[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30267.1

[Show Plain Result]


## Summary of Sequence Search
    1::209
    1::209     e-118 100%  209 aa  KTHY_FRATM RecName: Full=Thymidylate kinase;       
    1::209     e-118 100%  209 aa  KTHY_FRATW RecName: Full=Thymidylate kinase;       
    1::209     e-118 100%  209 aa  KTHY_FRATT RecName: Full=Thymidylate kinase;       
    1::209     e-118 100%  209 aa  KTHY_FRAT1 RecName: Full=Thymidylate kinase;       
    1::209     e-117  99%  209 aa  KTHY_FRATN RecName: Full=Thymidylate kinase;       
    1::209     e-117  99%  209 aa  KTHY_FRATH RecName: Full=Thymidylate kinase;       
    1::209     e-117  99%  209 aa  KTHY_FRATF RecName: Full=Thymidylate kinase;       
    1::209     e-117  99%  209 aa  KTHY_FRATO RecName: Full=Thymidylate kinase;       
    2::204     7e-88  74%  204 aa  KTHY_FRAP2 RecName: Full=Thymidylate kinase;       
    1::204     2e-49  49%  208 aa  KTHY_PSEHT RecName: Full=Thymidylate kinase;       
    1::209     1e-47  47%  210 aa  KTHY_ACTSZ RecName: Full=Thymidylate kinase;       
    1::198     1e-47  48%  219 aa  KTHY_PECCP RecName: Full=Thymidylate kinase;       
    1::198     3e-47  48%  219 aa  KTHY_ERWCT RecName: Full=Thymidylate kinase;       
    1::198     4e-47  50%  212 aa  KTHY_VIBCM RecName: Full=Thymidylate kinase;       
    1::198     4e-47  50%  212 aa  KTHY_VIBCH RecName: Full=Thymidylate kinase;       
    1::198     4e-47  50%  212 aa  KTHY_VIBC3 RecName: Full=Thymidylate kinase;       
    1::204     4e-47  45%  212 aa  KTHY_PHOLL RecName: Full=Thymidylate kinase;       
    6::204     1e-46  47%  209 aa  KTHY_SHESR RecName: Full=Thymidylate kinase;       
    6::204     1e-46  47%  209 aa  KTHY_SHESM RecName: Full=Thymidylate kinase;       
    4::206     1e-46  44%  212 aa  KTHY_LEGPH RecName: Full=Thymidylate kinase;       
    7::204     2e-46  47%  208 aa  KTHY_SHEAM RecName: Full=Thymidylate kinase;       
    1::200     2e-46  46%  222 aa  KTHY_ALTMD RecName: Full=Thymidylate kinase;       
    4::206     3e-46  44%  212 aa  KTHY_LEGPL RecName: Full=Thymidylate kinase;       
    1::196     4e-46  47%  208 aa  KTHY_ACTPJ RecName: Full=Thymidylate kinase;       
    1::196     4e-46  47%  208 aa  KTHY_ACTP7 RecName: Full=Thymidylate kinase;       
    1::196     4e-46  47%  208 aa  KTHY_ACTP2 RecName: Full=Thymidylate kinase;       
    5::209     1e-45  45%  215 aa  KTHY_SHEFN RecName: Full=Thymidylate kinase;       
    6::204     2e-45  46%  209 aa  KTHY_SHEON RecName: Full=Thymidylate kinase;       
    4::206     2e-45  43%  212 aa  KTHY_LEGPA RecName: Full=Thymidylate kinase;       
    4::206     2e-45  42%  212 aa  KTHY_LEGPC RecName: Full=Thymidylate kinase;       
    1::197     3e-45  49%  210 aa  KTHY_HAEIN RecName: Full=Thymidylate kinase;       
    1::197     3e-45  49%  210 aa  KTHY_HAEIG RecName: Full=Thymidylate kinase;       
    1::197     3e-45  49%  210 aa  KTHY_HAEIE RecName: Full=Thymidylate kinase;       
    1::207     5e-45  47%  212 aa  KTHY_BLOPB RecName: Full=Thymidylate kinase;       
    5::198     9e-45  46%  209 aa  KTHY_PASMU RecName: Full=Thymidylate kinase;       
    2::202     2e-44  47%  210 aa  KTHY_VIBFM RecName: Full=Thymidylate kinase;       
    6::206     2e-44  46%  210 aa  KTHY_SHELP RecName: Full=Thymidylate kinase;       
    6::212     3e-44  45%  214 aa  KTHY_HAEDU RecName: Full=Thymidylate kinase;       
    2::202     4e-44  46%  210 aa  KTHY_VIBF1 RecName: Full=Thymidylate kinase;       
    1::202     1e-43  45%  212 aa  KTHY_YERE8 RecName: Full=Thymidylate kinase;       
    1::198     1e-43  48%  209 aa  KTHY_PHOPR RecName: Full=Thymidylate kinase;       
    5::202     1e-43  46%  212 aa  KTHY_COLP3 RecName: Full=Thymidylate kinase;       
    3::199     1e-43  47%  212 aa  KTHY_VIBVY RecName: Full=Thymidylate kinase;       
    3::199     1e-43  47%  212 aa  KTHY_VIBVU RecName: Full=Thymidylate kinase;       
    2::196     2e-43  48%  213 aa  KTHY_AERHH RecName: Full=Thymidylate kinase;       
    2::202     3e-43  47%  210 aa  KTHY_ALISL RecName: Full=Thymidylate kinase;       
    1::198     4e-43  46%  213 aa  KTHY_EDWI9 RecName: Full=Thymidylate kinase;       
    1::198     5e-43  47%  212 aa  KTHY_SERP5 RecName: Full=Thymidylate kinase;       
    1::196     5e-43  47%  208 aa  KTHY_HAEPS RecName: Full=Thymidylate kinase;       
    2::210     6e-43  44%  210 aa  KTHY_VIBPA RecName: Full=Thymidylate kinase;       
    5::201     6e-43  46%  214 aa  KTHY_MANSM RecName: Full=Thymidylate kinase;       
    1::196     6e-43  47%  213 aa  KTHY_ECOL6 RecName: Full=Thymidylate kinase;       
    1::196     8e-43  47%  213 aa  KTHY_ECOUT RecName: Full=Thymidylate kinase;       
    1::196     8e-43  47%  213 aa  KTHY_ECOK1 RecName: Full=Thymidylate kinase;       
    1::196     8e-43  47%  213 aa  KTHY_ECO45 RecName: Full=Thymidylate kinase;       
    1::200     1e-42  48%  213 aa  KTHY_ESCF3 RecName: Full=Thymidylate kinase;       
    1::200     1e-42  47%  213 aa  KTHY_CITK8 RecName: Full=Thymidylate kinase;       
    2::222     2e-42  49%  234 aa  KTHY_WIGBR RecName: Full=Thymidylate kinase;       
    2::205     2e-42  45%  210 aa  KTHY_VIBHB RecName: Full=Thymidylate kinase;       
    1::200     4e-42  46%  212 aa  KTHY_ENTS8 RecName: Full=Thymidylate kinase;       
    1::196     4e-42  47%  213 aa  KTHY_ECOSM RecName: Full=Thymidylate kinase;       
    1::196     4e-42  47%  213 aa  KTHY_ECO7I RecName: Full=Thymidylate kinase;       
    1::198     5e-42  46%  212 aa  KTHY_YERPY RecName: Full=Thymidylate kinase;       
    1::198     5e-42  46%  212 aa  KTHY_YERPS RecName: Full=Thymidylate kinase;       
    1::198     5e-42  46%  212 aa  KTHY_YERPB RecName: Full=Thymidylate kinase;       
    1::198     5e-42  46%  212 aa  KTHY_YERP3 RecName: Full=Thymidylate kinase;       
    1::196     5e-42  47%  213 aa  KTHY_SHISS RecName: Full=Thymidylate kinase;       
    1::196     5e-42  47%  213 aa  KTHY_SHIFL RecName: Full=Thymidylate kinase;       
    1::196     5e-42  47%  213 aa  KTHY_SHIF8 RecName: Full=Thymidylate kinase;       
    1::196     5e-42  47%  213 aa  KTHY_SHIDS RecName: Full=Thymidylate kinase;       
    1::196     5e-42  47%  213 aa  KTHY_SHIBS RecName: Full=Thymidylate kinase;       
    1::196     5e-42  47%  213 aa  KTHY_SHIB3 RecName: Full=Thymidylate kinase;       
    1::206     5e-42  45%  213 aa  KTHY_SALPK RecName: Full=Thymidylate kinase;       
    1::206     5e-42  45%  213 aa  KTHY_SALPC RecName: Full=Thymidylate kinase;       
    1::206     5e-42  45%  213 aa  KTHY_SALPB RecName: Full=Thymidylate kinase;       
    1::206     5e-42  45%  213 aa  KTHY_SALPA RecName: Full=Thymidylate kinase;       
    1::206     5e-42  45%  213 aa  KTHY_SALNS RecName: Full=Thymidylate kinase;       
    1::206     5e-42  45%  213 aa  KTHY_SALHS RecName: Full=Thymidylate kinase;       
    1::206     5e-42  45%  213 aa  KTHY_SALG2 RecName: Full=Thymidylate kinase;       
    1::206     5e-42  45%  213 aa  KTHY_SALEP RecName: Full=Thymidylate kinase;       
    1::206     5e-42  45%  213 aa  KTHY_SALCH RecName: Full=Thymidylate kinase;       
    1::206     5e-42  45%  213 aa  KTHY_SALA4 RecName: Full=Thymidylate kinase;       
    5::204     5e-42  46%  210 aa  KTHY_HAES2 RecName: Full=Thymidylate kinase;       
    1::196     5e-42  47%  213 aa  KTHY_ECOSE RecName: Full=Thymidylate kinase;       
    1::196     5e-42  47%  213 aa  KTHY_ECOLU RecName: Full=Thymidylate kinase;       
    1::196     5e-42  47%  213 aa  KTHY_ECOLI RecName: Full=Thymidylate kinase;       
    1::196     5e-42  47%  213 aa  KTHY_ECOLC RecName: Full=Thymidylate kinase;       
    1::196     5e-42  47%  213 aa  KTHY_ECOL5 RecName: Full=Thymidylate kinase;       
    1::196     5e-42  47%  213 aa  KTHY_ECOHS RecName: Full=Thymidylate kinase;       
    1::196     5e-42  47%  213 aa  KTHY_ECODH RecName: Full=Thymidylate kinase;       
    1::196     5e-42  47%  213 aa  KTHY_ECOBW RecName: Full=Thymidylate kinase;       
    1::196     5e-42  47%  213 aa  KTHY_ECO8A RecName: Full=Thymidylate kinase;       
    1::196     5e-42  47%  213 aa  KTHY_ECO81 RecName: Full=Thymidylate kinase;       
    1::196     5e-42  47%  213 aa  KTHY_ECO55 RecName: Full=Thymidylate kinase;       
    1::196     5e-42  47%  213 aa  KTHY_ECO27 RecName: Full=Thymidylate kinase;       
    1::196     5e-42  47%  213 aa  KTHY_ECO24 RecName: Full=Thymidylate kinase;       
    1::206     7e-42  45%  213 aa  KTHY_SALTY RecName: Full=Thymidylate kinase;       
    1::206     7e-42  45%  213 aa  KTHY_SALTI RecName: Full=Thymidylate kinase;       
    1::206     7e-42  45%  213 aa  KTHY_SALSV RecName: Full=Thymidylate kinase;       
    1::206     7e-42  45%  213 aa  KTHY_SALDC RecName: Full=Thymidylate kinase;       
    1::196     7e-42  47%  213 aa  KTHY_ECO5E RecName: Full=Thymidylate kinase;       
    1::196     7e-42  47%  213 aa  KTHY_ECO57 RecName: Full=Thymidylate kinase;       
    1::189     9e-42  47%  210 aa  KTHY_ERWT9 RecName: Full=Thymidylate kinase;       
    1::200     9e-42  46%  213 aa  KTHY_ENT38 RecName: Full=Thymidylate kinase;       
    1::200     1e-41  46%  213 aa  KTHY_SALAR RecName: Full=Thymidylate kinase;       
    1::198     2e-41  46%  212 aa  KTHY_YERPP RecName: Full=Thymidylate kinase;       
    1::198     2e-41  46%  212 aa  KTHY_YERPN RecName: Full=Thymidylate kinase;       
    1::198     2e-41  46%  212 aa  KTHY_YERPG RecName: Full=Thymidylate kinase;       
    1::198     2e-41  46%  212 aa  KTHY_YERPE RecName: Full=Thymidylate kinase;       
    1::198     2e-41  46%  212 aa  KTHY_YERPA RecName: Full=Thymidylate kinase;       
    5::204     3e-41  45%  210 aa  KTHY_HAES1 RecName: Full=Thymidylate kinase;       
    1::200     8e-41  44%  213 aa  KTHY_KLEP3 RecName: Full=Thymidylate kinase;       
    1::200     1e-40  44%  213 aa  KTHY_KLEP7 RecName: Full=Thymidylate kinase;       
    3::202     1e-40  42%  205 aa  KTHY_RUTMC RecName: Full=Thymidylate kinase;       
    2::170     2e-40  49%  212 aa  KTHY_BUCAP RecName: Full=Thymidylate kinase;       
    3::202     6e-39  43%  205 aa  KTHY_VESOH RecName: Full=Thymidylate kinase;       
    1::200     6e-39  46%  210 aa  KTHY_HAMD5 RecName: Full=Thymidylate kinase;       
    1::203     7e-39  42%  205 aa  KTHY_IDILO RecName: Full=Thymidylate kinase;       
    2::193     2e-38  38%  208 aa  KTHY_KOSOT RecName: Full=Thymidylate kinase;       
    1::194     4e-38  43%  213 aa  KTHY_SODGM RecName: Full=Thymidylate kinase;       
    1::199     4e-38  44%  212 aa  KTHY_BAUCH RecName: Full=Thymidylate kinase;       
    6::204     6e-38  41%  209 aa  KTHY_SHESA RecName: Full=Thymidylate kinase;       
    1::196     1e-37  38%  205 aa  KTHY_NITMU RecName: Full=Thymidylate kinase;       
    3::208     1e-37  38%  215 aa  KTHY_NITEC RecName: Full=Thymidylate kinase;       
    1::215     3e-37  42%  225 aa  KTHY_TRIEI RecName: Full=Thymidylate kinase;       
    1::204     3e-37  38%  206 aa  KTHY_NEIG2 RecName: Full=Thymidylate kinase;       
    1::204     3e-37  38%  206 aa  KTHY_NEIG1 RecName: Full=Thymidylate kinase;       
    1::197     3e-37  41%  212 aa  KTHY_MARMS RecName: Full=Thymidylate kinase;       
    1::190     3e-37  39%  203 aa  KTHY_CARHZ RecName: Full=Thymidylate kinase;       
    2::193     3e-37  41%  199 aa  KTHY_ACIBS RecName: Full=Thymidylate kinase;       
    2::193     3e-37  41%  199 aa  KTHY_ACIBC RecName: Full=Thymidylate kinase;       
    2::193     4e-37  41%  199 aa  KTHY_ACIBT RecName: Full=Thymidylate kinase;       
    1::204     5e-37  38%  206 aa  KTHY_NEIMB RecName: Full=Thymidylate kinase;       
    1::198     5e-37  42%  207 aa  KTHY_HALOH RecName: Full=Thymidylate kinase;       
    9::204     5e-37  41%  227 aa  KTHY_COXBU RecName: Full=Thymidylate kinase;       
    2::193     7e-37  41%  199 aa  KTHY_ACIBY RecName: Full=Thymidylate kinase;       
    2::193     7e-37  41%  199 aa  KTHY_ACIB5 RecName: Full=Thymidylate kinase;       
    2::193     7e-37  41%  199 aa  KTHY_ACIB3 RecName: Full=Thymidylate kinase;       
    3::202     1e-36  38%  215 aa  KTHY_NITEU RecName: Full=Thymidylate kinase;       
    1::204     2e-36  37%  206 aa  KTHY_NEIMA RecName: Full=Thymidylate kinase;       
    7::207     2e-36  38%  212 aa  KTHY_CHRVO RecName: Full=Thymidylate kinase;       
    2::196     2e-36  38%  212 aa  KTHY_BUCBP RecName: Full=Thymidylate kinase;       
    5::197     3e-36  39%  207 aa  KTHY_DESRM RecName: Full=Thymidylate kinase;       
    2::199     3e-36  43%  212 aa  KTHY_BUCAI RecName: Full=Thymidylate kinase;       
    1::204     4e-36  37%  206 aa  KTHY_NEIMF RecName: Full=Thymidylate kinase;       
    1::200     6e-36  40%  203 aa  KTHY_RALEH RecName: Full=Thymidylate kinase;       
    1::204     6e-36  41%  211 aa  KTHY_BLOFL RecName: Full=Thymidylate kinase;       
    2::198     8e-36  40%  201 aa  KTHY_THEAB RecName: Full=Thymidylate kinase;       
    3::199     1e-35  40%  206 aa  KTHY_BURPP RecName: Full=Thymidylate kinase;       
    1::197     2e-35  40%  210 aa  KTHY_PSEPF RecName: Full=Thymidylate kinase;       
    1::200     2e-35  38%  206 aa  KTHY_CALS8 RecName: Full=Thymidylate kinase;       
    6::194     3e-35  39%  208 aa  KTHY_HAHCH RecName: Full=Thymidylate kinase;       
    2::196     3e-35  37%  197 aa  KTHY_FERNB RecName: Full=Thymidylate kinase;       
    6::200     5e-35  38%  205 aa  KTHY_CLONN RecName: Full=Thymidylate kinase;       
    3::199     1e-34  40%  206 aa  KTHY_BURP8 RecName: Full=Thymidylate kinase;       
    3::200     3e-34  40%  204 aa  KTHY_THIDA RecName: Full=Thymidylate kinase;       
    1::168     3e-34  43%  210 aa  KTHY_PSEF5 RecName: Full=Thymidylate kinase;       
    1::208     3e-34  41%  213 aa  KTHY_LACJO RecName: Full=Thymidylate kinase;       
    1::200     4e-34  42%  212 aa  KTHY_PROM2 RecName: Full=Thymidylate kinase;       
    1::201     5e-34  38%  210 aa  KTHY_PSEFS RecName: Full=Thymidylate kinase;       
    1::206     5e-34  41%  212 aa  KTHY_LACH4 RecName: Full=Thymidylate kinase;       
    1::195     5e-34  41%  210 aa  KTHY_GEOSW RecName: Full=Thymidylate kinase;       
    1::200     5e-34  39%  203 aa  KTHY_CUPTR RecName: Full=Thymidylate kinase;       
    3::169     7e-34  44%  206 aa  KTHY_BURXL RecName: Full=Thymidylate kinase;       
    2::170     7e-34  42%  202 aa  KTHY_ACIAD RecName: Full=Thymidylate kinase;       
    1::194     9e-34  39%  210 aa  KTHY_PSESM RecName: Full=Thymidylate kinase;       
    1::198     9e-34  38%  203 aa  KTHY_METFK RecName: Full=Thymidylate kinase;       
    5::199     9e-34  39%  204 aa  KTHY_JANMA RecName: Full=Thymidylate kinase;       
    1::201     1e-33  38%  210 aa  KTHY_PSE14 RecName: Full=Thymidylate kinase;       
    1::212     1e-33  40%  214 aa  KTHY_PROMP RecName: Full=Thymidylate kinase;       
    1::196     2e-33  41%  212 aa  KTHY_LACDB RecName: Full=Thymidylate kinase;       
    1::196     2e-33  41%  212 aa  KTHY_LACDA RecName: Full=Thymidylate kinase;       
    6::196     2e-33  40%  213 aa  KTHY_BACSK RecName: Full=Thymidylate kinase;       
    7::209     2e-33  38%  212 aa  KTHY_STRGC RecName: Full=Thymidylate kinase;       
    1::200     3e-33  39%  203 aa  KTHY_RALEJ RecName: Full=Thymidylate kinase;       
    1::194     3e-33  41%  233 aa  KTHY_BIFLI RecName: Full=Thymidylate kinase;       
    1::194     4e-33  38%  210 aa  KTHY_PSEU2 RecName: Full=Thymidylate kinase;       
   10::219     4e-33  39%  225 aa  KTHY_PARUW RecName: Full=Thymidylate kinase;       
    1::194     5e-33  41%  206 aa  KTHY_BIFLD RecName: Full=Thymidylate kinase;       
    5::201     8e-33  40%  208 aa  KTHY_METCA RecName: Full=Thymidylate kinase;       
    1::194     8e-33  41%  206 aa  KTHY_BIFLO RecName: Full=Thymidylate kinase;       
    5::203     1e-32  39%  206 aa  KTHY_BURCH RecName: Full=Thymidylate kinase;       
    5::203     1e-32  39%  206 aa  KTHY_BURCC RecName: Full=Thymidylate kinase;       
    5::203     1e-32  39%  206 aa  KTHY_BURCA RecName: Full=Thymidylate kinase;       
    1::208     1e-32  40%  210 aa  KTHY_PROM5 RecName: Full=Thymidylate kinase;       
    2::199     1e-32  38%  203 aa  KTHY_FINM2 RecName: Full=Thymidylate kinase;       
    2::195     2e-32  40%  213 aa  KTHY_MYCCT RecName: Full=Thymidylate kinase;       
    1::203     2e-32  36%  212 aa  KTHY_BACP2 RecName: Full=Thymidylate kinase;       
    5::203     2e-32  39%  206 aa  KTHY_BURCJ RecName: Full=Thymidylate kinase;       
    1::202     2e-32  41%  217 aa  KTHY_BIFAA RecName: Full=Thymidylate kinase;       
    1::202     3e-32  36%  205 aa  KTHY_RALPJ RecName: Full=Thymidylate kinase;       
    2::191     3e-32  42%  211 aa  KTHY_MESFL RecName: Full=Thymidylate kinase;       
    2::201     4e-32  40%  217 aa  KTHY_DESAD RecName: Full=Thymidylate kinase;       
    3::202     4e-32  39%  217 aa  KTHY_CHLP8 RecName: Full=Thymidylate kinase;       
    5::203     4e-32  39%  206 aa  KTHY_BURCM RecName: Full=Thymidylate kinase;       
    5::203     4e-32  39%  206 aa  KTHY_BURA4 RecName: Full=Thymidylate kinase;       
    1::200     5e-32  38%  216 aa  KTHY_LACAC RecName: Full=Thymidylate kinase;       
    3::203     5e-32  38%  206 aa  KTHY_BURP6 RecName: Full=Thymidylate kinase;       
    3::203     5e-32  38%  206 aa  KTHY_BURMS RecName: Full=Thymidylate kinase;       
