECLTGDALGSLRCDCRMQLQA
RIBBA_MYCMM     IERVAEARIPTRH-GEFRAIGYTSIYEDVEHVALVRPNSGDDVLVRVHSECLTGDVFGSRRCDCGPQLDA
RIBBA_MYCA1     IERIAEARIPTRH-GEFRAIGYTSIYEEVEHVALVRPNSGDDVLVRVHSECLTGDVFGSRRCDCGPQLDA
RIBBA_CHLMU     VEHVSSARIP-TKYGEFFIHVYKSIIDGTEHFALVKGREQESVPVRVHSECLTGDVLGSCRCDCGAQLDM
RIBBA_STAS1     LDAKAKVKMP-TEYGNFDMYGFTTDNSEEDIVVIANGDINKTENVRIHSACLTGDIFHSQRCDCGEQLAA
RIBBA_MYCTU     IERVAEARIPTRH-GEFRAIGYTSIYEDVEHVALVRNADGDDVLVRVHSECLTGDVFGSRRCDCGPQLDA
RIBBA_MYCTA     IERVAEARIPTRH-GEFRAIGYTSIYEDVEHVALVRNADGDDVLVRVHSECLTGDVFGSRRCDCGPQLDA
RIBBA_MYCBT     IERVAEARIPTRH-GEFRAIGYTSIYEDVEHVALVRNADGDDVLVRVHSECLTGDVFGSRRCDCGPQLDA
RIBBA_MYCBP     IERVAEARIPTRH-GEFRAIGYTSIYEDVEHVALVRNADGDDVLVRVHSECLTGDVFGSRRCDCGPQLDA
RIBBA_MYCBO     IERVAEARIPTRH-GEFRAIGYTSIYEDVEHVALVRNADGDDVLVRVHSECLTGDVFGSRRCDCGPQLDA
RIBBA_PELLD     VERAVESKLP-TAYGEFGLIAYESDHHNHMAFVKGDVSSGEPVLVRVHSQCATGDTFASLRCDCGNQLAS
RIBBA_PARD8     VENGVEVDLP-TEYGHFRLIPFRQKSNGLEHIALIKKFEKDEPLVRVHSSCATGDIFGSMRCECGEQLHE
RIBBA_PROA2     VARAVETSLPTRH-GDFRLIAYEDSQQQNHLAFVKGDFSTDEPLVRVHSQCATGDIFASLRCDCGNQLAS
RIBBA_ARATH     VERASAARIP-TMWGPFTAYCYRSILDGIEHIAMVKGEDGQDILVRVHSECLTGDIFGSARCDCGNQLAL
RIBBA_PELPB     VQRAVESRLP-TIYGEFRLIAYESTDQHNHMAFVKGDVTTDEPLVRVHSQCATGDTFASLRCDCGNQLAS
RIBBA_MYCA9     VQRIAEARIPTQH-GEFRAVGYTSIYDDVEHVALGPDGDGNDVLVRVHSECLTGDVFGSRRCDCGPQLDA
RIBBA_RHOE4     VLRIAEARIPTRH-GEFTAVGYTSIYDEVEHVALVRDGDGSDVLVRVHSECLTGDVFGSLRCDCGPQLDA
RIBBA_CORGL     VERQVETVLP-TDFGTFKAVGYRSIIDGTELVAIVASDGGENVLVRVHSECLTGDVFGSRRCDCGQQLHE
RIBBA_CORGB     VERQVETVLP-TDFGTFKAVGYRSIIDGTELVAIVASDGGENVLVRVHSECLTGDVFGSRRCDCGQQLHE
RIBBA_NOCFA     VVRVAEARIPTAH-GAFTAVGYQSIYDDVEHVALVRGGDGEDVLVRVHSECLTGDVFGSLRCDCGPQLDA
RIBBA_RHOSR     VERVASARIPTRH-GEFTAVGYRSIYDDVEHVALVRXXXXXXXXXRVHSECLTGDVFGSLRCDCGPQLDA
RIBBA_CORAM     VRRTVETQLP-TDFGSFTALGYKHEIDGQEHVALEELNGAEDVFVRVHSECLTGDVFHSRRCDCGQQLHQ
RIBB_VIBSL      ----------------------------------------------------------------------
RIBB_VIBVY      ----------------------------------------------------------------------
RIBB_VIBVU      ----------------------------------------------------------------------
RIBB_ECOSM      ----------------------------------------------------------------------
RIBB_ECOLU      ----------------------------------------------------------------------
RIBB_PECCP      ----------------------------------------------------------------------
RIBB_VIBHA      ----------------------------------------------------------------------
RIBB_SHISS      ----------------------------------------------------------------------
RIBB_SHIFL      ----------------------------------------------------------------------
RIBB_SHIF8      ----------------------------------------------------------------------
RIBB_SHIDS      ----------------------------------------------------------------------
RIBB_SHIBS      ----------------------------------------------------------------------
RIBB_SHIB3      ----------------------------------------------------------------------
RIBB_EDWI9      ----------------------------------------------------------------------
RIBB_ECOUT      ----------------------------------------------------------------------
RIBB_ECOSE      ----------------------------------------------------------------------
RIBB_ECOLI      ----------------------------------------------------------------------
RIBB_ECOLC      ----------------------------------------------------------------------
RIBB_ECOL6      ----------------------------------------------------------------------
RIBB_ECOL5      ----------------------------------------------------------------------
RIBB_ECOK1      ----------------------------------------------------------------------
RIBB_ECOHS      ----------------------------------------------------------------------
RIBB_ECODH      ----------------------------------------------------------------------
RIBB_ECOBW      ----------------------------------------------------------------------
RIBB_ECO8A      ----------------------------------------------------------------------
RIBB_ECO81      ----------------------------------------------------------------------
RIBB_ECO7I      ----------------------------------------------------------------------