    3::203     5e-32  38%  206 aa  KTHY_BURMA RecName: Full=Thymidylate kinase;       
    3::203     5e-32  38%  206 aa  KTHY_BURM9 RecName: Full=Thymidylate kinase;       
    3::203     5e-32  38%  206 aa  KTHY_BURM7 RecName: Full=Thymidylate kinase;       
    3::177     5e-32  42%  217 aa  KTHY_ALHEH RecName: Full=Thymidylate kinase;       
    2::193     7e-32  40%  204 aa  KTHY_SYNJA RecName: Full=Thymidylate kinase;       
    1::206     7e-32  36%  211 aa  KTHY_ANAVT RecName: Full=Thymidylate kinase;       
    1::203     7e-32  35%  208 aa  KTHY_ALCBS RecName: Full=Thymidylate kinase;       
    1::168     9e-32  41%  205 aa  KTHY_RALSO RecName: Full=Thymidylate kinase;       
    3::214     1e-31  38%  214 aa  KTHY_PELLD RecName: Full=Thymidylate kinase;       
    5::203     1e-31  38%  206 aa  KTHY_BURS3 RecName: Full=Thymidylate kinase;       
    3::203     1e-31  38%  206 aa  KTHY_BURPS RecName: Full=Thymidylate kinase;       
    3::203     1e-31  38%  206 aa  KTHY_BURP1 RecName: Full=Thymidylate kinase;       
    3::203     1e-31  38%  206 aa  KTHY_BURP0 RecName: Full=Thymidylate kinase;       
    2::194     1e-31  40%  206 aa  KTHY_SYNJB RecName: Full=Thymidylate kinase;       
    2::195     1e-31  38%  213 aa  KTHY_MYCMS RecName: Full=Thymidylate kinase;       
    1::195     1e-31  38%  225 aa  KTHY_GEOTN RecName: Full=Thymidylate kinase;       
    1::201     1e-31  41%  212 aa  KTHY_ENTFA RecName: Full=Thymidylate kinase;       
    3::203     1e-31  38%  206 aa  KTHY_BURTA RecName: Full=Thymidylate kinase;       
    1::204     1e-31  37%  209 aa  KTHY_ANOFW RecName: Full=Thymidylate kinase;       
    1::202     3e-31  36%  208 aa  KTHY_THETN RecName: Full=Thymidylate kinase;       
    3::203     3e-31  40%  212 aa  KTHY_SYNS3 RecName: Full=Thymidylate kinase;       
    1::201     3e-31  36%  210 aa  KTHY_PSEPG RecName: Full=Thymidylate kinase;       
    1::204     3e-31  40%  215 aa  KTHY_PROM4 RecName: Full=Thymidylate kinase;       
    3::195     3e-31  36%  204 aa  KTHY_HERAR RecName: Full=Thymidylate kinase;       
    3::202     4e-31  38%  215 aa  KTHY_PROVI RecName: Full=Thymidylate kinase;       
    3::210     4e-31  37%  219 aa  KTHY_CHLL2 RecName: Full=Thymidylate kinase;       
    7::208     6e-31  40%  211 aa  KTHY_STRA5 RecName: Full=Thymidylate kinase;       
    7::208     6e-31  40%  211 aa  KTHY_STRA3 RecName: Full=Thymidylate kinase;       
    7::208     6e-31  40%  211 aa  KTHY_STRA1 RecName: Full=Thymidylate kinase;       
    1::207     6e-31  36%  211 aa  KTHY_LACLS RecName: Full=Thymidylate kinase;       
    3::203     6e-31  37%  206 aa  KTHY_BURVG RecName: Full=Thymidylate kinase;       
    6::196     6e-31  39%  210 aa  KTHY_BACHD RecName: Full=Thymidylate kinase;         EC=2.7.4.9;
    1::205     7e-31  34%  208 aa  KTHY_LACS1 RecName: Full=Thymidylate kinase;       
    2::201     1e-30  35%  205 aa  KTHY_STAS1 RecName: Full=Thymidylate kinase;       
    1::201     1e-30  35%  210 aa  KTHY_PSEP1 RecName: Full=Thymidylate kinase;       
    1::207     1e-30  36%  211 aa  KTHY_LACLM RecName: Full=Thymidylate kinase;       
    2::201     2e-30  36%  214 aa  KTHY_SYMTH RecName: Full=Thymidylate kinase;       
    3::209     2e-30  38%  211 aa  KTHY_STRU0 RecName: Full=Thymidylate kinase;       
    1::207     3e-30  36%  211 aa  KTHY_LACLA RecName: Full=Thymidylate kinase;       
    6::204     3e-30  37%  213 aa  KTHY_CLOB8 RecName: Full=Thymidylate kinase;       
    2::211     4e-30  36%  216 aa  KTHY_PELCD RecName: Full=Thymidylate kinase;       
    2::204     4e-30  38%  212 aa  KTHY_GLOVI RecName: Full=Thymidylate kinase;       
    1::174     5e-30  39%  203 aa  KTHY_THEPX RecName: Full=Thymidylate kinase;       
    1::174     5e-30  39%  203 aa  KTHY_THEP3 RecName: Full=Thymidylate kinase;       
    1::180     5e-30  41%  209 aa  KTHY_SYNSC RecName: Full=Thymidylate kinase;       
    1::197     5e-30  35%  212 aa  KTHY_EXISA RecName: Full=Thymidylate kinase;       
    1::198     6e-30  39%  209 aa  KTHY_SYNS9 RecName: Full=Thymidylate kinase;       
    7::208     6e-30  36%  212 aa  KTHY_STRSV RecName: Full=Thymidylate kinase;       
   12::223     8e-30  40%  241 aa  KTHY_THEEB RecName: Full=Thymidylate kinase;       
    2::198     8e-30  35%  207 aa  KTHY_PSEPW RecName: Full=Thymidylate kinase;       
    1::209     8e-30  37%  209 aa  KTHY_PEDPA RecName: Full=Thymidylate kinase;       
    1::200     1e-29  38%  212 aa  KTHY_SYNR3 RecName: Full=Thymidylate kinase;       
    6::197     1e-29  43%  212 aa  KTHY_STRMU RecName: Full=Thymidylate kinase;       
    1::201     1e-29  34%  210 aa  KTHY_PSEMY RecName: Full=Thymidylate kinase;       
    3::210     1e-29  35%  217 aa  KTHY_PELPB RecName: Full=Thymidylate kinase;       
    1::204     1e-29  36%  212 aa  KTHY_STRPS RecName: Full=Thymidylate kinase;       
    2::202     1e-29  38%  223 aa  KTHY_PROA2 RecName: Full=Thymidylate kinase;       
    2::201     1e-29  37%  212 aa  KTHY_DESDG RecName: Full=Thymidylate kinase;       
    1::204     1e-29  35%  208 aa  KTHY_BACCN RecName: Full=Thymidylate kinase;       
    1::201     2e-29  34%  210 aa  KTHY_PSEU5 RecName: Full=Thymidylate kinase;       
    3::208     2e-29  36%  219 aa  KTHY_CHLPD RecName: Full=Thymidylate kinase;       
    3::204     2e-29  38%  222 aa  KTHY_CHLCH RecName: Full=Thymidylate kinase;       
    1::206     2e-29  36%  208 aa  KTHY_BACCQ RecName: Full=Thymidylate kinase;       
    2::194     3e-29  38%  199 aa  KTHY_THEM4 RecName: Full=Thymidylate kinase;       
    1::204     3e-29  36%  212 aa  KTHY_STRZP RecName: Full=Thymidylate kinase;       
    1::204     3e-29  36%  212 aa  KTHY_STRZJ RecName: Full=Thymidylate kinase;       
    1::204     3e-29  36%  212 aa  KTHY_STRR6 RecName: Full=Thymidylate kinase;       
    1::204     3e-29  36%  212 aa  KTHY_STRPN RecName: Full=Thymidylate kinase;       
    1::204     3e-29  36%  212 aa  KTHY_STRP7 RecName: Full=Thymidylate kinase;       
    1::204     3e-29  36%  212 aa  KTHY_STRP4 RecName: Full=Thymidylate kinase;       
    1::204     3e-29  36%  212 aa  KTHY_STRP2 RecName: Full=Thymidylate kinase;       
    1::196     4e-29  37%  212 aa  KTHY_STRZT RecName: Full=Thymidylate kinase;       
    5::174     4e-29  42%  208 aa  KTHY_PSYWF RecName: Full=Thymidylate kinase;       
    1::203     5e-29  35%  225 aa  KTHY_OCEIH RecName: Full=Thymidylate kinase;       
    1::204     7e-29  36%  212 aa  KTHY_STRPI RecName: Full=Thymidylate kinase;       
    1::205     7e-29  34%  212 aa  KTHY_BACSU RecName: Full=Thymidylate kinase;       
    1::206     7e-29  35%  208 aa  KTHY_BACCR RecName: Full=Thymidylate kinase;       
    1::206     7e-29  35%  208 aa  KTHY_BACC2 RecName: Full=Thymidylate kinase;       
    1::189     9e-29  38%  198 aa  KTHY_THET8 RecName: Full=Thymidylate kinase;       
    1::189     9e-29  38%  198 aa  KTHY_THET2 RecName: Full=Thymidylate kinase;       
    1::204     9e-29  36%  212 aa  KTHY_STRPJ RecName: Full=Thymidylate kinase;       
    1::197     9e-29  35%  212 aa  KTHY_EXIS2 RecName: Full=Thymidylate kinase;       
    4::201     1e-28  39%  217 aa  KTHY_RHOSK RecName: Full=Thymidylate kinase;       
    1::209     1e-28  38%  212 aa  KTHY_PROMS RecName: Full=Thymidylate kinase;       
    1::206     1e-28  35%  208 aa  KTHY_BACWK RecName: Full=Thymidylate kinase;       
    1::206     1e-28  35%  208 aa  KTHY_BACHK RecName: Full=Thymidylate kinase;       
    1::206     1e-28  35%  208 aa  KTHY_BACCZ RecName: Full=Thymidylate kinase;       
    1::206     1e-28  35%  208 aa  KTHY_BACC4 RecName: Full=Thymidylate kinase;       
    1::206     1e-28  35%  208 aa  KTHY_BACC1 RecName: Full=Thymidylate kinase;       
    1::206     1e-28  35%  208 aa  KTHY_BACAN RecName: Full=Thymidylate kinase;       
    1::206     1e-28  35%  208 aa  KTHY_BACAC RecName: Full=Thymidylate kinase;       
    1::206     1e-28  35%  208 aa  KTHY_BACAA RecName: Full=Thymidylate kinase;       
    2::207     2e-28  34%  214 aa  KTHY_DESOH RecName: Full=Thymidylate kinase;       
    1::206     2e-28  35%  208 aa  KTHY_BACC7 RecName: Full=Thymidylate kinase;       
    2::197     2e-28  41%  205 aa  KTHY_WOLPP RecName: Full=Thymidylate kinase;       
    4::194     2e-28  36%  204 aa  KTHY_SULSY RecName: Full=Thymidylate kinase;       
    4::200     2e-28  39%  217 aa  KTHY_RHOS4 RecName: Full=Thymidylate kinase;       
    4::200     2e-28  39%  217 aa  KTHY_RHOS1 RecName: Full=Thymidylate kinase;       
    1::199     2e-28  35%  208 aa  KTHY_LISW6 RecName: Full=Thymidylate kinase;       
    1::206     2e-28  35%  208 aa  KTHY_BACC3 RecName: Full=Thymidylate kinase;       
    1::206     2e-28  35%  208 aa  KTHY_BACAH RecName: Full=Thymidylate kinase;       
    1::206     2e-28  34%  211 aa  KTHY_ANASP RecName: Full=Thymidylate kinase;       
    2::201     3e-28  36%  203 aa  KTHY_STAES RecName: Full=Thymidylate kinase;       
    2::201     3e-28  36%  203 aa  KTHY_STAEQ RecName: Full=Thymidylate kinase;       
    1::195     3e-28  35%  208 aa  KTHY_LISIN RecName: Full=Thymidylate kinase;       
   12::211     3e-28  37%  226 aa  KTHY_BRASO RecName: Full=Thymidylate kinase;       
   11::214     5e-28  37%  230 aa  KTHY_NITHX RecName: Full=Thymidylate kinase;       
    5::200     5e-28  37%  212 aa  KTHY_CHRSD RecName: Full=Thymidylate kinase;       
    6::178     5e-28  39%  217 aa  KTHY_ACISJ RecName: Full=Thymidylate kinase;       
    5::199     6e-28  36%  214 aa  KTHY_GEOKA RecName: Full=Thymidylate kinase;       
    1::207     8e-28  38%  213 aa  KTHY_SYNPW RecName: Full=Thymidylate kinase;       
    5::197     8e-28  41%  211 aa  KTHY_STRP3 RecName: Full=Thymidylate kinase;       
    1::170     1e-27  41%  209 aa  KTHY_SYNPX RecName: Full=Thymidylate kinase;       
    3::197     1e-27  40%  211 aa  KTHY_STRE4 RecName: Full=Thymidylate kinase;       
    6::195     1e-27  37%  210 aa  KTHY_PYRFU RecName: Full=Probable thymidylate kinase;       
    1::209     1e-27  37%  212 aa  KTHY_PROM9 RecName: Full=Thymidylate kinase;       
    2::143     1e-27  42%  215 aa  KTHY_DESVM RecName: Full=Thymidylate kinase;       
    3::197     1e-27  40%  211 aa  KTHY_STRS7 RecName: Full=Thymidylate kinase;       
    5::196     1e-27  41%  211 aa  KTHY_STRPZ RecName: Full=Thymidylate kinase;       
    1::201     1e-27  35%  210 aa  KTHY_PSEE4 RecName: Full=Thymidylate kinase;       
    6::207     1e-27  35%  213 aa  KTHY_LEUMM RecName: Full=Thymidylate kinase;       
    2::180     2e-27  42%  205 aa  KTHY_WOLTR RecName: Full=Thymidylate kinase;       
    5::196     2e-27  41%  211 aa  KTHY_STRP1 RecName: Full=Thymidylate kinase;       
    6::210     2e-27  37%  214 aa  KTHY_LEUCK RecName: Full=Thymidylate kinase;       
    1::209     2e-27  35%  214 aa  KTHY_LACCB RecName: Full=Thymidylate kinase;       
    1::209     2e-27  35%  214 aa  KTHY_LACC3 RecName: Full=Thymidylate kinase;       
    2::143     2e-27  40%  224 aa  KTHY_DESVV RecName: Full=Thymidylate kinase;       
    3::198     2e-27  36%  206 aa  KTHY_DEIRA RecName: Full=Thymidylate kinase;       
    2::195     2e-27  36%  208 aa  KTHY_DEHSB RecName: Full=Thymidylate kinase;       
    1::199     2e-27  36%  204 aa  KTHY_DECAR RecName: Full=Thymidylate kinase;       
    5::196     2e-27  41%  211 aa  KTHY_STRP6 RecName: Full=Thymidylate kinase;       
    1::209     2e-27  37%  212 aa  KTHY_PROM0 RecName: Full=Thymidylate kinase;       
    1::189     2e-27  44%  225 aa  KTHY_POLSJ RecName: Full=Thymidylate kinase;       
    2::143     2e-27  40%  224 aa  KTHY_DESVH RecName: Full=Thymidylate kinase;       
    1::205     2e-27  34%  212 aa  KTHY_BACLD RecName: Full=Thymidylate kinase;       
    1::223     2e-27  39%  231 aa  KTHY_ACAM1 RecName: Full=Thymidylate kinase;       
    5::196     3e-27  41%  211 aa  KTHY_STRPG RecName: Full=Thymidylate kinase;       
    5::196     3e-27  41%  211 aa  KTHY_STRP8 RecName: Full=Thymidylate kinase;       
    1::189     3e-27  36%  200 aa  KTHY_RALME RecName: Full=Thymidylate kinase;       
    7::202     3e-27  37%  225 aa  KTHY_MESSB RecName: Full=Thymidylate kinase;       
    1::199     3e-27  34%  208 aa  KTHY_LISMO RecName: Full=Thymidylate kinase;       
    1::199     3e-27  34%  208 aa  KTHY_LISMH RecName: Full=Thymidylate kinase;       
    6::202     4e-27  32%  203 aa  KTHY_RICAE RecName: Full=Thymidylate kinase;       
    1::194     4e-27  34%  210 aa  KTHY_PSEAE RecName: Full=Thymidylate kinase;       
    1::194     4e-27  34%  210 aa  KTHY_PSEA8 RecName: Full=Thymidylate kinase;       
    2::124     4e-27  50%  199 aa  KTHY_NEOSM RecName: Full=Thymidylate kinase;       
    1::199     4e-27  34%  208 aa  KTHY_LISMF RecName: Full=Thymidylate kinase;       
    1::199     4e-27  34%  208 aa  KTHY_LISMC RecName: Full=Thymidylate kinase;       
    2::195     4e-27  36%  208 aa  KTHY_DEHSC RecName: Full=Thymidylate kinase;       
    1::212     4e-27  36%  212 aa  KTHY_BACA2 RecName: Full=Thymidylate kinase;       
    1::194     5e-27  34%  210 aa  KTHY_PSEA7 RecName: Full=Thymidylate kinase;       
    1::206     5e-27  34%  211 aa  KTHY_NOSP7 RecName: Full=Thymidylate kinase;       
    7::208     7e-27  36%  209 aa  KTHY_STRTD RecName: Full=Thymidylate kinase;       
    7::208     7e-27  36%  209 aa  KTHY_STRT2 RecName: Full=Thymidylate kinase;       
    7::208     7e-27  36%  209 aa  KTHY_STRT1 RecName: Full=Thymidylate kinase;       
    2::201     7e-27  35%  205 aa  KTHY_STAAW RecName: Full=Thymidylate kinase;       
    2::201     7e-27  35%  205 aa  KTHY_STAAS RecName: Full=Thymidylate kinase;       
    2::201     7e-27  35%  205 aa  KTHY_STAAR RecName: Full=Thymidylate kinase;       
    2::201     7e-27  35%  205 aa  KTHY_STAAN RecName: Full=Thymidylate kinase;       
    2::201     7e-27  35%  205 aa  KTHY_STAAM RecName: Full=Thymidylate kinase;       
    2::201     7e-27  35%  205 aa  KTHY_STAAC RecName: Full=Thymidylate kinase;       
    2::201     7e-27  35%  205 aa  KTHY_STAAB RecName: Full=Thymidylate kinase;       
    2::201     7e-27  35%  205 aa  KTHY_STAA9 RecName: Full=Thymidylate kinase;       
    2::201     7e-27  35%  205 aa  KTHY_STAA8 RecName: Full=Thymidylate kinase;       
    2::201     7e-27  35%  205 aa  KTHY_STAA3 RecName: Full=Thymidylate kinase;       
    2::201     7e-27  35%  205 aa  KTHY_STAA2 RecName: Full=Thymidylate kinase;       
    2::201     7e-27  35%  205 aa  KTHY_STAA1 RecName: Full=Thymidylate kinase;       
    6::204     7e-27  35%  206 aa  KTHY_RICBR RecName: Full=Thymidylate kinase;       
    1::210     7e-27  35%  213 aa  KTHY_LACRJ RecName: Full=Thymidylate kinase;       
    1::210     7e-27  35%  213 aa  KTHY_LACRD RecName: Full=Thymidylate kinase;       
    6::202     8e-27  32%  203 aa  KTHY_RICCN RecName: Full=Thymidylate kinase;       
    6::204     8e-27  35%  206 aa  KTHY_RICB8 RecName: Full=Thymidylate kinase;       
    1::209     8e-27  38%  220 aa  KTHY_PROMA RecName: Full=Thymidylate kinase;       
    2::195     8e-27  37%  207 aa  KTHY_DEHE1 RecName: Full=Thymidylate kinase;       
    2::198     1e-26  34%  203 aa  KTHY_STAHJ RecName: Full=Thymidylate kinase;       
    6::202     1e-26  32%  203 aa  KTHY_RICM5 RecName: Full=Thymidylate kinase;       
    4::202     1e-26  35%  219 aa  KTHY_PELPD RecName: Full=Thymidylate kinase;       
    1::204     1e-26  36%  214 aa  KTHY_LACSS RecName: Full=Thymidylate kinase;       
    2::185     1e-26  40%  197 aa  KTHY_THEMA RecName: Full=Thymidylate kinase;       
    2::215     1e-26  34%  226 aa  KTHY_ROSS1 RecName: Full=Thymidylate kinase;       
    6::202     1e-26  31%  203 aa  KTHY_RICTY RecName: Full=Thymidylate kinase;       
    1::194     1e-26  34%  210 aa  KTHY_PSEAB RecName: Full=Thymidylate kinase;       
    1::205     1e-26  37%  214 aa  KTHY_LACF3 RecName: Full=Thymidylate kinase;       
    6::200     2e-26  37%  210 aa  KTHY_MYCGE RecName: Full=Thymidylate kinase;       
    6::202     2e-26  32%  206 aa  KTHY_RICFE RecName: Full=Thymidylate kinase;       
   12::190     2e-26  37%  228 aa  KTHY_OLICO RecName: Full=Thymidylate kinase;       
    2::185     3e-26  40%  197 aa  KTHY_THESQ RecName: Full=Thymidylate kinase;       
    6::202     3e-26  32%  203 aa  KTHY_RICRS RecName: Full=Thymidylate kinase;       
    6::202     3e-26  32%  203 aa  KTHY_RICRO RecName: Full=Thymidylate kinase;       
    9::203     3e-26  34%  213 aa  KTHY_MYCGA RecName: Full=Thymidylate kinase;       
    7::208     4e-26  36%  211 aa  KTHY_SILPO RecName: Full=Thymidylate kinase;       
    6::202     4e-26  31%  203 aa  KTHY_RICPR RecName: Full=Thymidylate kinase;       
    7::167     4e-26  39%  215 aa  KTHY_HALHL RecName: Full=Thymidylate kinase;       
    1::195     4e-26  36%  203 aa  KTHY_DICNV RecName: Full=Thymidylate kinase;       
    6::204     4e-26  37%  214 aa  KTHY_BDEBA RecName: Full=Thymidylate kinase;       
    7::210     4e-26  36%  221 aa  KTHY_ACIAC RecName: Full=Thymidylate kinase;       
    6::202     6e-26  32%  203 aa  KTHY_RICPU RecName: Full=Thymidylate kinase;       
   12::184     6e-26  39%  230 aa  KTHY_NITWN RecName: Full=Thymidylate kinase;       
    2::191     6e-26  38%  207 aa  KTHY_AYWBP RecName: Full=Thymidylate kinase;       
    6::197     7e-26  40%  213 aa  KTHY_OENOB RecName: Full=Thymidylate kinase;       
    2::185     9e-26  40%  197 aa  KTHY_THEP1 RecName: Full=Thymidylate kinase;       
    6::202     9e-26  32%  203 aa  KTHY_RICCK RecName: Full=Thymidylate kinase;       
    3::207     9e-26  36%  214 aa  KTHY_CHLTE RecName: Full=Thymidylate kinase;       
    7::172     1e-25  42%  215 aa  KTHY_RHOFD RecName: Full=Thymidylate kinase;       
    6::199     1e-25  38%  207 aa  KTHY_DINSH RecName: Full=Thymidylate kinase;       
    2::205     2e-25  32%  221 aa  KTHY_LACPL RecName: Full=Thymidylate kinase;       
    1::201     2e-25  36%  208 aa  KTHY_JANSC RecName: Full=Thymidylate kinase;       
    1::141     3e-25  42%  211 aa  KTHY_PROMT RecName: Full=Thymidylate kinase;       
    2::205     3e-25  36%  209 aa  KTHY_MYCMO RecName: Full=Thymidylate kinase;       
   12::190     4e-25  35%  230 aa  KTHY_RHOPB RecName: Full=Thymidylate kinase;       
   12::214     4e-25  36%  228 aa  KTHY_BRAJA RecName: Full=Thymidylate kinase;       
    2::192     5e-25  38%  201 aa  KTHY_ACHLI RecName: Full=Thymidylate kinase;       
    1::201     6e-25  36%  214 aa  KTHY_BARQU RecName: Full=Thymidylate kinase;       
    6::202     8e-25  32%  203 aa  KTHY_RICAH RecName: Full=Thymidylate kinase;       
    4::196     8e-25  35%  213 aa  KTHY_GEOUR RecName: Full=Thymidylate kinase;       
    1::141     1e-24  41%  211 aa  KTHY_PROM1 RecName: Full=Thymidylate kinase;       
    4::198     1e-24  35%  214 aa  KTHY_GEOSF RecName: Full=Thymidylate kinase;       
    2::193     1e-24  41%  202 aa  KTHY_EHRRW RecName: Full=Thymidylate kinase;       
    2::193     1e-24  41%  202 aa  KTHY_EHRRG RecName: Full=Thymidylate kinase;       
    1::202     1e-24  31%  205 aa  KTHY_TERTT RecName: Full=Thymidylate kinase;       
    2::180     1e-24  39%  202 aa  KTHY_EHRCR RecName: Full=Thymidylate kinase;       
    1::173     1e-24  37%  221 aa  KTHY_DESAP RecName: Full=Thymidylate kinase;       
    1::208     2e-24  34%  216 aa  KTHY_PROMM RecName: Full=Thymidylate kinase;       
    2::187     2e-24  36%  195 aa  KTHY_HELHP RecName: Full=Thymidylate kinase;       
    1::222     2e-24  35%  234 aa  KTHY_CYAP4 RecName: Full=Thymidylate kinase;       
    3::198     2e-24  36%  208 aa  KTHY_CAUCR RecName: Full=Thymidylate kinase;       
    2::216     3e-24  34%  229 aa  KTHY_ROSCS RecName: Full=Thymidylate kinase;       
    2::206     4e-24  36%  207 aa  KTHY_ONYPE RecName: Full=Thymidylate kinase;       
   12::199     4e-24  35%  226 aa  KTHY_BRASB RecName: Full=Thymidylate kinase;       
    4::136     4e-24  42%  208 aa  KTHY_BORPE RecName: Full=Thymidylate kinase;       
    4::136     4e-24  42%  208 aa  KTHY_BORPA RecName: Full=Thymidylate kinase;       
    4::136     4e-24  42%  208 aa  KTHY_BORBR RecName: Full=Thymidylate kinase;       
    1::208     7e-24  34%  216 aa  KTHY_PROM3 RecName: Full=Thymidylate kinase;       
    2::190     7e-24  35%  207 aa  KTHY_CHLFF RecName: Full=Thymidylate kinase;       
    2::165     9e-24  41%  196 aa  KTHY_WOLPM RecName: Full=Thymidylate kinase;       
    1::200     9e-24  34%  205 aa  KTHY_PYRAB RecName: Full=Probable thymidylate kinase;       
    2::206     9e-24  33%  211 aa  KTHY_MYCHJ RecName: Full=Thymidylate kinase;       
    2::206     9e-24  33%  211 aa  KTHY_MYCH2 RecName: Full=Thymidylate kinase;       
    2::175     9e-24  41%  202 aa  KTHY_EHRCJ RecName: Full=Thymidylate kinase;       
    8::200     9e-24  39%  206 aa  KTHY_AKKM8 RecName: Full=Thymidylate kinase;       
    3::176     1e-23  36%  210 aa  KTHY_MYCPN RecName: Full=Thymidylate kinase;       
    2::191     1e-23  37%  211 aa  KTHY_CHLAB RecName: Full=Thymidylate kinase;       
    2::181     1e-23  40%  203 aa  KTHY_CHLMU RecName: Full=Thymidylate kinase;       
    2::191     1e-23  35%  207 aa  KTHY_CHLCV RecName: Full=Thymidylate kinase;       
   11::212     2e-23  34%  230 aa  KTHY_RHOPA RecName: Full=Thymidylate kinase;       
    2::201     2e-23  34%  227 aa  KTHY_DESAH RecName: Full=Thymidylate kinase;       
    1::206     3e-23  32%  210 aa  KTHY_MAGSM RecName: Full=Thymidylate kinase;       
    2::198     3e-23  34%  206 aa  KTHY_CHLPN RecName: Full=Thymidylate kinase;       
    2::193     4e-23  35%  193 aa  KTHY_COPPD RecName: Full=Thymidylate kinase;       
   11::212     6e-23  34%  230 aa  KTHY_RHOPT RecName: Full=Thymidylate kinase;       
    2::206     6e-23  33%  211 aa  KTHY_MYCH7 RecName: Full=Thymidylate kinase;       
    1::208     6e-23  32%  215 aa  KTHY_BARHE RecName: Full=Thymidylate kinase;       
   11::207     7e-23  33%  210 aa  KTHY_LEIXX RecName: Full=Thymidylate kinase;       
    7::197     7e-23  40%  214 aa  KTHY_GLUOX RecName: Full=Thymidylate kinase;       
    2::200     7e-23  33%  212 aa  KTHY_GEOLS RecName: Full=Thymidylate kinase;       
    3::185     7e-23  34%  195 aa  KTHY_AQUAE RecName: Full=Thymidylate kinase;       
    2::147     1e-22  38%  236 aa  KTHY_HERA2 RecName: Full=Thymidylate kinase;       
    1::119     1e-22  42%  211 aa  KTHY_CLAMS RecName: Full=Thymidylate kinase;       
    4::208     2e-22  32%  219 aa  KTHY_SYNAS RecName: Full=Thymidylate kinase;       
   49::214     4e-22  31%  245 aa  KTHY_RHOBA RecName: Full=Thymidylate kinase;       
    6::165     4e-22  40%  224 aa  KTHY_RHILO RecName: Full=Thymidylate kinase;       
    4::145     4e-22  39%  213 aa  KTHY_GEOSL RecName: Full=Thymidylate kinase;       
    1::205     4e-22  33%  214 aa  KTHY_BRUSU RecName: Full=Thymidylate kinase;       
    1::205     4e-22  33%  214 aa  KTHY_BRUSI RecName: Full=Thymidylate kinase;       
    4::136     4e-22  40%  207 aa  KTHY_BORPD RecName: Full=Thymidylate kinase;       
    8::180     4e-22  37%  224 aa  KTHY_AGRT5 RecName: Full=Thymidylate kinase;       
    2::140     6e-22  39%  210 aa  KTHY_THERP RecName: Full=Thymidylate kinase;       
    4::178     8e-22  34%  225 aa  KTHY_GEOBB RecName: Full=Thymidylate kinase;       
    1::205     1e-21  32%  214 aa  KTHY_BRUO2 RecName: Full=Thymidylate kinase;       
    1::205     1e-21  32%  214 aa  KTHY_BRUME RecName: Full=Thymidylate kinase;       
    1::205     1e-21  32%  214 aa  KTHY_BRUMB RecName: Full=Thymidylate kinase;       
    1::205     1e-21  32%  214 aa  KTHY_BRUC2 RecName: Full=Thymidylate kinase;       
    1::205     1e-21  32%  214 aa  KTHY_BRUA1 RecName: Full=Thymidylate kinase;       
    1::200     1e-21  31%  205 aa  KTHY_PYRHO RecName: Full=Probable thymidylate kinase;       
    1::168     1e-21  35%  216 aa  KTHY_PELTS RecName: Full=Thymidylate kinase;       
    1::119     1e-21  41%  211 aa  KTHY_CLAM3 RecName: Full=Thymidylate kinase;       
    2::199     2e-21  33%  205 aa  KTHY_THEON RecName: Full=Probable thymidylate kinase;       
    2::199     2e-21  33%  205 aa  KTHY_PYRKO RecName: Full=Probable thymidylate kinase;       
    1::194     2e-21  36%  205 aa  KTHY_METBF RecName: Full=Probable thymidylate kinase;       
    2::188     2e-21  35%  195 aa  KTHY_CAMC1 RecName: Full=Thymidylate kinase;       
    2::195     2e-21  34%  211 aa  KTHY_ANAMM RecName: Full=Thymidylate kinase;       
    2::195     2e-21  34%  211 aa  KTHY_ANAMF RecName: Full=Thymidylate kinase;       
    2::209     2e-21  33%  214 aa  KTHY_MYCS5 RecName: Full=Thymidylate kinase;       
    4::197     2e-21  32%  225 aa  KTHY_GEOSM RecName: Full=Thymidylate kinase;       
    4::201     3e-21  32%  210 aa  KTHY_THESM RecName: Full=Probable thymidylate kinase;       
    2::188     5e-21  31%  194 aa  KTHY_CAMC5 RecName: Full=Thymidylate kinase;       
    1::197     7e-21  32%  214 aa  KTHY_LACBA RecName: Full=Thymidylate kinase;       
    2::181     7e-21  34%  203 aa  KTHY_CHLTB RecName: Full=Thymidylate kinase;       
    2::181     7e-21  34%  203 aa  KTHY_CHLT2 RecName: Full=Thymidylate kinase;       
    2::170     7e-21  37%  219 aa  KTHY_ANAPZ RecName: Full=Thymidylate kinase;       
    2::186     9e-21  36%  193 aa  KTHY_PYRCJ RecName: Full=Probable thymidylate kinase;       
    8::203     9e-21  31%  217 aa  KTHY_ORITI RecName: Full=Thymidylate kinase;       
    8::203     9e-21  31%  217 aa  KTHY_ORITB RecName: Full=Thymidylate kinase;       
    1::194     1e-20  35%  206 aa  KTHY_METAC RecName: Full=Probable thymidylate kinase;       
   27::200     2e-20  36%  234 aa  KTHY_RHIME RecName: Full=Thymidylate kinase;       
    3::192     2e-20  33%  192 aa  KTHY_PYRAE RecName: Full=Probable thymidylate kinase;       
    2::181     2e-20  34%  203 aa  KTHY_CHLTR RecName: Full=Thymidylate kinase;       
    2::181     2e-20  34%  203 aa  KTHY_CHLTA RecName: Full=Thymidylate kinase;       
    4::124     3e-20  44%  208 aa  KTHY_THEGJ RecName: Full=Probable thymidylate kinase;       
    2::173     8e-20  35%  208 aa  KTHY_LAWIP RecName: Full=Thymidylate kinase;       
    2::191     1e-19  30%  199 aa  KTHY_TROWT RecName: Full=Thymidylate kinase;       
    2::191     1e-19  30%  199 aa  KTHY_TROW8 RecName: Full=Thymidylate kinase;       
    3::171     1e-19  33%  196 aa  KTHY_ARCFU RecName: Full=Probable thymidylate kinase;       
    1::187     2e-19  33%  203 aa  KTHY_BRAHW RecName: Full=Thymidylate kinase;       
    1::191     2e-19  32%  201 aa  KTHY_METBU RecName: Full=Probable thymidylate kinase;       
    2::187     2e-19  36%  192 aa  KTHY_CAMJR RecName: Full=Thymidylate kinase;       
    2::187     2e-19  36%  192 aa  KTHY_CAMJJ RecName: Full=Thymidylate kinase;       
    2::187     2e-19  36%  192 aa  KTHY_CAMJE RecName: Full=Thymidylate kinase;       
    1::185     3e-19  35%  206 aa  KTHY_METMA RecName: Full=Probable thymidylate kinase;       
   15::224     4e-19  32%  234 aa  KTHY_MYCPU RecName: Full=Thymidylate kinase;       
    2::187     4e-19  36%  192 aa  KTHY_CAMJ8 RecName: Full=Thymidylate kinase;       
   18::227     7e-19  35%  230 aa  KTHY_UREPA RecName: Full=Thymidylate kinase;       
   18::227     7e-19  35%  230 aa  KTHY_UREP2 RecName: Full=Thymidylate kinase;       
    2::187     9e-19  36%  192 aa  KTHY_CAMJD RecName: Full=Thymidylate kinase;       
    2::200     1e-18  31%  217 aa  KTHY_DESDA RecName: Full=Thymidylate kinase;       
    2::188     1e-18  34%  191 aa  KTHY_HELPH RecName: Full=Thymidylate kinase;       
    7::171     2e-18  38%  226 aa  KTHY_VEREI RecName: Full=Thymidylate kinase;       
    2::188     3e-18  33%  191 aa  KTHY_HELPG RecName: Full=Thymidylate kinase;       
    6::188     3e-18  31%  192 aa  KTHY_CAMFF RecName: Full=Thymidylate kinase;       
    2::183     4e-18  34%  191 aa  KTHY_HELP2 RecName: Full=Thymidylate kinase;       
    1::199     6e-18  33%  208 aa  KTHY_SPHWW RecName: Full=Thymidylate kinase;       
    8::205     6e-18  31%  214 aa  KTHY_MYCPE RecName: Full=Thymidylate kinase;       
    3::190     6e-18  34%  195 aa  KTHY_CAMHC RecName: Full=Thymidylate kinase;       
    2::153     7e-18  38%  191 aa  KTHY_HELAH RecName: Full=Thymidylate kinase;       
    2::183     9e-18  34%  191 aa  KTHY_HELPY RecName: Full=Thymidylate kinase;       
    2::185     2e-17  36%  191 aa  KTHY_SULDN RecName: Full=Thymidylate kinase;       
    2::182     3e-17  35%  189 aa  KTHY_ARCB4 RecName: Full=Thymidylate kinase;       
    2::143     5e-17  35%  209 aa  KTHY_DESMR RecName: Full=Thymidylate kinase;       
    8::201     8e-17  30%  205 aa  KTHY_LEPBL RecName: Full=Thymidylate kinase;       
    8::201     8e-17  30%  205 aa  KTHY_LEPBJ RecName: Full=Thymidylate kinase;       
    2::188     8e-17  33%  191 aa  KTHY_HELPS RecName: Full=Thymidylate kinase;       
    4::193     8e-17  29%  205 aa  KTHY_CALMQ RecName: Full=Probable thymidylate kinase;       
    2::192     1e-16  34%  194 aa  KTHY_NAUPA RecName: Full=Thymidylate kinase;       
    2::158     1e-16  37%  190 aa  KTHY_WOLSU RecName: Full=Thymidylate kinase;       
    7::193     1e-16  32%  202 aa  KTHY_DESPS RecName: Full=Thymidylate kinase;       
   16::194     2e-15  30%  204 aa  KTHY_PROAC RecName: Full=Thymidylate kinase;       
    2::188     2e-15  32%  191 aa  KTHY_HELPJ RecName: Full=Thymidylate kinase;       
    2::189     3e-15  32%  191 aa  KTHY_SULNB RecName: Full=Thymidylate kinase;       
    3::187     3e-15  34%  189 aa  KTHY1_SULSO RecName: Full=Probable thymidylate kinase 1;       
    8::199     4e-15  30%  199 aa  KTHY_STAMF RecName: Full=Probable thymidylate kinase;       
    2::179     4e-15  34%  188 aa  KTHY_METJA RecName: Full=Probable thymidylate kinase;       
    2::198     6e-15  31%  215 aa  KTHY_MYCAP RecName: Full=Thymidylate kinase;       
    3::164     1e-14  32%  196 aa  KTHY_NATPD RecName: Full=Probable thymidylate kinase;       
    8::191     3e-14  34%  204 aa  KTHY_LEPIN RecName: Full=Thymidylate kinase;       
    8::191     3e-14  34%  204 aa  KTHY_LEPIC RecName: Full=Thymidylate kinase;       
    3::189     3e-14  32%  195 aa  KTHY_HALMA RecName: Full=Probable thymidylate kinase;       
    3::167     1e-13  34%  206 aa  KTHY_METHJ RecName: Full=Probable thymidylate kinase;       
    3::193     2e-13  32%  197 aa  KTHY_HALLT RecName: Full=Probable thymidylate kinase;       
    2::150     3e-13  37%  194 aa  KTHY_CAMLR RecName: Full=Thymidylate kinase;       
    3::177     4e-13  29%  199 aa  KTHY_HALSA RecName: Full=Probable thymidylate kinase;       
    3::177     4e-13  29%  199 aa  KTHY_HALS3 RecName: Full=Probable thymidylate kinase;       
    2::184     2e-12  32%  190 aa  KTHY_THEVO RecName: Full=Probable thymidylate kinase;       
    1::148     3e-12  31%  212 aa  KTHY_SYNY3 RecName: Full=Thymidylate kinase;       
    7::201     3e-12  27%  213 aa  KTHY2_SULTO RecName: Full=Probable thymidylate kinase;       
    3::192     2e-11  34%  198 aa  KTHY_METLZ RecName: Full=Probable thymidylate kinase;       
    2::185     2e-11  27%  195 aa  KTHY_METST RecName: Full=Probable thymidylate kinase;       
    4::192     3e-11  32%  194 aa  KTHY_SULAC RecName: Full=Probable thymidylate kinase;       
    6::194     3e-11  33%  210 aa  KTHY_SCHPO RecName: Full=Thymidylate kinase;       
    2::159     4e-11  32%  196 aa  KTHY_META3 RecName: Full=Probable thymidylate kinase;       
    3::183     4e-11  32%  190 aa  KTHY1_SULTO RecName: Full=Probable thymidylate kinase;       
    2::109     7e-11  38%  199 aa  KTHY_METMP RecName: Full=Probable thymidylate kinase;       
    2::123     9e-11  38%  198 aa  KTHY_METVS RecName: Full=Probable thymidylate kinase;       
    1::210     9e-11  23%  213 aa  KTHY2_SULSO RecName: Full=Probable thymidylate kinase 2;       
    7::197     2e-10  31%  208 aa  KTHY_TREPA RecName: Full=Putative thymidylate kinase;       
    3::96      2e-10  38%  205 aa  KTHY_METMJ RecName: Full=Probable thymidylate kinase;       
   12::108     2e-10  34%  227 aa  KTHY_XANCP RecName: Full=Thymidylate kinase;       
   12::108     2e-10  34%  227 aa  KTHY_XANCB RecName: Full=Thymidylate kinase;       
   12::108     2e-10  34%  227 aa  KTHY_XANC8 RecName: Full=Thymidylate kinase;       
    2::109     2e-10  39%  199 aa  KTHY_METM7 RecName: Full=Probable thymidylate kinase;       
    2::109     3e-10  38%  199 aa  KTHY_METM6 RecName: Full=Probable thymidylate kinase;       
   21::183     3e-10  28%  222 aa  KTHY_DICDI RecName: Full=Thymidylate kinase;       
    3::174     4e-10  29%  208 aa  KTHY_XYLFT RecName: Full=Thymidylate kinase;       
   12::183     4e-10  29%  217 aa  KTHY_XYLF2 RecName: Full=Thymidylate kinase;       
   12::183     6e-10  29%  217 aa  KTHY_XYLFM RecName: Full=Thymidylate kinase;       
    3::174     7e-10  29%  208 aa  KTHY_XYLFA RecName: Full=Thymidylate kinase;       
    9::194     7e-10  30%  212 aa  KTHY_HUMAN RecName: Full=Thymidylate kinase;       
    4::201     1e-09  29%  216 aa  KTHY_YEAST RecName: Full=Thymidylate kinase;       
    7::183     5e-09  25%  204 aa  KTHY_CWPXG RecName: Full=Thymidylate kinase;       
    2::176     6e-09  29%  192 aa  KTHY_METS3 RecName: Full=Probable thymidylate kinase;       
    7::183     6e-09  25%  204 aa  KTHY_ECTVM RecName: Full=Thymidylate kinase;       
    6::133     1e-08  31%  202 aa  KTHY_PICTO RecName: Full=Probable thymidylate kinase;       
    7::183     2e-08  24%  204 aa  KTHY_RABPU RecName: Full=Thymidylate kinase;       
    7::183     2e-08  24%  204 aa  KTHY_CWPXB RecName: Full=Thymidylate kinase;       
    7::183     3e-08  24%  204 aa  KTHY_VACCW RecName: Full=Thymidylate kinase;       
    7::183     3e-08  24%  204 aa  KTHY_VACCT RecName: Full=Thymidylate kinase;       
    7::183     3e-08  24%  204 aa  KTHY_VACCC RecName: Full=Thymidylate kinase;       
    7::183     3e-08  24%  204 aa  KTHY_VACCA RecName: Full=Thymidylate kinase;       
    2::165     3e-08  25%  208 aa  KTHY_AERPE RecName: Full=Putative thymidylate kinase;       
   11::214     5e-08  27%  218 aa  KTHY_CAEEL RecName: Full=Probable thymidylate kinase;       
    7::183     7e-08  25%  204 aa  KTHY_CAMPS RecName: Full=Thymidylate kinase;       
    7::183     7e-08  25%  204 aa  KTHY_CAMPM RecName: Full=Thymidylate kinase;       
   12::122     9e-08  30%  227 aa  KTHY_XANOR RecName: Full=Thymidylate kinase;       
   12::122     9e-08  30%  227 aa  KTHY_XANOP RecName: Full=Thymidylate kinase;       
   12::122     9e-08  30%  227 aa  KTHY_XANOM RecName: Full=Thymidylate kinase;       
    2::102     2e-07  32%  194 aa  KTHY_METTH RecName: Full=Probable thymidylate kinase;       
    2::86      3e-07  40%  199 aa  KTHY_METM5 RecName: Full=Probable thymidylate kinase;       
    7::129     4e-07  28%  205 aa  KTHY_VARV RecName: Full=Thymidylate kinase;       