RIBB_ECO5E      ----------------------------------------------------------------------
RIBB_ECO57      ----------------------------------------------------------------------
RIBB_ECO55      ----------------------------------------------------------------------
RIBB_ECO45      ----------------------------------------------------------------------
RIBB_ECO27      ----------------------------------------------------------------------
RIBB_ECO24      ----------------------------------------------------------------------
RIBB_SHESH      ----------------------------------------------------------------------
RIBB_ESCF3      ----------------------------------------------------------------------
RIBB_NEIMB      LEDMGNAPVQ-TPWGEFQQHVYVDKLSGETHLALVKPAADTETLVRVHEPFSVMD-FIQANPRHSWSLPK
RIBB_SALTY      ----------------------------------------------------------------------
RIBB_SALTI      ----------------------------------------------------------------------
RIBB_SALSV      ----------------------------------------------------------------------
RIBB_SALPC      ----------------------------------------------------------------------
RIBB_SALPB      ----------------------------------------------------------------------
RIBB_SALNS      ----------------------------------------------------------------------
RIBB_SALHS      ----------------------------------------------------------------------
RIBB_SALG2      ----------------------------------------------------------------------
RIBB_SALEP      ----------------------------------------------------------------------
RIBB_SALDC      ----------------------------------------------------------------------
RIBB_SALCH      ----------------------------------------------------------------------
RIBB_SALA4      ----------------------------------------------------------------------
RIBB_VIBPA      ----------------------------------------------------------------------
RIBB_SALPK      ----------------------------------------------------------------------
RIBB_SALPA      ----------------------------------------------------------------------
RIBB_CHLT3      ----------------------------------------------------------------------
RIBB_ERWCT      ----------------------------------------------------------------------
RIBB_NEIMA      LEDMGNAPVQ-TPWGEFQQHVYVDKLSGETHLALVKPSADTETLVRVHEPFSVMD-FIQANPRHSWSLPK
RIBB_CLOBL      ----------------------------------------------------------------------
RIBB_SHEFN      ----------------------------------------------------------------------
RIBB_ERWT9      ----------------------------------------------------------------------
RIBB_CLOBH      ----------------------------------------------------------------------
RIBB_CLOB1      ----------------------------------------------------------------------
RIBB_SALAR      ----------------------------------------------------------------------
RIBB_SERP5      ----------------------------------------------------------------------
RIBB_PROMH      ----------------------------------------------------------------------
RIBB_CITK8      ----------------------------------------------------------------------
RIBB_HAMD5      ----------------------------------------------------------------------
RIBB_HAEIN      ----------------------------------------------------------------------
RIBBA_THEMA     MKKKAEATLP-TDFGVFKVVSFENHLDGKEHFAIVKEPLEDPVAVRIHSECVTGDVLSSLRCDCGSQLAN
RIBB_ENT38      ----------------------------------------------------------------------
RIBB_HAEI8      ----------------------------------------------------------------------
RIBB_SHEWM      ----------------------------------------------------------------------
RIBB_DESAD      ----------------------------------------------------------------------
RIBB_SODGM      ----------------------------------------------------------------------
RIBB_RALEJ      ----------------------------------------------------------------------
RIBB_KLEP7      ----------------------------------------------------------------------
RIBB_SHELP      ----------------------------------------------------------------------
RIBB_SHEHH      ----------------------------------------------------------------------
RIBB_PHOLE      IERISEYEL