    1::111     4e-07  31%  239 aa  KTHY_ASFWA RecName: Full=Thymidylate kinase;       
   12::122     7e-07  31%  226 aa  KTHY_XANC5 RecName: Full=Thymidylate kinase;       
   12::122     7e-07  31%  227 aa  KTHY_XANAC RecName: Full=Thymidylate kinase;       
    4::162     1e-06  30%  196 aa  KTHY_METS5 RecName: Full=Probable thymidylate kinase;       
    1::115     1e-06  32%  240 aa  KTHY_ASFB7 RecName: Full=Thymidylate kinase;       
   17::140     2e-06  29%  213 aa  KTHY_IIV6 RecName: Full=Putative thymidylate kinase 251L;       
    1::115     2e-06  30%  239 aa  KTHY_ASFP4 RecName: Full=Thymidylate kinase;       
    4::123     3e-06  30%  194 aa  KTHY_METKA RecName: Full=Probable thymidylate kinase;       
    9::191     6e-06  27%  212 aa  KTHY_MOUSE RecName: Full=Thymidylate kinase;       
    3::170     2e-05  35%  248 aa  PSTK_METJA RecName: Full=L-seryl-tRNA(Sec) kinase;       
    2::184     2e-05  32%  193 aa  KTHY_THEAC RecName: Full=Probable thymidylate kinase;       
    1::107     9e-05  30%  235 aa  KTHY_ASFK5 RecName: Full=Thymidylate kinase;       
   32::173     3e-04  31%  285 aa  DGK_DICDI RecName: Full=Deoxyguanosine kinase;         Short=dGK;  
   76::125     6e-04  36%  470 aa  ACDG2_METMA RecName: Full=Acetyl-CoA decarbonylase/synthase complex
   76::125     6e-04  36%  470 aa  ACDG1_METMA RecName: Full=Acetyl-CoA decarbonylase/synthase complex
    1::209

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSDSELLM
KTHY_FRATM      MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSDSELLM
KTHY_FRATW      MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSDSELLM
KTHY_FRATT      MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSDSELLM
KTHY_FRAT1      MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSDSELLM
KTHY_FRATN      MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSDSELLM
KTHY_FRATH      MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSDSELLM
KTHY_FRATF      MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSDSELLM
KTHY_FRATO      MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSDSELLM
KTHY_FRAP2      --SKFIVIEGLDGAGKSTAIGFIKKYLDSKSLAAVYTREPGGTKVAEELRSIVLHNDYDEEIHPDSELLM
KTHY_PSEHT      MKPKFIVIEGLEGAGKSTAIALCQSFLNSKKIDFINVREPGGTPLAESLRTLV-KAQHDEEIAFETELLI
KTHY_ACTSZ      MKGKFIVLEGLEGAGKTTALHTVVEQLRSLGITLVFTREPGGTPLAEKLRQLIKHET-EEPVTDKAELLM
KTHY_PECCP      MNSKFIVIEGLEGAGKTTARHIVVETLRSHGVKVVFTREPGGTPLAEKLRELIKQGMTDEKVTDKAEVLM
KTHY_ERWCT      MNSKFIVIEGLEGAGKTTARNIVVETLRSHGVKEVFTREPGGTPLAEKLRELIKQGMADEKVTDKAEVLM
KTHY_VIBCM      MNAKFIVIEGLEGAGKSTAIQVVVETLQQNGIDHITTREPGGTLLAEKLRALVKEEHPGEELQDITELLL
KTHY_VIBCH      MNAKFIVIEGLEGAGKSTAIQVVVETLQQNGIDHITTREPGGTLLAEKLRALVKEEHPGEELQDITELLL
KTHY_VIBC3      MNAKFIVIEGLEGAGKSTAIQVVVETLQQNGIDHITTREPGGTLLAEKLRALVKEEHPGEELQDITELLL
KTHY_PHOLL      MNSKFIVIEGLEGAGKTSAMKTIVEMLQQHGIQLIFTREPGGTPLAEKLRGLIKQGVEGEPLTDKAEVLM
KTHY_SHESR      --AKFIVVEGLEGAGKSSAIALIRDFIEKHTLAPVCTREPGGTPLAERIRDLVKIADPSDPLCDESECLL
KTHY_SHESM      --AKFIVVEGLEGAGKSSAIALIRDFIEKHTLAPVCTREPGGTPLAERIRDLVKIADPSDPLCDESECLL
KTHY_LEGPH      LTGKLIVIEGLEGAGKSTAVNLVVELLSQKKISTITTREPGGTKIGEILRSIIKNPEYNNVLDDRSELLL
KTHY_SHEAM      ---KFIVIEGLEGAGKSSAITLVHDFIEKHTMAPVCTREPGGTPLAEKIRDLVKNAEPGDPLCDEAECLL
KTHY_ALTMD      MRGKFIVVEGLEGAGKSSVIGLIVKALTDAGMRVEQTREPGGTPMAEAIRECVKHD-WDETVSEETELLL
KTHY_LEGPL      LTGKLIVIEGLEGAGKSTAVNLVVELLSQKKISTITTREPGGTKIGEILRSIIKNPEYNNVLDDRSELLL
KTHY_ACTPJ      MRGKFIVLEGLEGAGKTTAHQVILAQLEKAGKNVVQTREPGGTPLAEKLRHLIKHET-EEAVSDKAELLM
KTHY_ACTP7      MRGKFIVLEGLEGAGKTTAHQVILAQLEKAGKNVVQTREPGGTPLAEKLRHLIKHET-EEAVSDKAELLM
KTHY_ACTP2      MRGKFIVLEGLEGAGKTTAHQVILAQLEKAGKNVVQTREPGGTPLAEKLRHLIKHET-EEAVSDKAELLM
KTHY_SHEFN      -QGKFIVIEGLEGAGKSSAIALVNDIIKQHGQAPVCTREPGGTPLAEKMRDLVKIADETDPLCDEAECLL
KTHY_SHEON      --AKFIVVEGLEGAGKSSAIALIRDFIEKHTHAPVCTREPGGTPLAERIRDLVKIADPSDPLCDESECLL
KTHY_LEGPA      LTGKLIVIEGLEGAGKSTAVNLVVELLSQKKISTITTREPGGTRIGEILRSIIKNPEYNNVLDDRSELLL
KTHY_LEGPC      LTGKLIVIEGLEGAGKSTAVNLVVELLSQKKISTITTREPGGTRIGEILRSIIKNPEYNNVLDDRSELLL
KTHY_HAEIN      MKGKFIVIEGLEGAGKSSAHQSVVRVLHELGIQVVFTREPGGTPLAEKLRHLIKHET-EEPVTDKAELLM
KTHY_HAEIG      MKGKFIVIEGLEGAGKSSAHQSVVRVLHELGIKVVFTREPGGTPLAEKLRHLIKHET-EEPVTDKAELLM
KTHY_HAEIE      MKGKFIVIEGLEGAGKSSAHQSVVRVLHELAIQVVFTREPGGTPLAEKLRHLIKHET-EEPVTHKAELLM
KTHY_BLOPB      MDNRFITIEGLDGAGKTTITHRVSKYLNQYGVTDILTHEPGGTPVSDFLRVLIKYGPMNEPINSISELLM
KTHY_PASMU      ---KFIVLEGIEGAGKTTARDSIVRALHAHGIHDIFTREPGGTPLAEKLRQLIKHET-EEPVTDKAELLM
KTHY_VIBFM      --SKFIVIEGLEGAGKSTAIKNVLATLAKHGITSVTTREPGGTPLAEKMRELVKQGHPDEPLTDMAELLL
KTHY_SHELP      --AKFIVIEGLEGAGKSSAIALVRDFIEKHNVPPVCTREPGGTPLAERIRDLVKIADPNDPLCDESECLL
KTHY_HAEDU      MRGKFIVLEGLEGAGKTTAHQIILTQLKQAGIQQIVTREPGGTPLAEKLRYLIKH-EFEEPISPQAELLM
KTHY_VIBF1      --SKFIVIEGLEGAGKSTAIKNVLATLAKHGITSVTTREPGGTPLAEKMRELVKQGHPDEPLTDMAELLL
KTHY_YERE8      MNSKFIVIEGLEGAGKTTARDTVVATLRAQGINDIFTREPGGTPLAEKLRDLIKQGIDGEVLTDKAEVLM
KTHY_PHOPR      MTAKFIVIEGLEGAGKSTAIQQVIDALAAHGIEPESTREPGGTPLAEQMRALIKEGHPDEPLTDMAELLL
KTHY_COLP3      ---KFIVIEGMEGAGKSSAIAVIESTLNKHGIEYINTREPGGTPLAESLRDMVKSVDHQEKLTVETELLL
KTHY_VIBVY      -QAKFIVIEGLEGAGKSTAIQTVLDTLRQAGINEIQTREPGGTPLAEKMRALVKEEHPGEHLHDMTELLL
KTHY_VIBVU      -QAKFIVIEGLEGAGKSTAIQTVLDTLRQAGINEIQTREPGGTPLAEKMRALVKEEHPGEHLHDMTELLL
KTHY_AERHH      --SKFIVIEGLEGAGKSSAVRYVADYLHGHGVARIETREPGGTPLAERMRAIV-KEVHDERLTIEAELLL
KTHY_ALISL      --SKFIVIEGLEGAGKSTAIKNVLATLAKHGITAVTTREPGGTPLAEKMRELVKQGHPDEPLTDMAELLL
KTHY_EDWI9      MESKFIVIEGLEGAGKTTARDVVVDELRRHGIPVVFTREPGGTPLAEHLRTLVKEGVDGETLTDRAEVLM
KTHY_SERP5      MKSKFVVIEGLEGAGKTTARDTVVDVLREHGINDIFTREPGGTPLAEKLRDLFKRGVEGELPTIKAEVLM
KTHY_HAEPS      MRGKFIVIEGLEGAGKSNAQRIVSETLAAHGIEFITTREPGGTPIAEALRNLWKEGEDGEHTTDKAEVLM
KTHY_VIBPA      MKANFIVVEGLEGAGKSTAIKTVLDTLKQAGIENIVTREPGGTPLAEKMRALVKEEHEGEELKDMTELLL
KTHY_MANSM      MNGKFIVLEGLEGAGKTTARQAVVEQLNALGITLLFTREPGGTPLAEKLRNLIKY-ETEEPVTDKAELLM
KTHY_ECOL6      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_ECOUT      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_ECOK1      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_ECO45      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_ESCF3      MRSNYIVIEGLEGAGKTTARNVVVETLEQLGIREIFTREPGGTQLAEKLRSLVLDIKSDEVITEKAEVLM
KTHY_CITK8      MGSNYIVIEGLEGAGKTTARNVVVETLEQLGIHMIFTREPGGTQLAEKLRSLVLDIKSDETITDKAEVLM
KTHY_WIGBR      IKSKFIVIEGLEGSGKTNAISKIVNLLNKQGIKVIFTREPGGTPLAESLRTLIKEGVGYEKITDNAELLM
KTHY_VIBHB      MKANFIVVEGLEGAGKSTAIKTVLDTLKAAGIENIVTREPGGTPLAEKMRGLVKEEHEGEDLKDMTELLL
KTHY_ENTS8      MSSKYIVIEGLEGAGKTTARNLVVETLKSLGVTDMFTREPGGTVLAEKLRSLVLDIKSDEVITDNAEVLL
KTHY_ECOSM      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_ECO7I      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_YERPY      MNSKFIVIEGLEGAGKTTARDTVVAVLRAQGINDIFTREPGGTPLAEKLRDLIKQGIDGEVLTDKAEVLM
KTHY_YERPS      MNSKFIVIEGLEGAGKTTARDTVVAVLRAQGINDIFTREPGGTPLAEKLRDLIKQGIDGEVLTDKAEVLM
KTHY_YERPB      MNSKFIVIEGLEGAGKTTARDTVVAVLRAQGINDIFTREPGGTPLAEKLRDLIKQGIDGEVLTDKAEVLM
KTHY_YERP3      MNSKFIVIEGLEGAGKTTARDTVVAVLRAQGINDIFTREPGGTPLAEKLRDLIKQGIDGEVLTDKAEVLM
KTHY_SHISS      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_SHIFL      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_SHIF8      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_SHIDS      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_SHIBS      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_SHIB3      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_SALPK      MGSNYIVIEGLEGAGKTTARDVVVETLEQLGIRMIFTREPGGTQLAEKLRSLVLDIRSDEVITDKAEVLM
KTHY_SALPC      MGSNYIVIEGLEGAGKTTARDVVVETLEQLGIRMIFTREPGGTQLAEKLRSLVLDIRSDEVITDKAEVLM
KTHY_SALPB      MGSNYIVIEGLEGAGKTTARDVVVETLEQLGIRMIFTREPGGTQLAEKLRSLVLDIRSDEVITDKAEVLM
KTHY_SALPA      MGSNYIVIEGLEGAGKTTARDVVVETLEQLGIRMIFTREPGGTQLAEKLRSLVLDIRSDEVITDKAEVLM
KTHY_SALNS      MGSNYIVIEGLEGAGKTTARDVVVETLEQLGIRMIFTREPGGTQLAEKLRSLVLDIRSDEVITDKAEVLM
KTHY_SALHS      MGSNYIVIEGLEGAGKTTARDVVVETLEQLGIRMIFTREPGGTQLAEKLRSLVLDIRSDEVITDKAEVLM
KTHY_SALG2      MGSNYIVIEGLEGAGKTTARDVVVETLEQLGIRMIFTREPGGTQLAEKLRSLVLDIRSDEVITDKAEVLM
KTHY_SALEP      MGSNYIVIEGLEGAGKTTARDVVVETLEQLGIRMIFTREPGGTQLAEKLRSLVLDIRSDEVITDKAEVLM
KTHY_SALCH      MGSNYIVIEGLEGAGKTTARDVVVETLEQLGIRMIFTREPGGTQLAEKLRSLVLDIRSDEVITDKAEVLM
KTHY_SALA4      MGSNYIVIEGLEGAGKTTARDVVVETLEQLGIRMIFTREPGGTQLAEKLRSLVLDIRSDEVITDKAEVLM
KTHY_HAES2      ---KFIVIEGLEGAGKSSTHQVVVNTLTEFGIEVVFTREPGGTPLAEKLRYLIKHEA-EELVTAKAELLM
KTHY_ECOSE      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_ECOLU      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_ECOLI      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_ECOLC      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_ECOL5      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_ECOHS      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_ECODH      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_ECOBW      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_ECO8A      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_ECO81      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_ECO55      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_ECO27      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_ECO24      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEVITDKAEVLM
KTHY_SALTY      MGSNYIVIEGLEGAGKTTARDVVVETLEQLGIRMIFTREPGGTQLAEKLRSLVLDIRSDEVITDKAEVLM
KTHY_SALTI      MGSNYIVIEGLEGAGKTTARDVVVETLEQLGIRMIFTREPGGTQLAEKLRSLVLDIRSDEVITDKAEVLM
KTHY_SALSV      MGSNYIVIEGLEGAGKTTARDVVVETLEQLGIRMIFTREPGGTQLAEKLRSLVLDIRSDEVITDKAEVLM
KTHY_SALDC      MGSNYIVIEGLEGAGKTTARDVVVETLEQLGIRMIFTREPGGTQLAEKLRSLVLDIRSDEVITDKAEVLM
KTHY_ECO5E      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEIITDKAEVLM
KTHY_ECO57      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLVLDIKSDEIITDKAEVLM
KTHY_ERWT9      MNSKFIVIEGLEGAGKTTAREAVVSELQRHGINIIFTREPGGTPLAEKLRELIKQGVEGERVTDSAELLM
KTHY_ENT38      MRSNYIVIEGLEGAGKTTARNVVVDTLKELGIEQVFTREPGGTQLAEKLRSLVLDIKSDEVIDVKAEVLM
KTHY_SALAR      MGSNYIVIEGLEGAGKTTARDVVVETLEQLGIRMIFTREPGGTQLAEKLRSLVLDIRSDEVITDKAEVLM
KTHY_YERPP      MNSKFIVIEGLEGAGKTTTRDTVVAVLRAQGINDIFTREPGGTPLAEKLRDLIKQGIDGEVLTDKAEVLM
KTHY_YERPN      MNSKFIVIEGLEGAGKTTTRDTVVAVLRAQGINDIFTREPGGTPLAEKLRDLIKQGIDGEVLTDKAEVLM
KTHY_YERPG      MNSKFIVIEGLEGAGKTTTRDTVVAVLRAQGINDIFTREPGGTPLAEKLRDLIKQGIDGEVLTDKAEVLM
KTHY_YERPE      MNSKFIVIEGLEGAGKTTTRDTVVAVLRAQGINDIFTREPGGTPLAEKLRDLIKQGIDGEVLTDKAEVLM
KTHY_YERPA      MNSKFIVIEGLEGAGKTTTRDTVVAVLRAQGINDIFTREPGGTPLAEKLRDLIKQGIDGEVLTDKAEVLM
KTHY_HAES1      ---KFIVIEGLEGAGKSSTHQVVVNTLKEFGIEVVFTREPGGTPLAEKLRYLIKH-EVEELVTAKAELLM
KTHY_KLEP3      MRSNYIVIEGLEGAGKTTARQLVVETLQSAGIHMVFTREPGGTVLAEKLRSLVLQSTGDEVINDKAEVLM
KTHY_KLEP7      MRSNYIVIEGLEGAGKTTARQLVVETLQSAGIHMVFTREPGGTILAEKLRSLVLQSTGDEVINDKAEVLM
KTHY_RUTMC      -RGKFITIDGVEGSGKSTQIDFICDYLVTKKINVILTREPGGTELGEKIRTLLLSTDI-QSIHGDTELLL
KTHY_BUCAP      IKSKFIVIEGLEGAGKTHACICVQRILKENNIKVILVRQPGSTPVAEKIRKLIKNNTYIEDFEKETELLL
KTHY_VESOH      -RGKFITIDGVEGAGKSTQIDFICSYLAKKNINVVLTREPGGTKLGEKIRALLL--SIDTQLDNDTELLL
KTHY_HAMD5      MKGKFIVIEGLEGAGKSTAVNTVQQFLRHFKIQVICTREPGGTALSEEIRHLIKKKSQNEEILTDAEXXX
KTHY_IDILO      MSGKFIVIEGLEGAGKSSAIASVVTHLQAKGIQVETVREPGGTPLAESLRDLV-KKKWEEKVSPTTELLL
KTHY_KOSOT      ----FISFEGIDGSGKSTQVALFREYLERNSMEYVFIREPGGTQAGEDIREILLHNEY--KLFPETELLL
KTHY_SODGM      MNSKFIVIEGLEGSGKTSAIAQVVDVLREQGIRVVFTREPGGTPLAEALRTLIKDGVGEEPVTDRAELLM
KTHY_BAUCH      MKSKFIVIEGLEGAGKTSVIQQIITILHSNGIHNIITRDPGGTPLAETIRDIIKKGMNGEYITDYTELLL
KTHY_SHESA      --AKFIVVEGLEGAGKSSAIALIRDFIEKHTLAPVCTREPGGTPLAERIRDLVKIADPSDPLCDESECLL
KTHY_NITMU      MRGKFITLEGIDGAGKTTHLRWLEYFLKERGKNVMVTREPGGTPLGEALRDILLDSR--QTMHAETEALL
KTHY_NITEC      -RGKFITFEGIDGAGKSTHLAWLASFLRDKGLEVIVTREPGSTALGEQLRQLLLDHR--QAMHAETETLL
KTHY_TRIEI      MIGKFIVFEGVEGGGKTTQIELLQDWLLETDLEVVITREPGGTKLGKALRELLLSDVLAEKIQETSELLL
KTHY_NEIG2      MKPQFITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPVGEALREILLNPETKAGLRA--ETLM
KTHY_NEIG1      MKPQFITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPVGEALREILLNPETKAGLRA--ETLM
KTHY_MARMS      MRGKFISLEGGEGSGKTTAIHFIRQWLDDHKIPYIMTREPGGTPLAEEIRQLVLTPR-DESVNDVTELLL
KTHY_CARHZ      MRGKFITIEGVEGSGKTTQIQYIARYLTEKNIPHIITREPGGTALGKKIRELLLNPSYP--VVPEAEILL
KTHY_ACIBS      ----FISFEGTEGVGKTTLIRKIHQHFEEQGKQVVLTREPGGTPLAEQIRSMLLAVNHDENMSHDTELLL
KTHY_ACIBC      ----FISFEGTEGVGKTTLIRKIHQHFEEQGKQVVLTREPGGTPLAEQIRSMLLAVNHDENMSHDTELLL
KTHY_ACIBT      ----FISFEGTEGVGKTTLIRKIHQHFEEQGKQVVLTREPGGTPLAEQIRSMLLAVNHDENMSHDTELLL
KTHY_NEIMB      MKPQFITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPVGEALREILLNPETKAGLRA--ETLM
KTHY_HALOH      MRGLFITLEGIEGSGKSTQIEMLYKRLKKDGFDVIITREPGGTPIGKEIRKLLLDP--DNIMGAKAEFLL
KTHY_COXBU      -RGRFISFEGIEGVGKTTALNWVREQLDAARIPYVVTREPGGTPIAEAIRDVLLSHS-DEMMCPDTELLL
KTHY_ACIBY      ----FISFEGTEGVGKTTLIRKIHQHFEEQGKQVVLTREPGGTPLAEQIRSMLLAVNHNENMSHDTELLL
KTHY_ACIB5      ----FISFEGTEGVGKTTLIRKIHQHFEEQGKQVVLTREPGGTPLAEQIRSMLLAVNHNENMSHDTELLL
KTHY_ACIB3      ----FISFEGTEGVGKTTLIRKIHQHFEEQGKQVVLTREPGGTPLAEQIRSMLLAVNHNENMSHDTELLL
KTHY_NITEU      -RGKFITVEGIDGAGKSTHLAWLERFLQDKGLEVVVTREPGGTALGEALRQLLLDHR--QAMHPETEALL
KTHY_NEIMA      MKPQFITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPVGEALREILLNPETKAGLRA--ETLM
KTHY_CHRVO      -RGRFITLEGIDGAGKSTHLSFIRDWLARHGVDAAFTREPGGTPLSEKIRDLLLDPGTVASL--DAEALL
KTHY_BUCBP      LKGKFIVIEGIEGSGKTTICKTLKNILYEHGIKVICVRDPGSTPLAEKIRSLLITKDKNEYMVNETELLL
KTHY_DESRM      ----FIVFEGVDGSGKSTQLNLLNKYLSQKEIKTICTREPGGTPVGEKIRELLLDPNF-AEIQDRTEALL
KTHY_BUCAI      IKSKFIVIEGLEGAGKTNAICXXXXXXXXXXXXXXXXRQPGSTPIAEDIRRLIKKKFNDDNLIKETELLL
KTHY_NEIMF      MKPQFITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPVGEALREILLNPETKAGLRA--ETLM
KTHY_RALEH      MRGKFITFEGIDGAGKSTHIDWVADRLRRSDIAGVVTREPGGTSLGEDLRQILLHRK----MHLETEALL
KTHY_BLOFL      MNNRFIVVEGLDGSGKTTIVHKIVKYFYNQKITVITTHEPGGTEIAYILSELIKNKSKNEKLTDLSELLM
KTHY_THEAB      ----FIAFEGIDGSGKSTQLNLLSQYLKSKGKKVLNIREPGGTILGEKIREILLDNNLN--INKRSELLL
KTHY_BURPP      -RGKFITFEGIDGAGKTTHLSWFRERLEQKGRSVVMTREPGGTPLGEQIREIVLHQKMDLE----TEALL
KTHY_PSEPF      MTGLFITLEGPEGAGKSTNREYLAERLRAAGIEVVLTREPGGTPLAERIREVLLA-PVDEVMNPDTELLL
KTHY_CALS8      MKGKFIVFEGNDGSGKSTQILKVEKYLKEKGYKVVTTREPGGTEVGFRIRKLLLDPAY--KMDGLTEALL
KTHY_HAHCH      ----FITVEGIEGAGKTTNLNFIRSILEESGEEVVMTREPGGTPMAXXXXXXXXXXXXXA-VSSTAELLL
KTHY_FERNB      ----FVSFEGIDGCGKSTQVNLLVNYLEEKGIPYIKVREPGGTHLGEKIRELLI----TQEMCARSELLL
KTHY_CLONN      ----FITLEGPEGSGKTTIVKMIEKYLSENNIEYISTREPGGINISEQIRDVIL-NKDNVAMDARTEALL
KTHY_BURP8      -RGKFITFEGIDGAGKTTHLGWFRDRLEQKVAPAVMTREPGGTKLGESLRDILLHEAMDLE----TEALL
KTHY_THIDA      LPGKFITLEGVDGAGKSTHVGFVAEWLRGQGREVIVTREPGGTALGETLRELLLHR----EMAADTELLL
KTHY_PSEF5      MTGLFITLEGPEGAGKSTNREYLAERLRAAGIEVLLTREPGGTPLAERIRDVLL-TPVEEVMNADTELLL
KTHY_LACJO      MRGYLITFEGPDGAGKTTVINEIIKQLPQSQERTLVTREPGGSKISENIRTIILDPE-NKEMDDRTEALL
KTHY_PROM2      MKGKFIVIEGIDGCGKTTQIDELSKWLPSSGLIKITTREPGGSHLGKRLRGLILDNNQNNKPSPLAELLL
KTHY_PSEFS      MTGLFITLEGPEGAGKSTNRDYLAERLRSEGIEVVLTREPGGTPLAERIREVLLAPG-EEQMNPDTELLL
KTHY_LACH4      MRGYFVSFEGPDGAGKSTVLKEVLDQIPKLKPQYLVTREPGGSKIAEKIRDIIL-DPANDKMDAKTEALL
KTHY_GEOSW      MKGRFFSFEGPDGAGKTTMITKLESFLREKGFDVLLTREPGGVRIAEEIRSIILNPKHTE-MDGRTEALL
KTHY_CUPTR      MRGKFITFEGIDGAGKSTHIDWVADRLRRADIAGVVTREPGGTSLGEDLRQILLHRK----MHLETEALL
KTHY_BURXL      -RGKFITFEGIDGAGKTTHLSWFRERLEQKGRSVVMTREPGGTPLGEQIREIVLHQKMDLE----TEALL
KTHY_ACIAD      ----FISFEGTEGVGKTTLIRKLYEHFEASGKQVVLTREPGGTPLAEQIRSLLLAVNHDEPMSSDTELLL
KTHY_PSESM      MTGLFITLEGPEGAGKSTNRDYLAAQLRAQGVQVLLTREPGGTPLAERIRELLLAPS-DEGMSADTELLL
KTHY_METFK      MRGRFITLEGMDGAGKSSHIESIVSVLEGRGLEVVSTREPGGTPLGEKLRELLLH----ERMHVETETLL
KTHY_JANMA      ---KFITFEGIDGAGKSTHLSFVAELLCERKKTVVVTREPGGTSLGEELREILLH----EKMHLETEALL
KTHY_PSE14      MTGLFITLEGPEGAGKSTNREYLAAQLRAQGVQVLLTREPGGTPLAERIRELLLAPS-DEAMSADTELLL
KTHY_PROMP      MRGKFIVIEGIDGCGKTTQIDEISKWIPTSGLLRVKTREPGGSLLGKKIRNLILDNHKDNKPSSLAELLL
KTHY_LACDB      MQGYFITFEGPDGAGKTTVINEVVKAIQGQKREILVTREPGGSKIAEKIRDIIL-DPANTEMNAKTEALL
KTHY_LACDA      MQGYFITFEGPDGAGKTTVINEVVKAIQGQKREILVTREPGGSKIAEKIRDIIL-DPANTEMNAKTEALL
KTHY_BACSK      ----FITVEGGEGAGKTTIINLVQEQLATQGYEVIRTREPGGVELAEQIRDLLLHTQ-GVEMDNRTEALL
KTHY_STRGC      -----VSLEGPDGAGKSSVLEALVPILEAQGHQVVTTREPGGVPISEAIREVIL-DQNNTEMDGKTELLL
KTHY_RALEJ      MRGKFITFEGIDGAGKSTHIGAVAARLRKDIPAVVTTREPGGTPLGEDLRQILLHRK----MHLETEALL
KTHY_BIFLI      MSGLFVSFEGVDGVGKTTQVERLRAYLEAQGRTVVVTREPGGTVLGKAIRQLLLHGVDGGDIAPRAEALL
KTHY_PSEU2      MTGLFITLEGPEGAGKSTNRDYLAAQLRAQGVQVLLTREPGGTPLAERVRELLLAPS-DEAMSADTELLL
KTHY_PARUW      ----FITIEGGEGSGKSTLLNQLGDYFRNKGFEVIQTREPGGTKLGESIRHLLLNHEDSISIGHQAELLL
KTHY_BIFLD      MSGLFVSFEGVDGVGKTTQVERLRAYLEAQGRTVVVTREPGGTALGKAIRQLLLHGVDGGDIAPRAEALL
KTHY_METCA      ---KFITLEGGEGVGKSTNVDFVVSRLRARGLKVVATREPGGTAFGEAVREIFLRQ---DTVRPEAELLL
KTHY_BIFLO      MNGLFVSFEGVDGVGKTTQVERLRAYLEAQGRTVVVTREPGGTALGKAIRQLLLHGVDGGDIAPRAEALL
KTHY_BURCH      ---KFITFEGIDGAGKTTHLQWFCERLQGRLAAAVVTREPGGTQLGEKLREILLNQPMDLE----TEALL
KTHY_BURCC      ---KFITFEGIDGAGKTTHLQWFCERLQGRLAAAVVTREPGGTQLGEKLREILLNQPMDLE----TEALL
KTHY_BURCA      ---KFITFEGIDGAGKTTHLQWFCERLQGRLAAAVVTREPGGTQLGEKLREILLNQPMDLE----TEALL
KTHY_PROM5      MKGKFIVIEGIDGCGKTTQIDEISRWLPTSGLMGIKTREPGGSLLGKKLRNLILDNNKNNKPSSLAELLL
KTHY_FINM2      ----FITFEGPDGSGKSTIIQKVYDYLIENNYDVIKTREPGGSPIAEKIRNLILDTE-NIKMGYRTEALL
KTHY_MYCCT      ----FITFEGMDGSGKTTALLKVKEELERLNYKVLITREPGGEVIAEQIRQIILDNK-NKDMDAWTEALL
KTHY_BACP2      MSGMFITFEGPEGAGKTTVIRKVHEEMERQGYAVMATREPGGIDIAEQIREVILNEK-NTKMDAKTEALL
KTHY_BURCJ      ---KFITFEGIDGAGKTTHLAWFCERLQGRLAAAVVTREPGGTQLGEKLREILLNQPMDLE----TEALL
KTHY_BIFAA      MQGTFISFEGVDGVGKTTQVERLRAYVESQGRECVVTREPGGTALGVAIRKMLLHDTGDENDCADTEALL
KTHY_RALPJ      MTGKFITFEGIDGAGKSTHLAWFAQQLQAKGKKVVVTREPGGTPLGERLREVLLH----ERMHLETEALL
KTHY_MESFL      ----FITIEGMDGSGKTTALQRVKQYLEDLNYKVVMTREPGGLPLSEKIRELIL-NKDGVGMEPWTEALL
KTHY_DESAD      ----FITFEGIEGTGKTTQIKKLTAFLEESGHNVDVTLEPGGSRIGKELRKILL-NMDSTDITGECELFL
KTHY_CHLP8      -----ITFEGIDGAGKSTQVVKLKRHLQERGREVLTLREPGGTPVAEQIRELLLESHND--ITSIAELLL
KTHY_BURCM      ---KFITFEGIDGAGKTTHLQWFCERLQAKLAAGVVTREPGGTQLGEKLREILLNQPMDLE----TEALL
KTHY_BURA4      ---KFITFEGIDGAGKTTHLQWFCERLQAKLAAGVVTREPGGTQLGEKLREILLNQPMDLE----TEALL
KTHY_LACAC      MKGYFVSFEGPDGAGKSTVLKEVLAEIAPQKTQYLVTREPGGSKIAEKIRDIIL-DPANDKMDPKTEALL
KTHY_BURP6      -RGKFITFEGIDGAGKTTHLQWLQERLGPTGRHVVVTREPGGTQLGETLREILLNQPMDLE----TEALL
KTHY_BURMS      -RGKFITFEGIDGAGKTTHLQWLQERLGPTGRHVVVTREPGGTQLGETLREILLNQPMDLE----TEALL
KTHY_BURMA      -RGKFITFEGIDGAGKTTHLQWLQERLGPTGRHVVVTREPGGTQLGETLREILLNQPMDLE----TEALL
KTHY_BURM9      -RGKFITFEGIDGAGKTTHLQWLQERLGPTGRHVVVTREPGGTQLGETLREILLNQPMDLE----TEALL
KTHY_BURM7      -RGKFITFEGIDGAGKTTHLQWLQERLGPTGRHVVVTREPGGTQLGETLREILLNQPMDLE----TEALL
KTHY_ALHEH      -RGRFITLEGLEGAGKSTALTRVREYLQRQGIDAVMTREPGGTPLGERIRALLL-GQSEPPMAPATEALL
KTHY_SYNJA      ----FITLEGGEGVGKTTQQALLAERLQREGYACVSTREPGGTALGEALRELLLHG---DPLTPLAELLL
KTHY_ANAVT      MGGRFIVFEGVEGCGKTSQMQLCAEWLQNLGISVILTREPGGTELGVDLRRLLLQKAEDKPIAEVTELLL
KTHY_ALCBS      MSGRFITLEGGEGAGKSSNLVWLAEALRAEGKTVMVSREPGGTALAESIREVLLAPS-NEVMADDTELLL
KTHY_RALSO      MTGKFITFEGIDGAGKSTHLAWFAQQLEARGRKVVVTREPGGTPLGERLREVLLH----ERMHLETEALL
KTHY_PELLD      -----ITFEGIDGAGKSTQIQKLAAYLKQEGREVLTLREPGGTEVAEKIRHILLESRHD--ITPVGELLL
KTHY_BURS3      ---KFITFEGIDGAGKTTHLQWFCERLQGKLAAAVVTREPGGTQLGEKLREILLNQPMDLE----TEALL
KTHY_BURPS      -RGKFITFEGIDGAGKTTHLQWLQERLGPTGRHVVVTREPGGTQLGETLREILLNQPMDLE----TEALL
KTHY_BURP1      -RGKFITFEGIDGAGKTTHLQWLQERLGPTGRHVVVTREPGGTQLGETLREILLNQPMDLE----TEALL
KTHY_BURP0      -RGKFITFEGIDGAGKTTHLQWLQERLGPTGRHVVVTREPGGTQLGETLREILLNQPMDLE----TEALL
KTHY_SYNJB      ----FITLEGGEGVGKTTQQALLVERLRQEGYACLCTREPGGTALGKTLRELLLHG---DPFSPLAELLL
KTHY_MYCMS      ----FITFEGMDGSGKTTTLLKVKEELERLNYQVLITREPGGEAIAEQIRQIILDNK-NRDMDAWTEALL
KTHY_GEOTN      MNGYFFSFEGPEGAGKTTMIGKLESFLRERGFDVMVTREPGGVRIAEAIRALILNREYTE-MDGRTEALL
KTHY_ENTFA      MQGIFITFEGPDGAGKTSVLKEVSERLAKESKRKIVTREPGGIPIAEKIRTVILDPRNDR-MDERTEALL
KTHY_BURTA      -RGKFITFEGIDGAGKTTHLQWFCDRLQERLGPAVVTREPGGTRLGETLREILLNQPMDLE----TEALL
KTHY_ANOFW      MSYLFFSFEGPEGAGKTTIVRMLKDYLSEQHVDVVATREPGGIDIAEQIRAVILHPN-NERMDARTEALL
KTHY_THETN      MRGKFISFEGIDGCGKTTQVKLLEEHLKKEGYDLLVLREPGGTRVGEKVREILLDR--ENLIFPVTEMLL
KTHY_SYNS3      ---RLLVLEGIDGCGKTTQLQQLSSWLPKSGLMPVVTREPGGTALGTSLRQLLLHPPQDADPGPTAELLL
KTHY_PSEPG      MSGLFITLEGPEGAGKSTNRDYLAARLREHGLDVVLTREPGGTPLAERVRELLLAPS-DESMAADTELLL
KTHY_PROM4      MKGHFIVLEGIDGCGKSTQISHISKWLPQSGLANLYTREPGGTTLGKSLRDLLLHEHETNVPAPLTELLL
KTHY_HERAR      -KAKFITFEGIDGAGKSTHLSFVADLLRASKKNVVVTREPGGTSLGEALRTILLH----EKMHLETEALL
KTHY_PROVI      -----ITFEGIDGAGKSTQIRKLAAHLRSQGQEVLTLREPGGTEVAENIRLILLESRHD--ITPVGELLL
KTHY_CHLL2      -----ITFEGIDGAGKSTQIRKLQKLLIGAHIDSITLREPGGTEVAEKIRQILLESRH--EISPIGELLL
KTHY_STRA5      -----ISFEGPDGAGKTTVLEAVLPLLEKLSQDILTTREPGGVTISEEIRHIILDVKHTQ-MDKKTELLL
KTHY_STRA3      -----ISFEGPDGAGKTTVLEAVLPLLEKLSQDILTTREPGGVTISEEIRHIILDVKHTQ-MDKKTELLL
KTHY_STRA1      -----ISFEGPDGAGKTTVLEAVLPLLEKLSQDILTTREPGGVTISEEIRHIILDVKHTQ-MDKKTELLL
KTHY_LACLS      MNGILISLEGPDGAGKTTVLQEILPEIQKMKREVVPTREPGGVRVAEEIRQIILDPK-NTEIDSKTELML
KTHY_BURVG      -RGKFITFEGIDGAGKTTHLQWFCERLQAKLAAGVVTREPGGTPLGEALREMLLNQPMDLE----TEALL
KTHY_BACHD      ----FITVEGGEGAGKTSALDAIEEMLRENGLSVVRTREPGGIPIAEQIRSIILHTRMDPR----TEALL
KTHY_LACS1      MEGKFITFEGIDGSGKTSVLKGVIEHLNDKRIDNIWTREPGGNRISEAIRKIILNVEYTE-MDARTEALL
KTHY_STAS1      --SAFITFEGPEGSGKTTVIQQVAQKLE-NQYSVVLTREPGGVKTGEQIREVLLEG---DDMDDRTEALL
KTHY_PSEP1      MSGLFITLEGPEGAGKSTNRDYLAARLREHGLDVVLTREPGGTPLAEKVRELLL-TPSDEGMAADTELLL
KTHY_LACLM      MNGILISLEGPDGAGKTTVLQEILPEIQKMKREVVPTREPGGVRVAEEIRQIILDPK-NTEIDSKTELML
KTHY_SYMTH      --SVFISFEGVDGSGKSTQIRLLLQYLDEQSVPYVFTREPGGTPIAEQIRRVLL-DPANRGMSVITEALL
KTHY_STRU0      -KGKIITLEGPDGAGKTSVLEQLVLKLEKDNEQSIVTREPGGVAISESIRNIIL-DVNNTEMDFKTELLL
KTHY_LACLA      MNGILISLEGPDGAGKTTVLKEILPEIQKMKREIVPTREPGGVRVAEEIRQIILDPK-NTDIDSKTELML
KTHY_CLOB8      ----FIVFEGGEGTGKTTAIDAIYDWITENNFECIKTREPGGIKISEQIRQVIL-SKDNKEMDAKTEALL
KTHY_PELCD      --SFFISLEGIEGSGKTTQIKRLADRLESLGHAVLITREPGGCPIADQIRQILLHPD-NGHLDPKAELLL
KTHY_GLOVI      ----FITFEGGEGCGKTTQLTLLGDWLEKRCHRVVRTREPGGTALGRSLRGLLLDAR--SEITPTAELLL
KTHY_THEPX      MKGKFISFEGIDGCGKTTQIKFLEEYLLKQGYNILVLREPGGTKVGEKVRDILLDK--NNFISPVTEMLL
KTHY_THEP3      MKGKFISFEGIDGCGKTTQIKFLEEYLLKQGYNILVLREPGGTKVGEKVRDILLDK--NNFISPVTEMLL
KTHY_SYNSC      MTGRFIVLEGIDGCGKTTQIQHLLEWLPNSGLAVVCTREPGGTPLGRSIRELLLHTSDQEAPAPTAELML
KTHY_EXISA      MSGMFITVEGPDGSGKSTQLQLLVENLKQKGYDIVVTREPGGTTVGNQIREVLLSPDH-HEMTPRVEMML
KTHY_SYNS9      MTGRFIVLDGIDGCGKSTQIRHLAQWLPASGLMPICTREPGGTPLGQSIRELLLHTEADQVPSVTAELLL
KTHY_STRSV      -----ISLEGPEGAGKSSVLEALLPFLQNYGTGLITTREPGGVQIAEAIREVILEPSHTA-MDAKTELLL
KTHY_THEEB      ----FIVLEGGEGAGKTTQMGAIATWLENSGWLALLTREPGGTPLGQGLRQLLLHS--DLAIDPLAELLL
KTHY_PSEPW      ----FITLEGPEGAGKSTNRDYLAARLREQGLDVVLTREPGGTPLAEKVRELLLAPS-DEVMAADTELLL
KTHY_PEDPA      MNGHFISFEGPDGAGKTTVLAMVEHYQQRLKDQLTVTREPGGNPISEAIRTIIL-DKNNTEMDERTEALL
KTHY_SYNR3      MRGRFLVLEGIDGCGKTTQLKALADWLPASGLMPITTREPGGTALGQALRQLLLHPPEEQAPATRAELLL
KTHY_STRMU      ----FISFEGPDGAGKTTVLEAILPQLKK--LVAITTREPGGVAIAESIRDLILHTNMDDK----TELLL
KTHY_PSEMY      MTGLFITLEGPEGAGKSTNREYLAERLREQGVDVVLTREPGGTPLAERIRELLL-DPSDEPMAADTELLL
KTHY_PELPB      -----ITFEGIDGAGKSTQIKELVHALGLQGIEAVVLREPGGTTVAEKIRQILLESSHG--ITPVGELLL
KTHY_STRPS      MSKGFLVLEGPEGAGKTSVLEALLPILEEKGVKVLTTREPGGVLIGEKIREVILDPSHTQ-MDAKTELLL
KTHY_PROA2      ----FITFEGIDGAGKSTQVKMLRKLLISKGLEVLTLREPGGTDISESIRDILLEVKND--ITPIGELLL
KTHY_DESDG      ----FITFEGIEGSGKSTALARLKDWLQEHGHGATLTREPGGSRLGGILRSILLDIGNDD-LTGETELFL
KTHY_BACCN      MKGLFVTIEGPEGSGKSTLITKLLPYFENKGQKVIATREPGGIAISEEIRT-ILHKKEYTTMEARTEALL
KTHY_PSEU5      MKGLFVTLEGPEGAGKSTNREYLAERLRARGLDVVLTREPGGTPLAERIRELLL-TPADEPMAVDTELLL
KTHY_CHLPD      -----ITFEGIDGAGKSTQIKKLQTVLNKAGVESVTLREPGGTEVAEKIRSILLESRH--EISAVGELLL
KTHY_CHLCH      -----ITFEGIDGAGKSTQVAKLVAYLKQQSTPLLSLREPGGTPTAESIRSLLLDNR--KSITPIAELLL
KTHY_BACCQ      MKGLFVTIEGPEGSGKTTLIQGLLPYFEQKEQKVMATREPGGIAISEEIRT-ILHKQEYTMMEARTEALL
KTHY_THEM4      ----FIAFEGIDGSGKSTQLVLLEKYLINRGKKVIKVREPGGTILGEKIRDLLLNFNMNKR----SELLL
KTHY_STRZP      MSKGFLVLEGPEGAGKTSVLEALLPILEEKGVKVLTTREPGGVLIGEKIREVILDPSHTQ-MDAKTELLL
KTHY_STRZJ      MSKGFLVLEGPEGAGKTSVLEALLPILEEKGVEVLTTREPGGVLIGEKIREVILDPSHTQ-MDAKTELLL
KTHY_STRR6      MSKGFLVLEGPEGAGKTSVLEALLPILEEKGVEVLTTREPGGVLIGEKIREVILDPSHTQ-MDAKTELLL
KTHY_STRPN      MSKGFLVLEGPEGAGKTSVLEALLPILEEKGVEVLTTREPGGVLIGEKIREVILDPSHTQ-MDAKTELLL
KTHY_STRP7      MSKGFLVLEGPEGAGKTSVLEALLPILEEKGVEVLTTREPGGVLIGEKIREVILDPSHTQ-MDAKTELLL
KTHY_STRP4      MSKGFLVLEGPEGAGKTSVLEALLPILEEKGVEVLTTREPGGVLIGEKIREVILDPSHTQ-MDAKTELLL
KTHY_STRP2      MSKGFLVLEGPEGAGKTSVLEALLPILEEKGVEVLTTREPGGVLIGEKIREVILDPSHTQ-MDAKTELLL
KTHY_STRZT      MSKGFLVLEGPEGAGKTSVLEALLPILEEKGVEVLTTREPGGVLIGEKIREVILDPSHTQ-MDAKTELLL
KTHY_PSYWF      ---KFVSFEGTEGVGKTTAINGLCERLQAQGIEYVRTREPGGSPFAEQLRELLLDTR--TQINDDTELLL
KTHY_OCEIH      MAGLFITFEGGEGAGKTTVIQHIFQKLIAQGIDVIQTREPGGIKISEKIRSII-HDPEHLEMEERTEALL
KTHY_STRPI      MSKGFLVLEGPEGAGKTSVLEALLPILEVKGVKVLTTREPGGVLIGEKIREVILDPSHTQ-MDAKTELLL
KTHY_BACSU      MSGLFITFEGPEGAGKTTVLQEIKNILTAEGLQVMATREPGGIDIAEQIREVIL-NENNILMDPKTEALL
KTHY_BACCR      MKGLFVTIEGPEGSGKTTLIKSLLPYFEQKAQKVMATREPGGIAISEDIRT-ILHKQEYTMMEARTEALL
KTHY_BACC2      MKGLFVTIEGPEGSGKTTLIKSLLPYFEQKAQKVMATREPGGIAISEDIRT-ILHKQEYTMMEARTEALL
KTHY_THET8      MPGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGG--LPEVRSLLL----TQELSPEAEYLL
KTHY_THET2      MPGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGG--LPEVRSLLL----TQELSPEAEYLL
KTHY_STRPJ      MSKGFLVLEGPEGAGKTSVLEALLPILKEKGVEVLTTREPGGVLIGEKIREVILDPSHTQ-MDAKTELLL
KTHY_EXIS2      MTGTFITVEGPDGAGKTTQLQLLADRLTAEGYEIVMTREPGGTRIGNEIRSLILNPDF-QEMDEMTEILL
KTHY_RHOSK      -QGFFLAVEGIDGSGKSGIVRSLAAHLGAEGRDVLVTREPGGTPEGEAIRGLVLAGA-DEAWDPMAELLL
KTHY_PROMS      MKGKFIVIEGIDGCGKTTQIDELSKWLPNSGLIKITTREPXXXXXXXXXXXXXXDNNKNNKPSSLAELLL
KTHY_BACWK      MKGLFVTIEGPEGSGKTTLIKSLLPYFEQKEQKVMATREPGGIAISEDIRT-ILHKQEYTMMEARTEALL
KTHY_BACHK      MKGLFVTIEGPEGSGKTTLIQSLLPYFEQKEQKVMATREPGGIAISEDIRT-ILHKQEYTMMEARTEALL
KTHY_BACCZ      MKGLFVTIEGPEGSGKTTLIQSLLPYFEQKEQKVMATREPGGIAISEDIRT-ILHKQEYTMMEARTEALL
KTHY_BACC4      MKGLFVTIEGPEGSGKTTLIKSLLPYFEQKAQKVMATREPGGIAISEDIRT-ILHKQEYTMMEARTEALL
KTHY_BACC1      MKGLFVTIEGPEGSGKTTLIQGLLPYFEQKEQKVMATREPGGIAISEDIRT-ILHKQEYTMMEARTEALL
KTHY_BACAN      MKGLFVTIEGPEGSGKTTLIQSLLPYFEQKEQKVMATREPGGIAISEDIRT-ILHKQEYTMMEARTEALL
KTHY_BACAC      MKGLFVTIEGPEGSGKTTLIQSLLPYFEQKEQKVMATREPGGIAISEDIRT-ILHKQEYTMMEARTEALL
KTHY_BACAA      MKGLFVTIEGPEGSGKTTLIQSLLPYFEQKEQKVMATREPGGIAISEDIRT-ILHKQEYTMMEARTEALL
KTHY_DESOH      ----FITLEGIEGAGKTTQLPRLVDFLEQHGHTCVVTREPGGTGMGQKIRSLLL-DPDNSDMSPETELFL
KTHY_BACC7      MKGLFVTIEGPEGSGKTTLIQGLLPYFEQKEQKVMATREPGGIAISEDIRT-ILHKQEYTMMEARTEALL
KTHY_WOLPP      ----FITFEGIDGSGKTTQSELLANYFKQNNV--VLTREPGGTDFAEKIRGSLLKDNIDPI----SELLL
KTHY_SULSY      ----FITFEGIEASGKTTQINLLYDYLKSIGKNVIKTREPGGTKIGQKIREILL-SKWDEKFPYIAELLL
KTHY_RHOS4      -QGFFLAVEGIDGSGKSGIVRSLAAHLGAEGRDVLVTREPGGTPEGEAIRGLVLAGA-DEAWDPMAELLL
KTHY_RHOS1      -QGFFLAVEGIDGSGKSGIVRSLAAHLGAEGRDVLVTREPGGTPEGEAIRGLVLAGA-DEAWDPMAELLL
KTHY_LISW6      MKAIFITLEGPDGSGKTTVGTLLNQKMEEAGIDFIKTREPGGSPISEKVRNIVL-GIGNEEMDPKTEVLL
KTHY_BACC3      MKGLFVTIEGPEGSGKTTLIQSLLPYFEQKEQKVMATREPGGIAISEDIRT-ILHKQEYTMMEARTEALL
KTHY_BACAH      MKGLFVTIEGPEGSGKTTLIQSLLPYFEQKEQKVMATREPGGIAISEDIRT-ILHKQEYTMMEARTEALL
KTHY_ANASP      MGGRFIVFEGVEGCGKTSQMQLCAEWLQSLGISVVLTREPGGTEXXXXXXXXXXQKAEDKPIAEVTELLL
KTHY_STAES      --STFITFEGPEGAGKTSVIKKVSERLAKE-YDIVTTREPGGVLTSEEIRRIVLDG---DSIDIRTEAML
KTHY_STAEQ      --STFITFEGPEGAGKTSVIKKVSERLAKE-YDIVTTREPGGVLTSEEIRRIVLDG---DSIDIRTEAML
KTHY_LISIN      MKAIFITLEGPDGSGKTTVGTLLNQKMEEAGIDFIKTREPGGSPISEKVRNIVL-GIGNEEMDPKTEVLL
KTHY_BRASO      -RGRFVTFEGGEGAGKSTQIKMLADRLEKDGVRVVLTREPGGSPGAEIMRHLVLSGM-GKLLGAEAETLL
KTHY_NITHX      LRGRFITFEGGEGSGKSTQINILAERLNAAKLRAIVTREPGGSPGAEIIRHLVLSGM-GKLLGAYAETLL
KTHY_CHRSD      ---RFITLEGGEGVGKSTNVAFVCDWLSARGIEVVRTREPGGTPRAEAIRELLLDPAPQEPLDETAELLL
KTHY_ACISJ      ----FITFEGIDGAGKSSHIDALAQALRAAGHTVALTREPGGTPLAEKLREMLLHDSMD----ALTEALL
KTHY_GEOKA      MNGCFFSFEGPEGAGKTTMISKLESLLRERGIDVVATREPGGVRIAEAIRSIILNRDYTE-MDGRTEALL
KTHY_SYNPW      MKGRFLVLEGIDGCGKTTQLRQLAEWLPDSGLATLHTREPGGTPLGRALRELLLHXXXXXXXXXXXXLLM
KTHY_STRP3      ---KLITVEGPDGAGKTTVLEQLIPLLKQKVAQEILTREPGGVAISEYIRELILHTTMDPK----TELLL
KTHY_SYNPX      MSGRFIVLDGIDGCGKSTQLDHLLGWLPGSGLMPISTREPGGTPLGRSVRELLLHTRAEQAPAPTAELLL
KTHY_STRE4      -RGKLITFEGPDGAGKTTVLERLVPLLQAAGQTIVTTREPGGVAIAEKIRQLILHTTMDDK----TELLL
KTHY_PYRFU      ----FIVLEGIDGSGKTTQARLLARWFEDNGFKVVLTKEPTDTEFGKIIRKLVLEGSIIDRISLEAEALL
KTHY_PROM9      MKGKFIVIEGIDGCGKTTQINELSKWLPKSGLIKITTREPXXXXXXXXXXXXXXDNNKTNKPSSLAELLL
KTHY_DESVM      ----FITFEGMEGSGKSTALNRVQQVLLDAGHGVLLTREPGGSRLGRTLRSILLDLSNDD-IVPEAELFL
KTHY_STRS7      -RGKLITFEGPDGAGKTTVLERLVPLLQAAGQTIVTTREPGGVAIAEKIRQLILHTTMDDK----TELLL
KTHY_STRPZ      ---KLITVEGPDGAGKTTVLEQLIPLLKQKVAQDILTREPGGVAISEHIRELILHTAMDPK----TELLL
KTHY_PSEE4      MSGLFITLEGPEGAGKSTNREYLAARLREQGVDVVMTREPGGTPLAERIRELLLAPS-EEAMAVDTELLL
KTHY_LEUMM      ----FISFEGPEGAGKTSVLALISELKTKLGDDLVTTREPGGNPISEAIRS-ILQPEEDNGMDKRTEALL
KTHY_WOLTR      ----FITFEGIDGSGKTIQSELLANYFKQNNM--VLTREPGGTDFAEKVRGILLKDSIDPV----SELLL
KTHY_STRP1      ---KLITVEGPDGAGKTTVLEQLIPLLKQKVAQDILTREPGGVAISEHIRELILHTAMDPK----TELLL
KTHY_LEUCK      ----FITFEGPEGAGKTSVLEALVSELKPIGDQLVTTREPGGNPISEAIRQ-ILQPEDDNGMDDRTEALL
KTHY_LACCB      MTGTFITFEGPDGAGKTSVLKTLIPQLEQHVRVPLHTREPGGAKISETIREVIL-DPANTAMDARTEALL
KTHY_LACC3      MTGTFITFEGPDGAGKTSVLKTLIPQLEQHVRVPLHTREPGGAKISETIREVIL-DPANTAMDARTEALL
KTHY_DESVV      ----FITFEGIEGSGKSTALQGLAAWLQQHGHGVAVTREPGGSRLGRTLRSILL-DLGNTDITPEAELFL
KTHY_DEIRA      -QGLFITLEGPEGAGKTTQXXXXXXXXXXXGHAVTVTREPGGTPLGTRVREVVLDPAV--EIEPLGEFLL
KTHY_DEHSB      --SLFITFEGGEGCGKSTQSKALYRYLKKKGLGCVLTHEPGGSKSGDKITRLLKWSK-EEHISPLTELLL
KTHY_DECAR      MKGKFITFEGIDGAGKSSHVEWLAGLLRQRGIVVHVTREPGGTELGEKLRELLLN----EPMHLETETLL
KTHY_STRP6      ---KLITVEGPDGAGKTTVLEQLIPLLKQKVAQEILTREPGGVAISEYIRELILHTAMDPK----TELLL
KTHY_PROM0      MKGKFIVIEGIDGCGKTTQIDELSKWLPKKESKLITTREPXXXXXXXXXXXXXXDNNENNKPSSLAELLL
KTHY_POLSJ      MHGLFISFEGIDGAGKSTHIAGLADAFRAQGRAVTLTREPGGTPLAEKLRDLVLNDAMD----SLTEALL
KTHY_DESVH      ----FITFEGIEGSGKSTALQGLAAWLQQRGHGVAVTREPGGSRLGRTLRSILL-DLGNTDITPEAELFL
KTHY_BACLD      MNGLFITFEGPEGAGKTTILQAAADQLTKNGHSVLATREPGGIEISERIREVIL-NPSHTAMDPKTEALL
KTHY_ACAM1      MLGKFIVFEGGEGAGKTTQLNLVKGYIQGDYPSVLTTREPGGTALGKSIRKLLLDVTANESIDERAELLL
KTHY_STRPG      ---KLITVEGPDGAGKTTVLELIPPLKQKVAQEILTTREPGGVAISEYIRELILHTTMDPK----TELLL
KTHY_STRP8      ---KLITVEGPDGAGKTTVLELIPPLKQKVAQEILTTREPGGVAISEYIRELILHTTMDPK----TELLL
KTHY_RALME      MRGKFITFEGIDGAGKSTHIEWVAERL-RARANVVTTREPGGTPLGEDLRQLLLHRK----MHLETEALL
KTHY_MESSB      ----FITFEGGEGAGKSTQIHLLADRLRREGRDVLTTREPGGSPGAEAIRHVLLSGAA-EPFGATLEAIL
KTHY_LISMO      MKAIFITLEGPDGSGKTTVGTLLNQKMTEAGIDFIKTREPGGSPISEKVRNIVL-GIGNEEMDPKTEVLL
KTHY_LISMH      MKAIFITLEGPDGSGKTTVGTLLNQKMTEAGIDFIKTREPGGSPISEKVRNIVL-GIGNEEMDPKTEVLL
KTHY_RICAE      -QGKFITFEGGEGIGKSTQSQMLYEYLQSQNTPVILTREVGGTIVAEKMREILVH----EELLPISELLQ
KTHY_PSEAE      MTGLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPS-DEPMAADTELLL
KTHY_PSEA8      MTGLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPS-DEPMAADTELLL
KTHY_NEOSM      ----FIVLEGIDGSGKSTQVKLLSKFLAKDGYPCVLTREPGGTSFAESLRSMILHDPIDPM----ARLLL
KTHY_LISMF      MKAIFITLEGPDGSGKTTVGTLLNQKMTEAGIDFIKTREPGGSPISEKVRNIVL-GIGNEEMDPKTEVLL
KTHY_LISMC      MKAIFITLEGPDGSGKTTVGTLLNQKMTEAGIDFIKTREPGGSPISEKVRNIVL-GIGNEEMDPKTEVLL
KTHY_DEHSC      --SLFITFEGGEGCGKSTQSKALYRYLKKLGLGCVLTHEPGGSKSGDKITRLLKWSK-EEHISPLTELLL
KTHY_BACA2      MSGLFITFEGPEGAGKTTVLQEMKEILSAEGLPVTATREPGGIDIAEQIREVIL-NKNNTLMDAKTEALL
KTHY_PSEA7      MTGLFVTLEGPEGAGKSTNRDYLAERLRERGVEVQLTREPGGTPLAERIRELLLAPS-DEPMAADTELLL
KTHY_NOSP7      MGGKLIVFEGVEGCGKTSQMQLCSQWLESLGVSVVVTREPGGTEXXXXXXXXXXEKAEDKPVAEVTELLL
KTHY_STRTD      -----ISIEGPDGAGKTSVLKVLLPRLREVYPAVITTREPGGVAIAEQIREVILDID-NTAMDAKTELLL
KTHY_STRT2      -----ISIEGPDGAGKTSVLKVLLPRLREVYPAVITTREPGGVAIAEQIREVILDID-NTAMDAKTELLL
KTHY_STRT1      -----ISIEGPDGAGKTSVLKVLLPRLREVYPAVITTREPGGVAIAEQIREVILDID-NTAMDAKTELLL
KTHY_STAAW      --SAFITFEGPEGSGKTTVINKVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVLEGN-DMDIRT--EAML
KTHY_STAAS      --SAFITFEGPEGSGKTTVINKVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVLEGN-DMDIRT--EAML
KTHY_STAAR      --SAFITFEGPEGSGKTTVINEVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVLEGN-DMDIRT--EAML
KTHY_STAAN      --SAFITFEGPEGSGKTTVINEVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVLEGN-DMDIRT--EAML
KTHY_STAAM      --SAFITFEGPEGSGKTTVINEVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVLEGN-DMDIRT--EAML
KTHY_STAAC      --SAFITFEGPEGSGKTTVINEVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVLEGN-DMDIRT--EAML
KTHY_STAAB      --SAFITFEGPEGSGKTTVINEVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVLEGN-DMDIRT--EAML
KTHY_STAA9      --SAFITFEGPEGSGKTTVINEVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVLEGN-DMDIRT--EAML
KTHY_STAA8      --SAFITFEGPEGSGKTTVINEVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVLEGN-DMDIRT--EAML
KTHY_STAA3      --SAFITFEGPEGSGKTTVINEVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVLEGN-DMDIRT--EAML
KTHY_STAA2      --SAFITFEGPEGSGKTTVINEVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVLEGN-DMDIRT--EAML
KTHY_STAA1      --SAFITFEGPEGSGKTTVINEVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVLEGN-DMDIRT--EAML
KTHY_RICBR      -QGTFITFEGGEGIGKSTQCQMLYEYLKSQNIPVILTREVGGTNVAEKMREILVHT----DLLPMSELLQ
KTHY_LACRJ      MDGKFISFEGPDGAGKTSVXXXXXXXXXXGTEKVMYTREPGGNKISEQIRQ-VLFDGQNTDMDGRTEALL
KTHY_LACRD      MDGKFISFEGPDGAGKTSVXXXXXXXXXXGTEKVMYTREPGGNKISEQIRQ-VLFDGQNTDMDGRTEALL
KTHY_RICCN      -QGKFITFEGGEGIGKSTQSQMLYEYLQSQNTPVILTREVGGTIVAEKMREILVH----EELLPMSELLQ
KTHY_RICB8      -QGTFITFEGGEGIGKSTQCQMLYEYLKSQNIPVILTREVGGTNVAEKMREILVHT----DLLPMSELLQ
KTHY_PROMA      MKGIFLVLEGIDGCGKSTQIEHLAQWLPLSGLMPFITREPGGTRLGKSLRQLLLGTSTDESPKPLTELLL
KTHY_DEHE1      --SLFITFEGGEGCGKSTQSKALYRYLKKLGLGCVLTHEPGGTRSGDKITRLLKWSE-EENISPLAELFL
KTHY_STAHJ      --SAFITFEGPEGSGKTTVLQRVSEKLAQD-YQLIATREPGGVPTGEEIRKVVLEGA---NMDIRTEAML
KTHY_RICM5      -QGKFITFEGGEGIGKSTQSQMLYEYLQSQNTPVILTREVGGTIVAEKMREILVH----EELLPMSELLQ
KTHY_PELPD      ----FITFEGIEGSGKTTQIGLLGEQLESLGYSVVMTREPGGCAISDKIRSILL-DADNSSISPMTELLL
KTHY_LACSS      MVGKLITFEGPDGAGKTSALEAVVARLQKESQEIVVTREPGGNPISEQIRQIILDVK-NTAMDDRTEALL
KTHY_THEMA      ----FITFEGIDGSGKSTQIQLLAQYLEKRGKKVILKREPGGTETGEKIRKILL----EEEVTPKAELFL
KTHY_ROSS1      --SLFVTFEGPEGSGKSTQARLLYESLHARRFPVILTREPGGTRIGDLIRRIVLDLQHTE-MAPTAEMLL
KTHY_RICTY      -QGKFITFEGMDGIGKSTQSKMLYEYLKSQKIPVILTREVGGTFVAEKMREILVH----EELLPMSELLQ
KTHY_PSEAB      MTGLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPG-DEPMAADTELLL
KTHY_LACF3      MSGRFISFEGPDGAGKTSVLTAIRTGLV-NQLGVVYTREPGGNPIAEQVRAVLL-DKQNGAMDDWTEALL
KTHY_MYCGE      ----FVVIEGVDGAGKTALIEGFKKLYPTKNYQLTYTREPGGTLLAEKIRQLLLN----ETMEPLTEAYL
KTHY_RICFE      -QGKFITFEGGEGIGKSTQSQMLYEYLKSQNTPVILTREVGGTAVAEKMREILVH----EELLPMSELLQ
KTHY_OLICO      -RGRFITFEGGEGSGKSTQIQLLAERLKGQGIETLVTREPGGSPGAEIVRHLLLSG-VGKLLGADAETLL
KTHY_THESQ      ----FITFEGIDGSGKSTQIQLLAQYLEKRGKKVILKREPGGTETGEKIRKILL----EEEVTPKAELFL
KTHY_RICRS      -QGKFITFEGGEGIGKSTQSQMLYEYLQSQNTPVILTREVGGTIVAEKMREILVH----EELLPMSELFQ
KTHY_RICRO      -QGKFITFEGGEGIGKSTQSQMLYEYLQSQNTPVILTREVGGTIVAEKMREILVH----EELLPMSELFQ
KTHY_MYCGA      ----FIVIEGVDGSGKS---SFLKRMMNENSQPIIYSREPGGCDTSEAVRELIMKLSNSDPL---TEALL
KTHY_SILPO      ----FLTFEGIDGSGKSTQARLLAETLRAAGHDVVLTREPGGSPGAEEIRRLVLEGDPD-RWSAETEILL
KTHY_RICPR      -QGKFITFEGVDGIGKSTQSKMLYEYLKSQKIPVILTREVGGTTVAEKMREILVN----EELLPMSELLQ
KTHY_HALHL      ----FITVEGLEGAGKTTCLQAIEQMLLEAGIRPLFTREPGGTPFGEALRGALLDPQY-RGLTAEAEALT
KTHY_DICNV      MRGKFICLDGTEGSGKSSQIQAICSFLQQHGKTVITTREPGGTQIGEAIRELVLSPHYQPQ--ALTELLL
KTHY_BDEBA      ---KFIVFEGLDGSGKSSLMAALERELQNRAINFLRTREPGGTPLGDEIRNMIL-RKEGPAPTPRTELLL
KTHY_ACIAC      ----FITFEGIDGAGKSSHIEAVAEALXXXXXXXXXXXXPGGTPLAETLRSLLLNEAMD----ALTESLV
KTHY_RICPU      -QGKFITFEGGEGIGKSTQSQMLYEYLQSQNTPVILTREVGGTIVAEKMREILVH----EELLPMSELLQ
KTHY_NITWN      -RGRFITFEGGEGSGKSTQIRILAERLQAAKLRAIVTREPGGSPGAEIIRHLVLSG-VGKLLGADAETLL
KTHY_AYWBP      ----FISFEGCEGTGKTTHSSYLFEKLSKK-YSCVLTKEPGGGLFNEVIRNILLHS-YNKQIDFHTEALL
KTHY_OENOB      ----FITIEGPDGAGKTSLLDNLMPALRDDNL--IETREPGGVRISEAIRKIVLGLKYPE-MNRRTEALL
KTHY_THEP1      ----FITFEGIDGSGKSTQIKLLARYLEKRGKRVILKREPGGTETGEKIRKLLL----KEEMTPKAELFL
KTHY_RICCK      -QGKFITFEGGEGSGKSTQSQMLYEYLKSQNTPVILTREVGGTIVSEKMREILVH----EELLPMSELLQ
KTHY_CHLTE      -----ISFEGIDGAGKSTQVMKLKRYLQERGREVLALREPGGTPVAXXXXXXXXXXXND--ITPVGELLL
KTHY_RHOFD      ----FISFEGIDGAGKSTHIDALAQAFRAQGRAVTLTREPGGTPLAEKLRVLVLNDAMD----AMTEALL
KTHY_DINSH      ---RLISFEGIDGSGKSTQARRLAEHLRDTGRDPLLTREPGGSPGAEDIRRLLVEGDPDRW-SPETELLL
KTHY_LACPL      LTGKLVTFEGPDGAGKTSALNIVAKLQPQLGDRLVVTREPGGNQISEAIRKIIL-DRHNTAMDDRTEALL
KTHY_JANSC      MPPLFISLEGIDGSGKSTQTARLVDWLRVRGRDPLQTREPGGSEGAEEIRRLLVEGDPD-RWSAETEILL
KTHY_PROMT      MKGKFIVFEGIDGSGKTTQINQLSKWLISSDLIPVITREPGGTKLGKSIRSLLLDTSIEKSPDSITELLL
KTHY_MYCMO      ----FISFEGIDGAGKSTIIXXXXXXXXXXXXXXVFTREPGGKKLAEKIRKILLDKKTN--IDPMTETLL
KTHY_RHOPB      -RGRFITFEGGEGAGKSTQIKLLAERLNAGRIRCVLTREPGGSPGAEIIRHMXXXXXXXXXXXTEAETLL
KTHY_BRAJA      -RGRFITFEGGEGTGKSTQIKKLADRLKAARMRTLVTREPGGSPGAEIMRHLVLSGM-GKLLGPEAETLL
KTHY_ACHLI      ----FITFEGGEGSGKTTLIEKLKHTLLEKKYDVLTTREPGGSKVAEKIRSVLLDNK-NTEITAHTEALL
KTHY_BARQU      MSGYFITFEGGEGVGKTTQISLLAQYLRNQGYDVLTTREPGGTVGAEAIRHILLSGQA-QNYGPLIEVIL
KTHY_RICAH      -QGKFITFEGGDGIGKSTQAQMLYEYLKSQNTHVILTREVGGTAVAEKMRAILVH----ESLLPMSELLQ
KTHY_GEOUR      ----FITFEGVEGCGKTTQIKLLAQHLTEQGHTVIVTREPGGCPIADQARAILL-DADNRAMTPTTELLL
KTHY_PROM1      MKGKFIVFEGIDGSGKTTQINQLSKWLISTDLIPVITREPGGTQLGKSIRSLLLDTSIEKSPDSITELLL
KTHY_GEOSF      ----FITFEGIEGCGKTTQIKLLEQHLAEKGFKVLLTREPGGCPIADQIRAILL-DAANSAMTPSAELLL
KTHY_EHRRW      ----FITFEGIDGSGKTTQSRLLTEYLSGDNV--ILTREPGGTFFNESVRNLLFSTKNLDKL---SELLF
KTHY_EHRRG      ----FITFEGIDGSGKTTQSRLLTEYLSGDNV--ILTREPGGTFFNESVRNLLFSTKNLDKL---SELLF
KTHY_TERTT      MTGRFITVEGTEGVGKSTNLAFIEGFLRSRAIDVITTREPGGTPXXXXXXXXXXXXXXXP-VDACAELLM
KTHY_EHRCR      ----FITFEGIDGSGKTTQSHLLAEYLSENNV--VLTREPGGTLLNESVRNLLFKA---QGLDSLSELLF
KTHY_DESAP      MSGVFIVFEGIDGAGKTTQLAYLHELLSMRNHRVLVTREPGGTRIGEAVRRVLLDTG-NSEMTGETEALL
KTHY_PROMM      MSGRFLVLEGIDGCGKTTQLRHLANWLPRSGLARLHTREPGGTALGIALRKLVLHPPGDXXXXXXXXXXX
KTHY_HELHP      ----YVAIEGVDTCGKSTQIQLLKAYYPQ----AVFTKEPGGSIIGEHIRDLVLFKKYGFTLDERAELML
KTHY_CYAP4      MKGKLIVFEGGEGSGKTTQLQRSRQWLESSGWLALVTREPGGTALGIKLRQLLLNSDPEDVIQSRTELLL
KTHY_CAUCR      -QGFFISFEGGEGAGKSTQIRRLADRLKAAGHDVIVTREPGGSPGAEAIRELLVNGAADRWSPVTESLLM
KTHY_ROSCS      --SLFVTFEGPEGSGKSTQARLLYESLYARRYPVILTREPGGTRIGDLIRRIVLDLQHTE-MAPTTETLL
KTHY_ONYPE      ----FISFEGCEGTGKTTHSRYLFEKLSKK-YSCVLTKEPGGGLFNEVIRNILLHSS-NKQIDFHTEALL
KTHY_BRASB      -RGRFVTFEGGEGAGKSTQIKMLAARLESEGMRVVLTREPGGSPGAEIMRHLVLSGM-GKLLGAEAETLL
KTHY_BORPE      -RGRFITLEGVDGAGKSTHTAWMVQALRDLGLTVLATREPGGTPVGEKLRELLL----SEPMALETETLL
KTHY_BORPA      -RGRFITLEGVDGAGKSTHTAWMVQALRDLGLTVLATREPGGTPVGEKLRELLL----SEPMALETETLL
KTHY_BORBR      -RGRFITLEGVDGAGKSTHTAWMVQALRDLGLTVLATREPGGTPVGEKLRELLL----SEPMALETETLL
KTHY_PROM3      MSGRLLVLEGIDGCGKTTQLRHLANWLPRSGLARLHTREPGGTALGMALRKLVLHPPGDXXXXXXXXXXX
KTHY_CHLFF      ----FIVIEGCEGSGKSSLTELLKNRLITEGKSVIATREPGGSPLGEQVRNWIL-NPSLPGISPYTELFL
KTHY_WOLPM      ----FITFEGIDGSGKTTQSKLLANHFKQNNV--VLTREPGGTNFAEKVRGVLLTNNXXXXXXXXXXXXM
KTHY_PYRAB      MRGYFVVLEGIDGSGKTTQAKLLAEWFEEQGWDVLLTKEPTDTEFGRLIRELVLKNSIGSRISYEAEALL
KTHY_MYCHJ      ----FISFEGIDASGKSTVMDLFAKYLKIKEKEIVTTFEPGGKNLKEALQIREFLLSKNNQISPYVEMLL
KTHY_MYCH2      ----FISFEGIDASGKSTVMDLFAKYLKIKEKEIVTTFEPGGKNLKEALQIREFLLSKNNQISPYVEMLL
KTHY_EHRCJ      ----FITFEGIDGSGKTTQSHLLTEYLSKNNV--VLTREPGGTLLNEAVRDLLFQAK---GLDSLSELLF
KTHY_AKKM8      -KGRLIVFEGIDGTGKSTHIGHLRKYLEEKELEVVQSFEPTRGRWGRMLRDSAVTGRLSVE----EEVAL
KTHY_MYCPN      -QGVFVAIEGVDGAGKTVLLEAFKQRFPQSFLGTLFSREPGGTPLAEKIRALLLH----EAMEPLTEAYL
KTHY_CHLAB      ----FIVIEGCEGSGKSSLTQLLKDKLMAEGKAVVATREPGGSSLGERVRDWIL-DPSTTELSPYTELFL
KTHY_CHLMU      ----FIVVEGGEGAGKTQFTQALSKRLMEEGKEVVLTREPGGSALGEQLRDLVLD--VTQEISSYAELLL
KTHY_CHLCV      ----FIVIEGCEGSGKSSLTELLKDRLIAEGKAVVATREPGGSPLGERVRDLILEPS-TPSISPYTELFL
KTHY_RHOPA      LRGRFITFEGGEGAGKSTQIXXXXXXXXXXXXXTLVTREPGGSPGAEAIRSXXXXXXXXXXXXXXXXXXX
KTHY_DESAH      ----FITLEGIEGSGKTTQIKPLVDCLGQNGYEAVVTREPGATVIGKKIRAILL-DPGNSGMSDLCELFL
KTHY_MAGSM      MQGRFITFEGGEGAGKSTQIAQLTQSLQAHGVKVLCTREPGGCPISERIREILVTGQGD-DLDGTSELLL
KTHY_CHLPN      ----FIVIEGGEGSGKSSLAKALGDQLVAQDRKVLLTREPGGCLIGERLRDLILEPPH-LELSRCCELFL
KTHY_COPPD      ----FIVVEGIDGCGKSTVASLLAAEIGKKR-PVFHTFEPGHVRDGL-YRELIMENVDNPFVVA----AL
KTHY_RHOPT      LRGRFITFEGGEGAGKSTQIXXXXXXXXXXXXXTLVTREPGGSPGAEAIRSXXXXXXXXXXXXXXXXXXX
KTHY_MYCH7      ----FISFEGIDASGKSTVMDLFAKYLKIKEKDIVTTFEPGGKNLKEALLIREFLLSKNNQISPYVEMLL
KTHY_BARHE      MSGYFITFEGGEGVGKTTQIFLLAQHLYGKGYDVLTTREPGGTAGAEVIRHILLSGQVQQHYGPLIEAIL
KTHY_LEIXX      ----FITLEGGDGVGKSTQAALLERWLLGLGRAVVRTREPGGTDLGAEIREIVLHRRGD--IAPRAEALL
KTHY_GLUOX      ----FITLEGGEGAGKSTQXXXXXXXXXXXGHKVLLTREPGGTPGAEEIRNLLLFGKVD--LSWRAEILM
KTHY_GEOLS      ----FITFEGIEGCGKSTXXXXXXXXXXXXXXRVLLTREPGGCPIADQIRSVLL-DAANTALVPMAELML
KTHY_AQUAE      -----IAFEGIDGSGKTTQAKKLYEYLKQKGYFVSLYREPGGTKVGE----VXXXXXXXXXXXXXXXXXX
KTHY_HERA2      --SLFITFEGPEGSGKSTQARYLKDYLQQAGYPVILTREPGGTPISDAVRRLVLDGQW-TAMEPTTETLL
KTHY_CLAMS      MTGVFITLEGGDGVGKSTQSALLREWLEEQGHEVVVTREPGGSDLGQEIREIVLHRR--GHIAPRAEALL
KTHY_SYNAS      ----FISFEGIEGCGKTTQLKLAAQYLRTLKIPVXXXXXXXXXXLGKKIRNILL-NRGPFEICAEAETLL
KTHY_RHOBA      ---RLITLDGIDGVGKSSQIEILAERLRSEGRNVLCVRDPGSTDLGTKLRAMLLDS--DLEMHRRTEAML
KTHY_RHILO      ----FITFEGGEGAGKSTQIERLARKMHAKKYDVLLTREPGGSPGAEAVRHVLLSGAA-EPFGPKMEALL
KTHY_GEOSL      ----FITFEGIEGCGKTTQIKRAAQSLREAGHRVVVTREPGGCPIADDIRAILL-DAGNSAMVPTTELLL
KTHY_BRUSU      MSGLFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGSPGAEAIRHVILSGNA-ETYGPXXXXXX
KTHY_BRUSI      MSGLFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGSPGAEAIRHVILSGNA-ETYGPXXXXXX
KTHY_BORPD      -RGRFITLEGVDGAGKSTHAAWLADALRDMGRTVVATREPGGTPLGETLRGLVL----SESMTLDTETLL
KTHY_AGRT5      ----FISFEGGEGAGKSTQIRTLAEALRGRGFEVVVTREPGGSPGAEAVRHVILSGAA-ESFGVRMEAIL
KTHY_THERP      --SWFITFEGPEGAGKTTQCALLAARLREAGYSLLVTREPGGTPLGETIREWLLAG---EALRPETEALL
KTHY_GEOBB      ----FITFEGIEGCGKTTQLRLLKERLEAAGEKVTVTREPGGCPVADQMRAILLDAK-NSAITPXXXXXX
KTHY_BRUO2      MSGLFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGSPGAEAIRHVILSGN-AETYGPXXXXXX
KTHY_BRUME      MSGLFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGSPGAEAIRHVILSGN-AETYGPXXXXXX
KTHY_BRUMB      MSGLFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGSPGAEAIRHVILSGN-AETYGPXXXXXX
KTHY_BRUC2      MSGLFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGSPGAEAIRHVILSGN-AETYGPXXXXXX
KTHY_BRUA1      MSGLFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGSPGAEAIRHVILSGN-AETYGPXXXXXX
KTHY_PYRHO      MRGYFIVLEGIDGSGKTTQAKLLAEWFEDKGYEVLLTKEPTDSELGKLIRRIILEESVIDKISYEAEALL
KTHY_PELTS      MKGKFIVFEGVDGSGKTTQIKLLGEKLESMGCPVVYTREPGGTRVGERIREILLNPLYGELVPWXXXXXX
KTHY_CLAM3      MTGVFITLEGGDGVGKSTQSALLRGWLEDEGHEVVVTREPGGSELGVEIREIVLHRR--GHIAPRAEALL
KTHY_THEON      ----FIVIEGIDGAGKSTQARLLAEWFKKKGYDVVLTKEPTDTAFGKLIRRLVLTGGKEARISHEAEALL
KTHY_PYRKO      ----FIVLEGIDGAGKSTQAKLLAEWFENRGYEVVLTKEPTDTPFGKLIRRLVLTGGKEAKISHEAEALL
KTHY_METBF      MRGKLITLEGIDGSGKSTVAEKLQKNPEIKAFKPVFTREP--------TRGTLTGDAVEKAIQSDTELFL
KTHY_CAMC1      ----YVLFEGIDGVGKSTQIEILASKFSD----AIVTKEPGGTQLGVNLREILLRSSI--KIGKRAEILL
KTHY_ANAMM      ----FITFEGIDGCGKTTQAVLLAKYLSDGEHRVVLTREPGGTSLNELIRGALL-GLTDYKLDGITELML
KTHY_ANAMF      ----FITFEGIDGCGKTTQAVLLAKYLSDGEHRVVLTREPGGTSLNELIRGALL-GLTDYKLDGITELML
KTHY_MYCS5      ----FITFEGLDGSGKTTVINEXXXXXXXXXXXXXYTREPGGKDISEKIREMILDS--DLEFSPITEALL
KTHY_GEOSM      ----FITFEGIEGCGKTTQLRLLKERLVALGEKVTVTREPGGCPVADQMRAILLDAK-NSAITPXXXXXX
KTHY_THESM      ----FIVLEGIDGAGKSTQAKMLAKWFENRGYEVVLTKEPTDTAFGKLIRRLVLIGGKEARISKEAEALL
KTHY_CAMC5      ----YVLFEGVDGVGKSTQIEMIARAHEDS----LVTKEPGGTKIGQKLREILLGG--DFKLSARAEILL
KTHY_LACBA      MSGTFISFEGPDGAGKTSALQAITTQIKPVGDQLVITREPGGNPISESIRAIIL-DRANTAMDYRTEALL
KTHY_CHLTB      ----FIVVEGGEGAGKTQFIQALSKRLIEEGREIVTTREPGGCSLGDSVRGLLLDP--EQKISPYAELLL
KTHY_CHLT2      ----FIVVEGGEGAGKTQFIQALSKRLIEEGREIVTTREPGGCSLGDSVRGLLLDP--EQKISPYAELLL
KTHY_ANAPZ      ----FITFEGIDGCGKTTQSILLAKYMSEDNV--VLTREPGGTSFNELLRSVFL-SVSDYKVDKLTELFL
KTHY_PYRCJ      ----FIAVEGIDGSGKTTVIAEVAKALPR----VYVTREPSGGPIGRLLKEWALRGGTADP-HVDA--LL
KTHY_ORITI      ---KFITFEGNEGSGKTTQSKLLYEKLLDNGIKAVWTREIGGTDIAELIRDIVLF----KDMSITTELLL
KTHY_ORITB      ---KFITFEGNEGSGKTTQSKLLYEKLLDNGIKAVWTREIGGTDIAELIRDIVLF----KDMSITTELLL
KTHY_METAC      MRGKLITLEGIDGSGKSTVAKKLQENSELRVFEPVFTREP--------TRGTLTGNAVENAIQSDTELFL
KTHY_RHIME      ---------------KSTQMRLLAEALSARGYRVLTTREPGGSVGAEAVRHVLLSGAA-ESFGVRMEAIL
KTHY_PYRAE      ----FVAIEGIDGSGKSTVISLLEKKLPR-----VYTREPSSGPIGRLIKEWALKGG---SVDPHVDALL
KTHY_CHLTR      ----FIVVEGGEGAGKTQFIQALSKRLIEEGREIVTTREPGGCSLGDSVRGLLLDP--EQKISPYAELLL
KTHY_CHLTA      ----FIVVEGGEGAGKTQFIQALSKRLIEEGREIVTTREPGGCSLGDSVRGLLLDP--EQKISPYAELLL
KTHY_THEGJ      ----FVVIEGIDGAGKSTQAKLLAKWFEKKGYEVILTKEPTDTAFGKLIRKLVLTGGREARISHEAEALL
KTHY_LAWIP      ----FITIEGIEGSGKTTLINRLSEYFSSRGEDVIVTREPGGCEXXXXXXXXXXXXXXXXT--AESELFL
KTHY_TROWT      ----FVTFEGIDGSGKTAQLTAAGEFLKASGKQVVLTREPGTISC---IRDYVLASDMDIR----TEALL
KTHY_TROW8      ----FVTFEGIDGSGKTAQLTAAGEFLKASGKQVVLTREPGTISC---IRDYVLASDMDIR----TEALL
KTHY_ARCFU      -----IAVEGIDGAGKTTIAAYIAELLKEKGYKVKVLKEPGDSKFGKKIK------XXXXXXXXXXXXXX
KTHY_BRAHW      MKGKLIVLEGIDGSGKSSIGMMLTDILNNIGIKSIYTFEPTHAYYGSKLRESML----SKDLTPEEELSL
KTHY_METBU      MKGKLITLEGIDGSGKSTITRFLNSHPAFAN--AVFTKEPTTSWIGD-----AVYKAIQSDTDELAELML
KTHY_CAMJR      ----YVVFEGIDCVGKSTQISLLKEIYKD----AIFTLEPGGTELGKHLREILLNKTH--PINKRAELLL
KTHY_CAMJJ      ----YVVFEGIDCVGKSTQISLLKEIYKD----AIFTLEPGGTELGKHLREILLNKTH--PINKRAELLL
KTHY_CAMJE      ----YVVFEGIDCVGKSTQISLLKEIYKD----AIFTLEPGGTELGKHLREILLNKTH--PINKRAELLL
KTHY_METMA      MRGKLITLEGIDGSGKSTVAKKIQENPEIQVFDPVFTREPTGT-----LTGTAVENAIQSETDQLAELFL
KTHY_MYCPU      ----FITFEGIDASGKTSLLAKLKAHVVQKNLQGTFTWEPGGRKSPETIRHLILNK--ESNLSPIAEAFL
KTHY_CAMJ8      ----YVVFEGIDCVGKSTQISLLKEIYKD----AIFTLEPGGTELGKHLREILLNKTH--PISKRAELLL
KTHY_UREPA      ----FIVFEGIDGAGKTSILKQLLEVLKEPKLVIFLTREPGGNNAAEMIREFFLKNL---EVFDPLTLAY
KTHY_UREP2      ----FIVFEGIDGAGKTSILKQLLEVLKEPKLVIFLTREPGGNNAAEMIREFFLKNL---EVFDPLTLAY
KTHY_CAMJD      ----YVVFEGIDCVGKSTQISLLKEIYKD----AIFTLEPGGTELGKHLREILLNKTH--PISKRAELLL
KTHY_DESDA      ----FVTFEGIEGAGKSTAIDYLSDYLQARGHDPVLTREPXXXXXXXXXXXXXXDVRTGG-LASRAELFL
KTHY_HELPH      ----YVVLEGVDGVGKSTQVGLLKDRFKN----ALFTKEPGGTKMGESLRHIAL----NENISELARAFL
KTHY_VEREI      ----FISFEGIDGAGKSSHVEGLAAAFRAQGRRVTVSREPGGTPXXXXXXXXXXXXXMD----ALTESLL
KTHY_HELPG      ----YVVLEGVDGAGKSTQVELLKTRFKN----ALFTKEPGGTRMGESLRHIAL----NENISELARAFL
KTHY_CAMFF      --------EGVDGVGKSTQISLLKEF--RND--AVITKEPGGTEFGLMVRDYLLKNA--SKISNKTEIFL
KTHY_HELP2      ----YVVLEGVDGAGKSTQVGLLKNKFKN----ALFTKEPGGTKIGESLRRIAL----NENISELARAFL
KTHY_SPHWW      MPGRFITLEGGEGVGKSTQXXXXXXXXXXXGLDVVETREPGGSDGAEAIRRLLLEGAADRW-NXXXXXXX
KTHY_MYCPE      ----FVAFEGPDACGKSTVSKLVYQKLINNKDSVILTREPGGTEVGEKIREILVN--YD--IDPRTEALL
KTHY_CAMHC      -----IFFEGIDGVGKSTQIELLKSVYNKNYL---ITKEPGGTLLGEKLREILLES--DFKISKTAELFL
KTHY_HELAH      ----YVVLEGIDGVGKSTQIELLKSAFQN----ALFTKEPGGTKIGETLRHIALH----ENLSELARAFL
KTHY_HELPY      ----YVVLEGVDGAGKSTQVELLKDRFKN----ALFTKEPGGTRMGESLRRIAL----NENISELARAFL
KTHY_SULDN      ----YIAIEGIDTAGKSTQIAKLQEHFSD----AIITKEPGGTEAGKEIREIVLNAKIKSK---KAEFLL
KTHY_ARCB4      ----YVSIEGIDTAGKSTQLNI----LEKTFPNAIFTKEPGGTALGIKLRAMALGGEAKSSI---AEMFL
KTHY_DESMR      ----FVTFEGVEGSGKSTQMTRLCAALEAAGRTVCRTRQPGGCFLGQTLRAILLSQK-TAGLDDRAELFL
KTHY_LEPBL      ----FVVFEGIDGSGKSTLCKSLTEKLTERGIPSVNFTEPTNFETGKYLRKFL---RGEIDLERKEQIDA
KTHY_LEPBJ      ----FVVFEGIDGSGKSTLCKSLTEKLTERGIPSVNFTEPTNFETGKYLRKFL---RGEIDLERKEQIDA
KTHY_HELPS      ----YVVLEGVDGAGKSTQVGLLKDRFKN----ALVTKEPGGTRMGEHLRHIALN----ENISELARAFL
KTHY_CALMQ      ----FVDVEGIDGVGKSTVIRLTADELRRRGYLVYTTSEPSDSPIGLFIRRSILESNL--EVEPMALALL
KTHY_NAUPA      ----YIALEGIDTAGKSTQIELLKNEY-KNNI--LFIKEPGFTKFGTKIREII----FNDDISKKAELFL
KTHY_WOLSU      ----YVAIEGVDTCGKSTQIALLKRRFP----GAIFTKEPGGTALGMKLRELLLGG---EAKSAKAELLL
KTHY_DESPS      ---KLIIFEGTDGAGKSTQIKMLANYLRSKGLDVIASFEPTNGPYGQKIRQLYTDR---NKVTRNEELEL
KTHY_PROAC      ---------------KTTQARLLDQWLTTEGIPHLMTREPGDSWLGQRIRELVL-SPGSGPISSRAEALL
KTHY_HELPJ      ----YVVLEGVDGAGKSTQVGLLKDRFKN----ALFTKEPGGTRMGESLRRIAL----NENISELARAFL
KTHY_SULNB      ----YILFEGIDTCGKSTQMEL----LTQKHPGIITTHEPGGTAFGQQAREILLSDSLRSK---RAELLL
KTHY1_SULSO     ---KLIAIEGIDGSGKTTLANLLKEHLEKMKLNVIVTREP----FSEDIIKLIEKIGWNDPI----LLVL
KTHY_STAMF      ----FLVLEGIDGAGKTSIAFKLRDFLVEKGFNVHYTYEPYNTLYVEALK-----KKYNEXXXXXXXXXX
KTHY_METJA      VDNMFIVFEGIDGSGKTTQSKLLAKKMD-----AFWTYEPSNSLVGKIIRE-ILSGK--TEVDNKTLALL
KTHY_MYCAP      ----FITFEGLDGSGKTTIVQXXXXXXXXXXLSFIVTREPGGKNVSEKIRELILDK--ESRLSPISEALL
KTHY_NATPD      -----ITLEGIDGSGKSTAHAALRERLTAEETT--FTREPTDSWYGSAVERSI----GDADADPLAELFL
KTHY_LEPIN      ----FVVFEGIDGSGKSTLCSLTEKLIELGIPSAAFT-EPTNLETGKYLRKFL---RGEIELGKEEQIEA
KTHY_LEPIC      ----FVVFEGIDGSGKSTLCSLTEKLIELGIPSAAFT-EPTNLETGKYLRKFL---RGEIELGKEEQIEA
KTHY_HALMA      -----VTLEGLDGSGKTTVWERLRSD-DAVPSETVFTREPTDTWYGDAVQRSIDNDDAD----SLAELFL
KTHY_METHJ      -----VTIEGIDGSGKSTLHKALGPYLA--DLNPVITCEPGSTWIGEAVRRAIRE-------HADAEALL
KTHY_HALLT      -----ITLEGLDGSGKTT----VWEALHDVYPDATFTREPTDSWYGEAVDRSIAADDADPL----AELFL
KTHY_CAMLR      ----YIAFEGVDCVGKSTQIELLKKCFKD----AIFTKEPGGSELGVHLRKILLESKM--QFSKKAELLL
KTHY_HALSA      -----VTLEGLDGSGKTTVWESLRA---SHDDGVTFTAEPTDSQYGQAVRR----SESAADADPIAELFL
KTHY_HALS3      -----VTLEGLDGSGKTTVWESLRA---SHDDGVTFTAEPTDSQYGQAVRR----SESAADADPIAELFL
KTHY_THEVO      ----FIAVEGIDGAGKTTLAKXXXXXXEKEGFRVFLTREP-----TDDIRN------YEGD---DVELFI
KTHY_SYNY3      MAALFIVLEGIDGSGKTTQGDLLLAHFQRQGLAAVLSPEPTNGPVGRLIRQALQGDLFTYNDARQFEAQM
KTHY2_SULTO     -----IAFEGIDGSGKSSQATLLKDWIELKR--DVYLTEWNSS---DWIHDIIKEAKKKDLLTPLTFSLI
KTHY_METLZ      -----ITLEGIDGAGKSTLYEGLKTRLQ--DLEPVFTKEPGSPLVNSAVRREIGANR-----DPFAEATL
KTHY_METST      ----YIVLEGIDGVGKTTQTEKLKEWLEKRGFSVKTIVEPTDSDIGKIIREELLKPEATSDTNQQMLALL
KTHY_SULAC      -----ISFEGIDGSGKTTISKIIYEKLIGSNKKIILTSEP----FSQEIIKLIEEIGWKDPI---SLALL
KTHY_SCHPO      -RGRLIVIEGLDRSGKSTQCQLVDKLISQHEKAELFKFPDRGKKIDDYLKESVQLN--DQVIH-----LL
KTHY_META3      --NKFIVFEGIDGSGKTTQAKLLADYLN-----GIYTCEPTNGEIGQLIRKVLGGKNCEKE-----SLAL
KTHY1_SULTO     ---RFISFEGIDGAGKTTLAKKVYEVLKKKGYNVILTQEP----FTREITELIKKAGWNDPV---LLTLL
KTHY_METMP      --NKFIVFEGIDGCGKTTQAKLVAEKLNAN-----FTFEPTDGKIGKSIREILAGSKCNKE----TLALL
KTHY_METVS      --NKFIVFEGIDGSGKTTQAKMLAE-----KLNAEYTCEPTTGKIGRTIREVL----SGSECKKETLALL
KTHY2_SULSO     MRGLLIAFEGIDGSGKSSQAVLLKDWIEMRR--DVYLTE---WNSSEWIHDIIKEAKKKNMLTSITFSLI
KTHY_TREPA      ----FVVFEGIDGTGTSTQLRALERHFQARK-DMVFTQEPTGGEIGTLIRDVL----QKRVIMSSKALLL
KTHY_METMJ      -----ITIEGIDGSGKSTXXXXXXXXXXXXXXX--FTREPGATWVGESVRRAIA-----ERMDPITEALL
KTHY_XANCP      -----IAIEGIDGAGKTTLARSLATLLEQAGARVVLSKEPTNGPWGTQLRQSAATGR----LSAQDEVDL
KTHY_XANCB      -----IAIEGIDGAGKTTLARSLATLLEQAGARVVLSKEPTNGPWGTQLRQSAATGR----LSAQDEVDL
KTHY_XANC8      -----IAIEGIDGAGKTTLARSLATLLEQAGARVVLSKEPTNGPWGTQLRQSAATGR----LSAQDEVDL
KTHY_METM7      --NKFIVFEGIDGCGKTTQAKLIAE-----KLNAKFTFEPTDGKIGKSIREILSGSKCQKE----TLALL
KTHY_METM6      --NKFIVFEGIDGCGKTTQAKLIAE-----RLNAKFTFEPTDGKIGKSIREILSGSKCQKE----TLALL
KTHY_DICDI      ----FILFEGVDRVGKSTQVQSLTNHISNQKLPTKSLRFPDRTTPIGQIINQYLQNATNMD---DRALHL
KTHY_XYLFT      -----VAIEGIDGAGKTTLARSLALKLRGVGLETVVSKEPTNGPWGTLLRQSAVTGRFSPE----EEVDV
KTHY_XYLF2      -----VAIEGIDGAGKTTLARSLALKLRGVGLETVVSKEPTNGPWGTLLRQSAVTGRFSPE----EEVDV
KTHY_XYLFM      -----VAIEGIDGAGKTTLARSLALKLRGVGLETVVSKEPTNGPWGTLLRQSAATGRFSPE----EEVDV
KTHY_XYLFA      -----VAIEGIDGAGKTTLARSLALKLRGVGLETVVSKEPTNGPWGMLLRQSAATGRFSPE----EEVDV
KTHY_HUMAN      -----IVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHS---VHL
KTHY_YEAST      -RGKLILIEGLDRTGKTTQCNILYKKLQPN--CKLLKFPERSTRIGGLINEYLTDDSFQ---LSDQAIHL
KTHY_CWPXG      -----IVFEGLDKSGKTTQCMNIMESIPSNTIK--YLNFPQRSTVTGKMIDDYLTRK---KTYNDHIVNL
KTHY_METS3      ----YIVFEGIDGAGKSTQINLLKDWLDQNGFDVETVVEPTDSEVGKLIRKILQRPDATTDRIQKTLGLL
KTHY_ECTVM      -----IVFEGLDKSGKTTQCMNIMESIPSNTIK--YLNFPQRSTVTGKMIDDYLTRK---KTYNDHIVNL
KTHY_PICTO      --SMFIAIEGIDGSGKTTLAGDIASY-----TGFYLTREP---------TDRFCYDYIEADYNDESSIIN
KTHY_RABPU      -----IVFEGLDKSGKTTQCMNIMESIPSNTIK--YLNFPQRSTVTGKMIDDYLTRK---KTYNDHIVNL
KTHY_CWPXB      -----IVFEGLDKSGKTTQCMNIMESIPSNTIK--YLNFPQRSTVTGKMIDDYLTRK---KTYNDHIVNL
KTHY_VACCW      -----IVFEGLDKSGKTTQCMNIMESIPANTIK--YLNFPQRSTVTGKMIDDYLTRK---KTYNDHIVNL
KTHY_VACCT      -----IVFEGLDKSGKTTQCMNIMESIPANTIK--YLNFPQRSTVTGKMIDDYLTRK---KTYNDHIVNL
KTHY_VACCC      -----IVFEGLDKSGKTTQCMNIMESIPANTIK--YLNFPQRSTVTGKMIDDYLTRK---KTYNDHIVNL
KTHY_VACCA      -----IVFEGLDKSGKTTQCMNIMESIPANTIK--YLNFPQRSTVTGKMIDDYLTRK---KTYNDHIVNL
KTHY_AERPE      ---RIVALEGIDGSGVSTHSRLLHARLAGAGVKSCLWKEPTEGPVGRLIRGFL---RSTEGVDSDLMALL
KTHY_CAEEL      -----IVFEGLDRSGKSTQAKRLVESINKKSTSAVLQAFPDRSSSIGKLIDQYLRKEIDMDEHA---LHL
KTHY_CAMPS      -----IVFEGLDKSGKTTQCMNIMESILANTIK--YLNFPQRSTVTGKMIDDYLTRK---KTYNDHIVNL
KTHY_CAMPM      -----IVFEGLDKSGKTTQCMNIMESILANTIK--YLNFPQRSTVTGKMIDDYLTRK---KTYNDHIVNL
KTHY_XANOR      -----IAIEGIDGXXXXXXXXXXXXXXXXXXXXVVLSKEPTNGPWGTKLRQSAATGR----LSADEEAEL
KTHY_XANOP      -----IAIEGIDGXXXXXXXXXXXXXXXXXXXXVVLSKEPTNGPWGTKLRQSAATGR----LSADEEAEL
KTHY_XANOM      -----IAIEGIDGXXXXXXXXXXXXXXXXXXXXVVLSKEPTNGPWGTKLRQSAATGR----LSADEEAEL
KTHY_METTH      ----YICFEGIDGSGKTTHAALTASWLRENGYMVHEVREPTDSNIGSLIRSM-LSSPDARTPDVQRMLAL
KTHY_METM5      --NKFIVFEGIDGCGKTTQAKLIAE-----KLNAKFTFEPTDGKIGKSIREILSGSQCQKE----TLALL
KTHY_VARV       -----IVFEGLDKSGKTTQCMNIMESIPTNTIK--YLNFPQRSTVTGKMIDDYLTRK---KTYNDHIVNL
KTHY_ASFWA      MRGILIAIEGINGVGKSTQAMRLKKALECMDYNAVCIRFPNPDTTTGDLILQVLNKMIE---MSSEQLHK
KTHY_XANC5      -----IAIEGIDGXXXXXXXXXXXXXXXXXXXXVVLSKEPTNGPWGTQLRQSAATGRLSAE--EEAELLI
KTHY_XANAC      -----IAIEGIDGXXXXXXXXXXXXXXXXXXXXVVLSKEPTNGPWGTQLRQSAATGRLSAE--EEAELLI
KTHY_METS5      -----VVIEGIDASGKTTLAKRLAESLSPR-FKVLLTQEP----FTDDIKQLLEKYQWKDQVLL---ALL
KTHY_ASFB7      MRGILITIEGINGVGKSTQAMRLKKALECMDYNAVCIRFPNPDTTTGGLILQVL-NKMTE--MSSEQLHK
KTHY_IIV6       -----IVFEGCDKTGKSTQCKLLFEELKQKNIEVRMINFPNRTTQTGKLIDQYLKGKIDEDIH------I
KTHY_ASFP4      MRGILIAIEGVNRVGKSTQAMRLKKALECMDYNAVCIRFPNPDTTTGDLILQVLNKMIE---MSSEQLHK
KTHY_METKA      ----YLGVEGIDGVGKSSVVNLAAEFLEIHGLEVTTVREP-STDIGR------------EALEWDDPYLQ
KTHY_MOUSE      -----IVLEGVDRAGKTTGLKLVTALCASGHRAELLRFPERSTEIG-KLLNSYLEKKTELEDHS---VHL
PSTK_METJA      -----IILTGLPGVGKSTFSKNLAKILSKNNIDVIVL---GSDLIRESFP--VWKEKYEEFIKKST----
KTHY_THEAC      ----FIAIEGIDGAGKTTLARGIGNMLLGEGYRVYMTKEP-----TDGMENYA---------GDGVELFL
KTHY_ASFK5      MRGILIAIEGINGVEKSTQAIRLKNALENKRYDVIYLHFPSGKLILDVLNKIV--KMPSEQLHE------
DGK_DICDI       --SKIIILEGNISAGKTYLSSKLKVFLEPNPYLSLFYKEP--SKYALIMQKWLLNQRYNT----------
ACDG2_METMA     ----------------------------------------------------------------------
ACDG1_METMA     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDP
KTHY_FRATM      IYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDP
KTHY_FRATW      IYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDP
KTHY_FRATT      IYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDP
KTHY_FRAT1      IYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDP
KTHY_FRATN      IYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDP
KTHY_FRATH      IYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDP
KTHY_FRATF      IYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDP
KTHY_FRATO      IYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNNNFLNGCEPDLVIYLDIDP
KTHY_FRAP2      IYAGRIQHYRNLIAPALTKGVNVVSDRFYWSSIAYQGGGRELGVDKLNVLNETFLKDCQPDLIIYLDIDP
KTHY_PSEHT      MYAARSQLMHNVINPALEQGQWVLADRHDLSSQAYQGGGRGISANTLASLSSMVLKGLKPDLTIYLDIDP
KTHY_ACTSZ      LYAARIQLVENVIKPALAAGKWVIGDRHDLSSQAYQGGGRGLDRHFMQTLKDSVLGGFEPDFTLYLDIEP
KTHY_PECCP      LYAARVQLVDNVIKPALANGQWVIGDRHDLSSQAYQGGGRGIDQQLLRSLRDTVLGDFRPDLTLYLDLPP
KTHY_ERWCT      LYAARVQLVDNVIKPALADGKWVIGDRHDLSSQAYQGGGRGIDQQLLRSLRDTVLGNFRPDLTLYLDLPP
KTHY_VIBCM      VYAARVQLVENVIKPALARGEWVVGDRHDMSSQAYQGGGRQIAPSTMQSLKQTALGDFKPDLTLYLDIDP
KTHY_VIBCH      VYAARVQLVENVIKPALARGEWVVGDRHDMSSQAYQGGGRQIAPSTMQSLKQTALGDFKPDLTLYLDIDP
KTHY_VIBC3      VYAARVQLVENVIKPALARGEWVVGDRHDMSSQAYQGGGRQIAPSTMQSLKQTALGDFKPDLTLYLDIDP
KTHY_PHOLL      LYAARVQLVENVIKPALARGTWVVGDRHDLSSQAYQGGGRGIDKNLMTSLRDTVLGDFRPDLTIYLDLPP
KTHY_SHESR      IYAARAQLVANVIKPALAEGKWVLGDRHNLSSLAYQGGGRGL-MPLVEAVSNATLKGFKPDLTLYLDLDP
KTHY_SHESM      IYAARAQLVANVIKPALAEGKWVLGDRHNLSSLAYQGGGRGL-MPLVEAVSNATLKGFKPDLTLYLDLDP
KTHY_LEGPH      LYAARIQLIEQVIKPALNVGQWVIADRFELSTLAYQGGGRKMDMRVINELSNFCLKGFKPDLTLYLDINP
KTHY_SHEAM      FYAARAQLVANVIKPSLASGRWVLGDRHNLSSIAYQGGGRGL-MSLVKTISDATLGGFKPDLTLYLDIDP
KTHY_ALTMD      MYAARVQLLTNKIYPSLNAGAWVVGDRHDLSSQAYQGGGRGVSEKTMTAISDIALNGFKPDLTLYLDVDP
KTHY_LEGPL      LYAARIQLIEQVIKPALNVGQWVIADRFELSTLAYQGGGRKMDMRVINELSNFCLKGFKPDLTLYLDINP
KTHY_ACTPJ      LYAARIQLVENVIKPALAEGKWVLGDRHDMSSQAYQGGGRQIDRHLLETLKETVLGNFEPDLTIYLDIDP
KTHY_ACTP7      LYAARIQLVENVIKPALAEGKWVLGDRHDMSSQAYQGGGRQIDRHLLETLKETVLGNFEPDLTIYLDIDP
KTHY_ACTP2      LYAARIQLVENVIKPALAEGKWVLGDRHDMSSQAYQGGGRQIDRHLLETLKETVLGNFEPDLTIYLDIDP
KTHY_SHEFN      IYAARTQLIANVIKPALSVGQWVLGDRHNLSSLAYQGGGRGL-MPLVKAVSDACLRGFKPDLTLYLDIDP
KTHY_SHEON      IYAARAQLVANVIKPALAQGNWVLGDRHNLSSLAYQGGGRGL-MPLVEAVSNATLKGFKPDLTLYLDLDP
KTHY_LEGPA      LYAARIQLIEQVIKPALNVGQWVIADRFELSTLAYQGGGRKMNMRVINELSNFCLKGFKPDLTLYLDINP
KTHY_LEGPC      LYAARIQLIEQVIKPALNEGQWVIADRFELSTLAYQGGGRKMDMRVINELSNFCLKGFKPDLTLYLDINP
KTHY_HAEIN      LYAARIQLVENVIKPALMQGKWVVGDRHDMSSQAYQGGGRQLDPHFMLTLKETVLGNFEPDLTIYLDIDP
KTHY_HAEIG      LYAARIQLVENVIKPALMQGKWVVGDRHDMSSQAYQGGGRQLDPHFMLTLKETVLGDFEPDLTIYLDIDP
KTHY_HAEIE      LYAARIQLVDNVIKPALMQGKWVVGDRHDMSSQAYQGGGRQLDPHFMLTLKETVLGDFEPDLTIYLDIDP
KTHY_BLOPB      IYAARLQLIENVIKPALSKGYWVIGDRFDLSSQAYQGGGRGIDILLLHALSNKITNTLSPDLTFYLDISP
KTHY_PASMU      LYAARIQLVENVIKPALAQGKWVIGDRHDMSSQAYQGGGRQLDQHLLHTLKQTILGEFEPDLTLYLDIDP
KTHY_VIBFM      LYAARAQLVGNVIKPALAKGEWVVGDRHDLSSQAYQGGGRGFDRDLMMTMRNTVLGDFKPDLTIYMDIDP
KTHY_SHELP      IYAARAQLVANVIKPALAQGNWVLGDRHNLSSLAYQGGGRQL-MPLVEAVSQATLKDFKPDLTLYLDIDP
KTHY_HAEDU      LYAARAQLVENVIKPALSAGKWVLGDRHDMSSQAYQGGGRQLDVALLNSLKESVLGPFEPDLTIYLDIDP
KTHY_VIBF1      LYAARAQLVGNVIKPALARGEWVVGDRHDLSSQAYQGGGRGFDRELMMTMRNTVLGDFKPDLTIYMDIDP
KTHY_YERE8      LYAARVQLVENVIKPALARGSWVVGDRHDLSSQAYQGGGRGIDINLMTSLRDTVLGEFRPDLTLYLDLPP
KTHY_PHOPR      LYAARIQLVDNIIKPALAEGRWVVGDRHDMSSQAYQGGGRGFDKALMENLRDTVLGDFCPDLTIYMDIDP
KTHY_COLP3      MYASRSQLLANKILPALAAGKWVIGDRHDLSSRAYQGGGRGFDETIMNTISDITLKGFRPDITLYLDIDP
KTHY_VIBVY      LYAARVQLVENVIKPALHEGKWVVGDRHDLSSQAYQGGGRQIDATLMKNLRDTALGEFKPAFTLYMDIDP
KTHY_VIBVU      LYAARVQLVENVIKPALHEGKWVVGDRHDLSSQAYQGGGRQIDATLMKNLRDTALGEFKPAFTLYMDIDP
KTHY_AERHH      MYASRVQLVETRIKPALADGIWVVGDRHDLSSQAYQGGGRGIDANLIGAIKRAVLGDFKPDLTLYLDIDP
KTHY_ALISL      LYAARAQLVGNVIKPALAAGNWVVGDRHDLSSQAYQGGGRGFDRELMATMKRTVLGDFTPDLTIYMDIDP
KTHY_EDWI9      LYAARVQLVENVIKPALARGAWVVGDRHDLSSQAYQGGGRGIDTHLMQTLRDTVLGDFKPDLTLYLDIPP
KTHY_SERP5      LYAARVQLVETVIKPALARGAWVVGDRHDLSSQAYQGGGRGVDQQLMASLRDTVLGEFRPDLTLYLDLPP
KTHY_HAEPS      IYAARIQLVETVIEPALASGKWVVGDRHNMSSQAYQGGGRGL-AELVDEVGSAILGDFEPDFTIYLDIEP
KTHY_VIBPA      LYAARVQLVENVIKPALANGQWVVGDRHDLSSQAYQGGGRQIDASLMKNLRDTTLGDFKPAFTLYMDIDP
KTHY_MANSM      LYAARIQLVENVIKPALAQGKWVIGDRHDLSSQAYQGGGRQIDSHLLETLKKTVLGDFEPDFTLYLDLSP
KTHY_ECOL6      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGGVRPDLTLYLDVTP
KTHY_ECOUT      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGGFRPDLTLYLDVTP
KTHY_ECOK1      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGGFRPDLTLYLDVTP
KTHY_ECO45      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGGFRPDLTLYLDVTP
KTHY_ESCF3      FYAARVQLVETVIKPALAKGTWVIGDRHDLSTQAYQGGGRGVDQTMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_CITK8      FYAARVQLVETVIKPALAKGTWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_WIGBR      IYAARIQLVESVIKPALENGSWVVGDRHDLSSLAYQGGGRKIDTKILKMLREVFLRDFYPDLTFYLDIPP
KTHY_VIBHB      LYAARVQLVENVIKPALANDQWVVGDRHDLSSQAYQGGGRQIDASLMKNLRDTTLGEFKPAFTLYMDIDP
KTHY_ENTS8      FYAARVQLVETVIKPALARGEWVIGDRHDLSTQAYQGGGRGIDRQLLATLRQAVLGDFAPDLTLYLDVDP
KTHY_ECOSM      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_ECO7I      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_YERPY      LYAARVQLVENVIKPALARGSWVVGDRHDLSSQAYQGGGRGIDSQLMASLRDTVLGEFRPDLTLYLDLPP
KTHY_YERPS      LYAARVQLVENVIKPALARGSWVVGDRHDLSSQAYQGGGRGIDSQLMASLRDTVLGEFRPDLTLYLDLPP
KTHY_YERPB      LYAARVQLVENVIKPALARGSWVVGDRHDLSSQAYQGGGRGIDSQLMASLRDTVLGEFRPDLTLYLDLPP
KTHY_YERP3      LYAARVQLVENVIKPALARGSWVVGDRHDLSSQAYQGGGRGIDSQLMASLRDTVLGEFRPDLTLYLDLPP
KTHY_SHISS      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_SHIFL      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_SHIF8      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_SHIDS      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_SHIBS      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_SHIB3      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_SALPK      FYAARVQLVETVIKPALAQGIWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_SALPC      FYAARVQLVETVIKPALAQGIWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_SALPB      FYAARVQLVETVIKPALAQGIWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_SALPA      FYAARVQLVETVIKPALAQGIWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_SALNS      FYAARVQLVETVIKPALAQGIWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_SALHS      FYAARVQLVETVIKPALAQGIWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_SALG2      FYAARVQLVETVIKPALAQGIWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_SALEP      FYAARVQLVETVIKPALAQGIWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_SALCH      FYAARVQLVETVIKPALAQGIWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_SALA4      FYAARVQLVETVIKPALAQGIWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_HAES2      LYAARVQLVENVIKPALARGKWVVGDRHDLSSQAYQGGGRGLDRHLMTTLKNAVLGDFKPDFTLYLDIEP
KTHY_ECOSE      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_ECOLU      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_ECOLI      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_ECOLC      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_ECOL5      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_ECOHS      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_ECODH      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_ECOBW      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_ECO8A      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_ECO81      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_ECO55      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_ECO27      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_ECO24      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_SALTY      FYAARVQLVETVIKPALAQGVWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_SALTI      FYAARVQLVETVIKPALAQGVWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_SALSV      FYAARVQLVETVIKPALAQGVWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_SALDC      FYAARVQLVETVIKPALAQGVWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_ECO5E      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_ECO57      FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_ERWT9      LYAARVQLVENVIKPALARGAWVVGDRHDLSSQAYQGGGRGMDAGLMNSLKQAVLGDFAPDLTLYLDVTP
KTHY_ENT38      FYAARVQLVETVIKPALAEGQWVIGDRHDLSTQAYQGGGRGIDQQMLATLRNAVLGDFRPNLTLYLDVTP
KTHY_SALAR      FYAARVQLVETVIKPALAQGVWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTP
KTHY_YERPP      LYAARVQLVENVIKPALARGSWVVGDRHDLSSQAYQGGGRGIDSQLMASLRDTVLGEFRPDLTLYLDLPP
KTHY_YERPN      LYAARVQLVENVIKPALARGSWVVGDRHDLSSQAYQGGGRGIDSQLMASLRDTVLGEFRPDLTLYLDLPP
KTHY_YERPG      LYAARVQLVENVIKPALARGSWVVGDRHDLSSQAYQGGGRGIDSQLMASLRDTVLGEFRPDLTLYLDLPP
KTHY_YERPE      LYAARVQLVENVIKPALARGSWVVGDRHDLSSQAYQGGGRGIDSQLMASLRDTVLGEFRPDLTLYLDLPP
KTHY_YERPA      LYAARVQLVENVIKPALARGSWVVGDRHDLSSQAYQGGGRGIDSQLMASLRDTVLGEFRPDLTLYLDLPP
KTHY_HAES1      LYAARVQLVENVIKPALAQGKWVVGDRHDLSSQAYQGGGRGLDQHLMTTLKNAVLGDFKPDFTLYLDIEP
KTHY_KLEP3      FYAARVQLVETVIKPALARGQWVIGDRHDLSTQAYQGGGRGIDRTMLATLRDAVLGDFRPNLTLYLDVTP
KTHY_KLEP7      FYAARVQLVETVIKPALARGQWVIGDRHDLSTQAYQGGGRGIDRTMLATLRDAVLGDFRPNLTLYLDVTP
KTHY_RUTMC      LFAARNEHIRTKIIPSLEKGDWVLSDRFTDASYAYQGGGRGLSIERITQLEKWVLQDFTPDVTLLLDVSV
KTHY_BUCAP      MYAARIQLVKKIIQPALKKGTWVISDRHDLSSLAYQGGGLGIKRKLINKLKYLFLQDFIPDLTIYLDVYP
KTHY_VESOH      IFAARNEHIKTKIIPALNRGDWVLSDRFTDASYAYQGGGRGLSIERIALLEQWVLQDFSPDVTLLLDVPV
KTHY_HAMD5      XXXXXXXXXENIIKPALSSGTWVIGDRHDLSSQAYQGGGRGIKSEFIKSLADFTLGSSRPDLTLYLDLPP
KTHY_IDILO      MYASRVQLVDNIIKPALSKNRWVIGDRHDLSSRAYQGGGRELGDELLQKIRKITLGNFTPDLTLLLDVEE
KTHY_KOSOT      FMASRAQIVREVIIPALKKKKLVLADRFLDSSVAYQGYGRGLSIQMVTTLNEFSTGGVTPHLTLFIDVPV
KTHY_SODGM      LYAARVQLVEGVIKPALARGAWVVGDRHDLSSQAYQGGGRGMDARLLQTLRDAVLGDFRPDLTLYLDIPP
KTHY_BAUCH      LYAARTQLVAQVIKPALMSGTWVISDRYDLSSQAYQGGGRGIDIRLLQNLRDAALGKFYPDLTIYLDLPP
KTHY_SHESA      IYAARAQLVANVIKPALAEGKWVLGDRHNLSSLAYQGGGRGL-MPLVEAVSNATLKGFKPXXXXXXXXXX
KTHY_NITMU      MFAARREHLDKVILPALSRGEWVISDRFTDASFAYQGGGRGLSLQKLNELECWVQGEFQPDVTLYLDVSI
KTHY_NITEC      MFAARREHLDKVILPALERGAWVISDRFTDASFAYQGGGRGVPSARLEILEQWVQKGFSPDLTVYFDVPV
KTHY_TRIEI      YAADRAQHIEALIKPCLERGTIVLCDRFIDSTIAYQGYGRGLDVELIKQLNYIATGGLKSDLTFWLDIDV
KTHY_NEIG2      MFAARMQHIEEVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQGGLRPDLTLLLDVPL
KTHY_NEIG1      MFAARMQHIEEVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQGGLRPDLTLLLDVPL
KTHY_MARMS      VFAARAQHLAEKIQPALEKGTWVISDRFLDSSYVYQGKARGGDIAMLDQLANWVVGDNKPDATLVLDVPV
KTHY_CARHZ      YLADRAQHVGEKIIPHLDKGVWVISDRYFDSTLAYQGYGRGFDLTLLKSFIAFATKGLIPDLTVLIDLPP
KTHY_ACIBS      IYAARAQHLQQVILPALESNKIVLSDRFTDASFAYQCSGRGLSQDKLQLLNQNFVSRM-PEVTFWLDAPI
KTHY_ACIBC      IYAARAQHLQQVILPALESNKIVLSDRFTDASFAYQCSGRGLSQDKLQLLNQNFVSRM-PEVTFWLDAPI
KTHY_ACIBT      IYAARAQHLQQVILPALESNKIVLSDRFTDASFAYQCSGRGLSQDKLQLLNQNFVSRM-PEVTFWLDAPI
KTHY_NEIMB      MFAARMQHIEEVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQGGLKPDLTLLLDVPL
KTHY_HALOH      YAADRAQHVVELIKPALESGKVVLADRFIDSSIAYQGYGRGLDIDVVKTVNEWVIDGCWPDLTFVLDLDV
KTHY_COXBU      MFAGRAQNIAHVVLPALRRGQWVLSDRFTDASFAYQGGGRGIPVKHIEELAGWVLGNLKPDLTLLLDAPV
KTHY_ACIBY      IYAARAQHLQQVILPALESNKIVLSDRFTDASFAYQCSGRGLSQDKLQLLNQNFVSSM-PEVTFWLDAPI
KTHY_ACIB5      IYAARAQHLQQVILPALESNKIVLSDRFTDASFAYQCSGRGLSQDKLQLLNQNFVSSM-PEVTFWLDAPI
KTHY_ACIB3      IYAARAQHLQQVILPALESNKIVLSDRFTDASFAYQCSGRGLSQDKLQLLNQNFVSSM-PEVTFWLDAPI
KTHY_NITEU      MFAARREHLDKVILPALDRGAWVVSDRFTDASFAYQGGGRGVAQSKLDNLEQWVQAELSPDLTVYFDVPV
KTHY_NEIMA      MFAARMQHIEDVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQGGLRPDLTLLLDVPL
KTHY_CHRVO      AFAARQQHIAEVIEPALAAGRWLVSDRFTDSTYAFQGGGRGVPFERIRALEDWVQRGLQPDLTLLFDLPT
KTHY_BUCBP      FYAARIQLIKNIIQPALNKGVWVISDRYFLSSLAYQCAGRKIKEEIVLLLQSLFLKNFNPNITFYLDVTP
KTHY_DESRM      YSAARAQLVAQVIRPQLEQGTVVLCDRYIDSTLAYQGYGRGMDISFLAQINELASGGLMPNITILLDLPP
KTHY_BUCAI      MYAARIQLVEKKIKPALKNGIWVISDRHDLSSLAYQGGGLGIPKKIIYQLQSLFLNNFIPDLTIYLDVSP
KTHY_NEIMF      MFAARMQHIEDVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQGGLRPDLTLLLDVPL
KTHY_RALEH      MFAARREHIAEVIAPALERGKWVISDRFTDATFAYQGGGRGLATERLEVLEDWVQGGLQPDLTLLFDVPL
KTHY_BLOFL      LYAARSQLLENVIKPALFKGDWVIGDRCDLSSFAYQGAGRKLNSVLLNMLSQYVINDFFPKLIFYLDIPS
KTHY_THEAB      FLASRAQLVEEVIKPHLKRGFFVLADRFSDSSIAYQGGARNIGVETVSTLNDFATDNIYPDIVFYIDIPT
KTHY_BURPP      MFALRRQHLAEVIEPALARGDWVLSDRFTDATFAYQGGGRGLPRDKLETLERWVQGGFQPDLTVLFDLAP
KTHY_PSEPF      VFAARAQHLAEVIRPALARGAVVLCDRFTDSTYAYQGGGRGLSLERIAALETFVQGDLRPDLTLIFDLPV
KTHY_CALS8      LAADRNEHVKNVLIPALEDGYVVVCDRYILSSIVYQGIVRGVGVENIIKLNSIFEEKIKPDLYIILTLSP
KTHY_HAHCH      MFAARAQHLEQKIKPTIERGVHVLSDRFTDATYAYQGGGRGLSWAMIQDLEKLVQAGFKPDLTLLLRIDP
KTHY_FERNB      FLASRAQLVESVIKPALKNGKIVIADRFAHSSVAYQGCGRELGPETVKILNDFATDKTYPDIVFYIDVPV
KTHY_CLONN      YVASRRQHLAERVIPAIKEGKVVICDRFIDSSLAYQGYARGIGIDEVMAINEFAIDGYMPDLTLYLDIEP
KTHY_BURP8      MFAARREHLAQVIEPALARGDWVLSDRFTDATFAYQGGGRGLPRDKLEALERWVQGGFQPDLTVLFDVPP
KTHY_THIDA      MFAARQQHLAELILPALARGAWVVSDRFTDASYAYQCGGXXXXXXXXXXLEDWVQRGFAPDLTLLFDVPP
KTHY_PSEF5      VFAARAQHLATVIRPALERGAVVLCDRFTDSTYAYQGAGRGLSLARIAALEDFVQGELRPDLTLVFDLPV
KTHY_LACJO      YAAQRSQHVSEVIRPALATGKVVLSDRFIDSSLAYQGVGRNLGIEEVKQINDFGTGGLEPDLTIFLDLDP
KTHY_PROM2      YSADRAEHVYKIISPALNNNDWVISDRFSDSTLAYQGYGRNINLEIIKNIESIVCQGESPDLTFFLEISP
KTHY_PSEFS      VFAARAQHLAEVIRPALARGAVVICDRFTDSTYAYQGGGRGLSLARIATLETFVQGDLRPDLTLVFDLPV
KTHY_LACH4      YAAARSQHVEEIIRPALSEGKIVFSDRFVDSSLAYQGEGRDLGIEEVKQINDFATGKLDPDLTFFLDIAP
KTHY_GEOSW      YAAARRQHLLEKIIPAIKAGKIVLCDRFVDSSLAYQGFARGLGIDEILQINQFAIDGFFPSLTIYFDIDP
KTHY_CUPTR      MFAARREHIAEVIAPALERGKWVISDRFTDATFAYQGGGRGLATERLEVLENWVQGSLQPDLTLLFDVPL
KTHY_BURXL      MFALRRQHLAEVIEPALARGDWVLSDRFTDATFAYQGGGRGLPRDKLETLERWVQGGFQPDLTVLFDLDP
KTHY_ACIAD      MYAARAQHLQQVIVPALADEKLVLSDRFTDASYAYQCVGRGLSKDKLNTLNQTFVSHM-PDITFWLDAPI
KTHY_PSESM      VFAARAQHLAEVIRPALARGEVVLCDRFTDATYAYQGGGRGLSHERIAALEQFVQGDLRPDLTLVFDLPV
KTHY_METFK      MFAARREHIAEVIEPALARGAWVVSDRFTDASFAYQCGGRGVPCEKVEALEAWVHPDLQPDLTLLFDVPV
KTHY_JANMA      MFAARREHIAQVIAPALERGDWVISDRFTDATFAYQGGGRKLDRAKLNALEQWVHPHLQPHLTLLFDVPL
KTHY_PSE14      VFAARAQHLAEVIRPALARGEVVLCDRFTDATYAYQGGGRGLSQQRIAVLEEFVQGDLRPDLTLVFDLPV
KTHY_PROMP      YSADRAEHISKTISPALENQDWVLSDRFCDSTLAYQGYGRNINLEIIKNIESIVCQGESPDLTIFLEISA
KTHY_LACDB      YAASRSQHVSEIINPALKRGDLVMSDRFVDSSLAYQGQGRGLGIDEVAQINAFATGHLEPDLTIFLDLDP
KTHY_LACDA      YAASRSQHVSEIINPALKRGDLVMSDRFVDSSLAYQGQGRGLGIDEVAQINAFATGHLEPDLTIFLDLDP
KTHY_BACSK      YAAARREHLIKKIVPALAEGALVLCDRYIDSSLVYQGHARGIGMEEVRAINGFAIETYMPDLTLYFDVEP
KTHY_STRGC      YIASRRQHLIEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDVADIEWLNQYATDGLKPDLTLYFDLDV
KTHY_RALEJ      MFAARREHIAEVIEPALARGDWVISDRFTDATFAYQGGGRGLATSRLETLETWVQDGLQPDLTLLFDVPL
KTHY_BIFLI      FAADRAQHVAETIRPALERGEVVITDRYLDSSLAYQAGGRELTPEEIRSLSMWATNNLLPDRTYLLDMDP
KTHY_PSEU2      VFAARAQHLAEVIRPALARGEVVLCDRFTDATYAYQGGGRGLSHQRIAALEQFVQGDLRPDLTLVFDLPV
KTHY_PARUW      FLAARAQHIEELIQPALKAGKIVLCDRFNDSTIAYQGAARGLNAKKIQEFCQLVCAEILPNWTLFLDVSP
KTHY_BIFLD      FAADRAQHVAETIRPALERGEVVITDRYLDSSLAYQAGGRELTPEEIRSLSMWATNNLLPDRTYLLDMDP
KTHY_METCA      LFAARVHHLREVIEPALRRGDWVVCDRFTDASYAYQGAGRGIAPGVIDFLRDWIQAGLRPDLTLLLDAPV
KTHY_BIFLO      FAADRAQHVAETIRPALERGEVVITDRYLDSSLAYQAGGRELTPEEIRSLSMWATNNLLPDRTYLLDMDP
KTHY_BURCH      MFAARREHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLETLERWVQGGFQPDLTVLFDVAP
KTHY_BURCC      MFAARREHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLETLERWVQGGFQPDLTVLFDVAP
KTHY_BURCA      MFAARREHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLETLERWVQGGFQPDLTVLFDVAP
KTHY_PROM5      YSADRAEHVSKIISPALKKEDWVISDRFSDSTLAYQGYGRHINLEIIKNIESIVCQGEYPDLTIFLEISA
KTHY_FINM2      YAASRAQHVEETILPALNENKIVLCDRFLISSLAYQGVGRGLGIENVRNINEFAINGXXXXXXXXXXXXX
KTHY_MYCCT      FIASRNQHLQKVIKPALEKNIIVISDRFIDSTSAYQGSARNIGVDVVSEVQQIVLKNCLPDLTLFFDVSF
KTHY_BACP2      YAAARRQHLAEKVEPALQRGETVLCDRFVDSSLAYQGYARGLGIDQVRSINDFAIDGTMPQMTIYFSITP
KTHY_BURCJ      MFAARREHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLETLERWVQGGFQPDLTVLFDVAP
KTHY_BIFAA      FAADRAQHVAEVILPALQRGAVVITDRYLDSSLAYQAGGRELTAAEIRNLSMWATNGLLPERTYLLDMDP
KTHY_RALPJ      MFASRREHIAEVIQPALDAGDWVISDRFTDATFAYQGGGRGLAIDRLEALEHWVQQGLQPTKTILFDLAP
KTHY_MESFL      FIAARKEHLEKVIKPYLKKGYIVISDRFMDSTTAYQGGARGLGVDYLNELQKNILEGFLPDLTLYFE---
KTHY_DESAD      YLADRAQHVGQVIKPAVEAGKIIISDRFADSTIVYQGYGRGLDPKLLRELNDVAVSGNWPDLTILLDIDP
KTHY_CHLP8      FSASRAELMEKIIVPALEDGCDVILDRFFDSTTAYQGYGRGLNLDMLAEINRIASHGIRPDITFYLDLTP
KTHY_BURCM      MFAARREHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLETLERWVQGGFQPDLTVLFDVAP
KTHY_BURA4      MFAARREHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLETLERWVQGGFQPDLTVLFDVAP
KTHY_LACAC      YAAARSQHVEEIIKPAINEGKVVFSDRFVDSSLAYQGQGRDLGIAKVKQINDFATDKLDPDLTFFLDIAP
KTHY_BURP6      MFAGRREHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLEALERWVQGGFQPDLTVLFDVQP
KTHY_BURMS      MFAGRREHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLEALERWVQGGFQPDLTVLFDVQP
KTHY_BURMA      MFAGRREHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLEALERWVQGGFQPDLTVLFDVQP
KTHY_BURM9      MFAGRREHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLEALERWVQGGFQPDLTVLFDVQP
KTHY_BURM7      MFAGRREHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLEALERWVQGGFQPDLTVLFDVQP
KTHY_ALHEH      MFAARSEHLDKRIWPALERGQWVVCDRFTDASYAYQGWGRGLGAERIAALEDWTQGALRPDLTLWLDVPV
KTHY_SYNJA      YAADRAEHVNKVIAPALAVGQVVICDRFTDSTLAYQGYGRGLNLEQIRQLNHLATGGLQPQLTLWLDLAP
KTHY_ANAVT      YAADRAQHVAQELKPKLAQGKYILCDRYVDSTIAYQGYGRNLDMNLIHQLNDIATGGLTSDITIWLDVDV
KTHY_ALCBS      VFAARAQHLEQKIRPALARGEWVLCDRFLDATWAYQGAGRGLDSAAIAALEALVIRDTRPDMTILFDVPV
KTHY_RALSO      MFASRREHIAEVIQPALERGDWVISDRFTDATFAYQGGGRGLAIERLEALEQWVQQGLQPTRTLLFDLAP
KTHY_PELLD      FSASRAELVSEVVRPALAEGKTVILDRFFDSTTAYQGYGRGLDLNMLRTLIAISTGALTPDITFYLDILP
KTHY_BURS3      MFAARREHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLETLERWVQGGFQPDLTVLFDVAP
KTHY_BURPS      MFAGRREHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLEALERWVQGGFQPDLTVLFDVQP
KTHY_BURP1      MFAGRREHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLEALERWVQGGFQPDLTVLFDVQP
KTHY_BURP0      MFAGRREHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLEALERWVQGGFQPDLTVLFDVQP
KTHY_SYNJB      YAADRAEHVSKVIAPALAAGQVVVCDRFTDSTLAYQGYGRGLDLEKIRQLNHLATGGLQPHLTLWLDLPP
KTHY_MYCMS      FIASRNQHLQKVIKPALEKNIIVISDRFIDSTSAYQGSARNIGVDVVNQVQQIVLKNCLPDLTLFFDVSF
KTHY_GEOTN      YAAARRQHLLEKIVPALEAGRVVLCDRFVDSSLAYQGFARGLGVEEVWKINEFAIDGYMPSLTVYFDIDP
KTHY_ENTFA      YAAARRQHLVEKILPALEAGHLVLCDRFVDSSLAYQGAGRRIGIAPIASINAFATEGVSPDFTIYLDVDS
KTHY_BURTA      MFAGRREHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLEALERWVQGGFQPDLTVLFDVPP
KTHY_ANOFW      YAAARRQHLVEKVIPALKDGKVVLCDRFIDSSLAYQGVARGLGIDEILAINAFAIENWMPILTIYFDIDP
KTHY_THETN      YASSRAQLVEEKILPALSKGQMVIVDRFIDSSYVYQGYARGLGLEKVKIVNEIATKGLFPDITVYIDITP
KTHY_SYNS3      YAADRAQHVDRVIQPALERGDWVLSDRFTGSTMAYQGYGRGLNRELITDLERIATRGLTPDMTVWLDIPL
KTHY_PSEPG      VFAARAQHLAQVIRPALARGAVVLCDRFTDATYAYQGGGRGLSVERIATLEQFVQGGLRPDLTLVFDLPV
KTHY_PROM4      YAADRAEHIHSLIQPKLDKGDWVISDRFSGSTLAYQGFGRGLDINLIRRLDAIARQGLVPEITIFLKISV
KTHY_HERAR      MFAARREHIAQLIEPALARGDWVISDRFTDATFAYQGGGRKLDRQKLSVLEQWVHPHLQPDLTLLFDVPL
KTHY_PROVI      FSASRAELVNEVIRPALKEGTTVILDRFFDSTTAYQGYGRGIDLPTLNSIIALSTGGLKPDITFYLDILP
KTHY_CHLL2      FSASRAELVQQVILPAIDNGTTVILDRFFDSTIAYQGYGREIDQVMLQTIITLSTFSLQPDITFYLDISP
KTHY_STRA5      YMAARRQHLVEKVLPALEEGKIVLMDRFIDSSVAYQGSGRGLDKSHIKWLNDYATDSHKPDLTLYFDVPS
KTHY_STRA3      YMAARRQHLVEKVLPALEEGKIVLMDRFIDSSVAYQGSGRGLDKSHIKWLNDYATDSHKPDLTLYFDVPS
KTHY_STRA1      YMAARRQHLVEKVLPALEEGKIVLMDRFIDSSVAYQGSGRGLDKSHIKWLNDYATDSHKPDLTLYFDVPS
KTHY_LACLS      FEAARRLHMQEKMLPALRAGKVVIVDRFIDSSVAYQGYGRDLGVEVVDWLNYFATDGLKPDLTLYFDIDT
KTHY_BURVG      MFAARREHLARVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLEALERWVQGGFQPDLTVLFDVAP
KTHY_BACHD      YAAARRQHLVEKVLPALEAGHVVLCDRFIDSSLAYQGYARGIGFEDILAINEFAIEGRYPDLTLLFRVDP
KTHY_LACS1      YAAARRQHLVDTVLPALNEGKLVLCDRFVDSSVVYQGVARDIGVEPVIKLNEFATENLKPDLTLYYDVEP
KTHY_STAS1      FAASRREHLVGKVIPSLENGKLVLCDRYIDSSLAYQGYARGIGIEEVKSINEFAINGLYPDITIYLDVSV
KTHY_PSEP1      VFAARAQHLAQVIRPALARGAVVLCDRFTDATYAYQGGGRGLSVERIAVLEQFVQGDLRPDLTLVFDLPV
KTHY_LACLM      FAAARRLHMQEKMLPALRAGKVVIVDRFIDSSVAYQGYGRDLGVEVVDWLNYFATDGLKPDLTLYFDIDT
KTHY_SYMTH      FAAARAEHVSRTIRPALEEGKVVICDRFVDSSLVYQGVAGGLPVEFLTQINEMATGALRPHRTIVLDLAP
KTHY_STRU0      YIAARRQHLVEKVLPSLSAGKLVFIDRFIDSSVAYQGEGRGLNKSDIEWLNDFATDGIKPDLTLLFDVPS
KTHY_LACLA      FAAARRLHMQEKMLPALQAGKVVIVDRFIDSSVAYQGYGRDLGVEVVDWLNYFATDGLKPDLTLYFDVDT
KTHY_CLOB8      YAAARRQHLVEKVIPALNQGVIVLCDRFIDSSLAYQGYARNLGIEEVLSINKFAIGEYMPDISVLFDLDP
KTHY_PELCD      YAAARAQHVAEVIRPALDQGKIVLCDRYCDATLAYQGYARGLDLPMVKQLNELAAGNCRPHLTLLLDMPH
KTHY_GLOVI      YATDRAEHLARVVRPALASGAAVLCDRFSDSTVAYQGYGRGLDLGLIERLNAIATGGLLPDLTFWLKLDP
KTHY_THEPX      YASSRAQLVEEKILPAIEEGKIVLLDRFVDSSYVYQGYARGLGIEKVKVVNEIATMGILPDVTIYIDITP
KTHY_THEP3      YASSRAQLVEEKILPAIEEGKIVLLDRFVDSSYVYQGYARGLGIEKVKVVNEIATMGILPDVTIYIDITP
KTHY_SYNSC      YAADRAQHVETLIRPALERGDWVISDRFSGSTLAYQGYGRGLDRDLIQRLEQIATAGLQPDITLWLRLSV
KTHY_EXISA      YAASRAQNVEQVIRPALERGAIVLCDRFIDASIAYQGYGLQYDLDQIRSLNEWATNGLTPDLTFLFDLNP
KTHY_SYNS9      YAADRAQHVDTVIRPALLRGDWVLSDRFAGSTLAYQGYGRGLDRQLITRLESIATTGLEPDLTAWLMVPV
KTHY_STRSV      YIASRRQHLTERVLPALAQGKLVLMDRFIDSSVAYQGYGRGLDVADIEWLNQFATDGLKPDLTLYFDIDV
KTHY_THEEB      YAADRAQHVAMGIRPQLQRGGIVLCDRYTASTVAYQGYGRGLDLQIIQHINQMATGGLGADLVLWLDLPV
KTHY_PSEPW      VFAARAQHLAQVIRPALARGAVVLCDRFTDATYAYQGGGRGLSVERIAALEQFVQGELRPDLTLVFDLPV
KTHY_PEDPA      YAAARRQHLVETILPALKKNHVVFCDRFVDSSIAYQGAGRKIGTDAVYQMNLFATEGALPEKTIYLDVPS
KTHY_SYNR3      YAADRAQHVQTRLEPALAAGDWVLSDRYCGSTAAYQGYGRGLDLDLITQLEQLATAGLQPDLCLWLELSP
KTHY_STRMU      YIAARRQHLVERILPELKKGNLVLVDRFIDSSVAYQGYGRGLDADAVTWLNNFATDGLQPDLTLYFDVDS
KTHY_PSEMY      VFAARAQHLQQVIRPALAKGCVVLCDRFTDATYAYQGGGRGLSIERIAQLEQFVQGELRPDLTLIFDLPV
KTHY_PELPB      FSASRAELVQEVIRPALASGKTIILDRFFDSTTAYQGYGRGIDMELLRSIIAISTCGITPDITFYLDLEP
KTHY_STRPS      YIASRRQHLVEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDIEAIDWLNQFATDGLKPDLTLYFDIEV
KTHY_PROA2      FAASRAELVQKVIKPALSDHATVLLDRFYDSTSAYQGYGRGLDLALLHQINRIASCSLEPDITFYLDLSP
KTHY_DESDG      YLADRSQHVHQVIRPALAEGVAVISDRYADSTVVYQGYGRGLDPALLHRLNDVAVRGLWPDLTLLFDLEP
KTHY_BACCN      YAAARRQHLVEKVMPALEADQLVLCDRFIDSSLAYQGYARGLGIDKVYEMNRFATEDCMPSLTIYLDIAP
KTHY_PSEU5      VFAARAQHLAQVIRPALARGAVVLCDRFTDATYAYQGGGRGLSLERIAQLETFVQGDLRPDLTLIFDLPX
KTHY_CHLPD      FSATRAELVQQVIIPALQTDAVVILDRFYDSTRAYQGYGRGIDLTILETIIAFSTFNLIPDVTFYLDIKP
KTHY_CHLCH      FSASRAELVETLIRPALAEGKTVILDRFFDSTTAYQGHGRGISLEQLHSIIALSTGDLLPDVTFYLDLEP
KTHY_BACCQ      YAAARRQHLVEKVMPALNKDYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEP
KTHY_THEM4      FLASRAQLVEEVIRPSIEKGYFVLADRFSDSSIAYQGGARNLGKDLVEKLNIFATNGXXXXXXXXXXXXX
KTHY_STRZP      YIASRRQHLVEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDIEAIDWLNQFATDGLKPDLTLYFDIEV
KTHY_STRZJ      YIASRRQHLVEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDIEAIDWLNQFATDGLKPDLTLYFDIEV
KTHY_STRR6      YIASRRQHLVEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDIEAIDWLNQFATDGLKPDLTLYFDIEV
KTHY_STRPN      YIASRRQHLVEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDIEAIDWLNQFATDGLKPDLTLYFDIEV
KTHY_STRP7      YIASRRQHLVEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDIEAIDWLNQFATDGLKPDLTLYFDIEV
KTHY_STRP4      YIASRRQHLVEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDIEAIDWLNQFATDGLKPDLTLYFDIEV
KTHY_STRP2      YIASRRQHLVEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDIEAIDWLNQFATDGLKPDLTLYFDIEV
KTHY_STRZT      YIASRRQHLVEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDIEAIDWLNQFATDGLKPDLTLYFDIEV
KTHY_PSYWF      MFAARSDHLAQVIMPALSAGKWVICDRFIDSTVAYQGYGRGFMLHKIEALIAGFVPRL-PDITLWLDLPV
KTHY_OCEIH      YAAARRQHLVEKVFPALEQGKVVLCDRFVDSSLAYQGYARGLGIDEVYAINHFVIQDCMPDLTLFFDIEP
KTHY_STRPI      YIASRRQHLVEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDIEAIDWLNQFATDGLKPDLTLYFDIEV
KTHY_BACSU      YAAARRQHLVEKVKPALEQGFIVLCDRFIDSSLAYQGYARGLGIDEVLSINEFAIGDMMPHVTVYFSIDP
KTHY_BACCR      YAAARRQHLVEKVMPALNEDYLVLCDRFIDSSLAYQGYARGLGMDKIFEINRFATEDCMPSLTIYLDIEP
KTHY_BACC2      YAAARRQHLVEKVMPALNENYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEP
KTHY_THET8      FSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATRGLKPRLTFLLDLPP
KTHY_THET2      FSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATRGLKPRLTFLLDLPP
KTHY_STRPJ      YIASRRQHLVEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDIEAIDWLNQFATDGLKPDLTLYFDIEV
KTHY_EXIS2      YAASRAQHVNELIRPALAAGKIVLCDRFIDASIAYQGYGLGYTIEQVRSINQQATNHLTPDRTYLFDLTV
KTHY_RHOSK      MTAARVQHVRRVIAPALAQGQVVISDRYAGSTLAYQGTGRGLSEAFIRTLHAEATGDLWPDLTLVLDLEA
KTHY_PROMS      YSADRAEHVSKIISPALNNNDWVISDRFSDSTLAYQGYGRNINLEIIKNIESIVCQGASPDLTFFLEISP
KTHY_BACWK      YAAARRQHLVEKVMPALEENYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEP
KTHY_BACHK      YAAARRQHLVEKVMPALNEDYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEP
KTHY_BACCZ      YAAARRQHLVEKVMPALNEDYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEP
KTHY_BACC4      YAAARRQHLVEKVMPALNEKYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEP
KTHY_BACC1      YAAARRQHLVEKVMPALDEDYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEP
KTHY_BACAN      YAAARRQHLVEKVMPALNEDYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEP
KTHY_BACAC      YAAARRQHLVEKVMPALNEDYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEP
KTHY_BACAA      YAAARRQHLVEKVMPALNEDYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEP
KTHY_DESOH      YAADRAQHVRRLIEPALAEGKTVVCDRFADATEVYQGWARGLDMELVQVLNRVATGGRKPDITLLFDLPP
KTHY_BACC7      YAAARRQHLVEKVMPALNEDYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEP
KTHY_WOLPP      FTSMRYEHMKELILPALKEGKTVICDRFIDSTIAYQGYGLGVDLSLIRDLH-KLVEIKYPDITFILDIDV
KTHY_SULSY      YESDRNIHIQSIVKPSLDAGYIVLSDRYIDSTTAYQHYARGIDYEIVSYLNTLATDGLKPNLTFLIDIPV
KTHY_RHOS4      MTAARVQHVRRVIAPALAQGRVVISDRYAGSTLAYQGTGRGLSEAFIRTLHAEATGDLWPDLTLVLDLEA
KTHY_RHOS1      MTAARVQHVRRVIAPALAQGRVVISDRYAGSTLAYQGTGRGLSEAFIRTLHAEATGDLWPDLTLVLDLEA
KTHY_LISW6      IAGARRQHVVETIRPALAAGKTVLCDRFMDSSLAYQGAGRDMDMEQVLQVNLYAIEDTIPDRTYYLDVPA
KTHY_BACC3      YAAARRQHLVEKVMPALNDDYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEP
KTHY_BACAH      YAAARRQHLVEKVMPALNDDYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEP
KTHY_ANASP      YAADRAQHVAQELKPKLAQGKYILCDRYVDSTIAYQGYGRNLDMNLIHQLNDIATGGLTSDITIWLDVDV
KTHY_STAES      FAASRREHLVEKIIPSLQAGKIVLCDRYIDSSLAYQGYARGIGIKEVKLLNEFAINGLYPDLTIYLDVDA
KTHY_STAEQ      FAASRREHLVEKIIPSLQAGKIVLCDRYIDSSLAYQGYARGIGIKEVKLLNEFAINGLYPDLTIYLDVDA
KTHY_LISIN      IAGARRQHVVETIRPALAAGKTVLCDRFMDSSLAYQGAGRDMNMEQVLQVNLYAIEDTIPDRTYYLDVPA
KTHY_BRASO      FAAARDDHVRNVILPALNQGSWVLCDRFFDSTRAYQGSQGKVAPDVLNAMQRVTIGDLKPDLTLILDVPV
KTHY_NITHX      FAAARDDHVHTVIKPALEQGIWVLCDRFADSTRAYQGRLGDVLPGVLNALERVTIGDLKPDLTVILDVPV
KTHY_CHRSD      MFAARAQHLAARIRPALARGAWVVCDRFTDATFAYQGGGRGLDETRIATLEALVQQGLQPDLTLLLDM-P
KTHY_ACISJ      VFAARRDHLRCVIEPALARGEVVLCDRFTDATFAYQGAGRGFDLEVLSYMERLAQTGVNPDLTLWFDVPP
KTHY_GEOKA      YAAARRQHLLEKIVPALEAGCVVLCDRFVDSSLAYQGFARGLGIEEVWKINEFAIDGYMPSLTIYFDIDP
KTHY_SYNPW      YAADRAQHVQRRILPALACGDWVLSDRFSGSTLAYQGDGRGLDRALILDLERIATAGLVPDVTLWLDLSL
KTHY_STRP3      YIAARRQHLVEKVLPALEAGQLVFIDRFIDSSVAYQGAGRGLIKADIQWLNEFATDGLEPDLTLYFDVPS
KTHY_SYNPX      YAADRAQHVERLILPTLERGDWVISDRFSGSTMAYQGYGRGLDRQLIDQLERIATAGVQPDLTLWLTL-P
KTHY_STRE4      YIAARRQHLVEKIMPALESGHLVLVDRFIDSSVAYQGAGRGLDKQAIQWLNHFATDGVDPDLTLYFDVPS
KTHY_PYRFU      FAADRAEHVKKIIEPALREGKVVISDRYFYSSLAYQ-WARGLNLEWLIEINK---FAPHPDIAILLDIPP
KTHY_PROM9      YSADRAEHISKIISPALNNNDWVISDRFSDSTLAYQGYGRKINLEIIKKVESIVCQGEYPDLTFFLEISP
KTHY_DESVM      YLADRAQHVGQVIRPALDEGVVVLSDRYADSTVVYQGYGRGLDPERLRELNDMAVGGLWPDLTLVFDLPP
KTHY_STRS7      YIAARRQHLVEKIMPALEAGHLVLVDRFIDSSVAYQGAGRGLDKQAIQWLNHFATDGVDPDLTLYFDVPS
KTHY_STRPZ      YIAARRQHLVEKVLPALEAGQLVFIDRFIDSSVAYQGAGRGLTKADIQWLNEFATDGLEPDLTLYFDVPS
KTHY_PSEE4      MFAARAQHLAQVIRPALARGAVVLCDRFTDATYAYQGGGRGLSVERI-AILESFVQGLRPDLTLVFDLPV
KTHY_LEUMM      YTAARRQHLVENIKPALDQNKIVISDRYVDSSLAYQGGGRGLGIDNIWEINQFAIDGLLPDMTIYLDVPV
KTHY_WOLTR      LISMRYEHVKKVILPALKKGKIVICDRFIDSTIAYQGYGLGVDLELIRDLH-KLVKIKYPDTTFILDIDV
KTHY_STRP1      YIAARRQHLVEKVLPALEAGQLVFIDRFIDSSVAYQGAGRGLIKADIQWLNEFATDGLEPDLTLYFDVPS
KTHY_LEUCK      YAAARRQHIVETILPALSAGKVLISDRYVDSSLAYQGGGRDLGVDNIWQINQFAIDGLLPDLTIYFDVPS
KTHY_LACCB      YAASRRQHLVEVIQPALAQGDIVVCDRFVDSSVAYQGGGREIGPDAVLKMNQFATAGLEPALTLYLDVPV
KTHY_LACC3      YAASRRQHLVEVIQPALAQGDIVVCDRFVDSSVAYQGGGREIGPDAVLKMNQFATAGLEPALTLYLDVPV
KTHY_DESVV      YLADRAQHVAQVVRPALDEGMVVLSDRYADSTVVYQGYGRGLDPMMLRQFNDVAVGGLWPDLTILLDLEP
KTHY_DEIRA      YSASRAQLVREVLRPALERGETVLCDRYADSSLAYQGAGRGLSLPLLRQITAEXXXXXXXXXXXXXXXXX
KTHY_DEHSB      FNASRSILIDNVIKPALQDGKIVICDRYTDSTLAYQGYGRGLDLDTVKCVNSLASGGLVPDLTIWLDMDD
KTHY_DECAR      MFAARREHLARLIEPALARGEWVVCDRFSDATYAYQGGGRGLDRAKFLALEHWVHGHXXXXXXXXXXXXX
KTHY_STRP6      YIAARRQHLVEKVLPALEAGQLVFIDRFIDSSVAYQGAGRGLIKADIQWLNEFATDGLEPDLTLYFDVPS
KTHY_PROM0      YSADRAEHVSKIILPALNNNDWVISDRFSDSTLAYQGYGRNINLEIIKNIESIVCQGASPDLTFFLEISP
KTHY_POLSJ      IFAARRDHLVRVIAPALVRGDVVLCDRFTDATFAYQGAGRGFDLAVLATLSDEGLLGIEPHLTVWFDLPP
KTHY_DESVH      YLADRAQHVAQVVRPALDEGMVVLSDRYADSTVVYQGYGRGLDPMMLRQFNDVAVGGLWPDLTILLDLEP
KTHY_BACLD      YAAARRQHLVEKVKPALEEGKIVLCDRFIDSSLAYQGYARGLGIDEVFSVNQFAIGSLMPNVTIYFDIDP
KTHY_ACAM1      FAADRAQHVSSCLLPHLQQGALVLCDRYTDSTIAYQGYGRELDLTLIHQLNQIATQGLVSDLTFWLDIDP
KTHY_STRPG      YIAARRQHLVEKVLPALEAGQLVFIDRFIDSSVAYQGAGRGLIKADIQWLNEFATDGLEPDLTLYFDVPS
KTHY_STRP8      YIAARRQHLVEKVLPALEAGQLVFIDRFIDSSVAYQGAGRGLIKADIQWLNEFATDGLEPDLTLYFDVPS
KTHY_RALME      MFAARREHIAEVIEPALARGDWVISDRFTDATFAYQXXXXXXXXXXXXXXEQWVQSGLQPDLTLLFDVPL
KTHY_MESSB      FAAARSDHVEQVIRPAVESGAIVLCDRFLDSSRVYQGVTGGLASDFMAALERVTVNGLIPDLTVILDIDP
KTHY_LISMO      IAGARRQHVVETIRPALAAGKSVLCDRFMDSSLAYQGAGRDMNMEQVLQVNLYAIEDTLPDRTYYLDVPA
KTHY_LISMH      IAGARRQHVVETIRPALAVGKTVLCDRFMDSSLAYQGAGRDMDMEQVLQVNLYAIEDTLPDRTYYLDVPA
KTHY_RICAE      VMAARYDHMARKIIPALQEGHIVICDRFIDSTVCYQGLELENGIDLVYNLHKTLMPSLMPDITFFIDVEP
KTHY_PSEAE      MFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPV
KTHY_PSEA8      MFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPV
KTHY_NEOSM      IVSARVDHYNKVILPALKEGKVVVCDRFIYSTLAYQGYGDKIDLQTI--LDLHRLSGCEPD---------
KTHY_LISMF      IAGARRQHVVETIRPALAAGKTVLCDRFMDSSLAYQGAGRDMNMEQVLQVNLYAIEDTLPDRTYYLDVPA
KTHY_LISMC      IAGARRQHVVETIRPALAAGKTVLCDRFMDSSLAYQGAGRDMNMEQVLQVNLYAIEDTLPDRTYYLDVPA
KTHY_DEHSC      FNASRSILIDNVIKPALQDGKIVICDRYTDSTLAYQGYGRGLDLDTVKCVNSLASGGLVPDLTIWLDMDD
KTHY_BACA2      YAAARRQHLAEKVQPALKEGRIVLCDRFIDSSLAYQGYARGLGIDEVLSINQFAIGDTMPDVTIYFSIEP
KTHY_PSEA7      MFAARAQHIAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPV
KTHY_NOSP7      YAADRSQHVEQELKPNLAAGKYILCDRYTDSTIAYQGYGRGLNMSLINQLNYIATAGLESDLTIWLDIDV
KTHY_STRTD      YIAARRQHLVEKVLPELENGNMVIMDRFIDSSVAYQGAGRGLDQDEVAWLNNYATDGHKPDLTLLFDVDS
KTHY_STRT2      YIAARRQHLVEKVLPELENGNMVIMDRFIDSSVAYQGAGRGLDQDEVAWLNNYATDGHKPDLTLLFDVDS
KTHY_STRT1      YIAARRQHLVEKVLPELENGNMVIMDRFIDSSVAYQGAGRGLDQDEVAWLNNYATDGHKPDLTLLFDVDS
KTHY_STAAW      FAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSA
KTHY_STAAS      FAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSA
KTHY_STAAR      FAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSA
KTHY_STAAN      FAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSA
KTHY_STAAM      FAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSA
KTHY_STAAC      FAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSA
KTHY_STAAB      FAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSA
KTHY_STAA9      FAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSA
KTHY_STAA8      FAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSA
KTHY_STAA3      FAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSA
KTHY_STAA2      FAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSA
KTHY_STAA1      FAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSA
KTHY_RICBR      AMAARYDHMVKKIIPALQAGNIVICDRFIDSTACYQGLENGIEL--VYNLHKDLMPPLMPDLTFFIDVES
KTHY_LACRJ      FAAARRQHIVSEIIPGLKAGKVILCDRFVDSSIAYQGAGRGLGEKEIWQINQFAIDGLMPALTIYLDIES
KTHY_LACRD      FAAARRQHIVSEIIPGLKAGKVILCDRFVDSSIAYQGAGRGLGEKEIWQINQFAIDGLMPALTIYLDIES
KTHY_RICCN      AMAARYDHMARKIIPALQEGHIVICDRFIESTVCYQGLELENGIDLVYNLHKTLMPSLMPDITFFIDVEP
KTHY_RICB8      AMAARYDHMVKKIIPALQAGNIVICDRFIDSTACYQGLENGIEL--VYNLHKDLMPPLMPDLTFFIDVES
KTHY_PROMA      YAADRAQHVSQVIQPKINNGDWVISDRFSSSTLAYQGFGRRLDKSLIKELENIATQGITPDLTFLLEIPV
KTHY_DEHE1      FNASRSILIDNVIKPALLDGNIVICDRYTDSTLAYQGYGRGLELDTVKCINSLASGGLVPDLTIWLDMDD
KTHY_STAHJ      FAASRREHLVEKVVPALNDNKIVLCDRYIDSSLAYQGYARGIGIEEVKQLNDFAINGLYPDLTIYLDITA
KTHY_RICM5      AIAARYDHMARKIIPALQEGHIVICDRFIDSTACYQGLELENGIDLVYNLHKTLMPSLMPDITFFIDVEP
KTHY_PELPD      YAAARAQHVSEVIIPALKQGNIVLCDRFSDATLAYQGSGRGIAREKVDTLNQLACQSLRPDLTVLIDCDV
KTHY_LACSS      YAAARRQHIVEKIQPALAADKLVICDRFVDSSIAYQGAGRGIGEEAVAQMNLFATDGLTPDLTLYLDVPS
KTHY_THEMA      FLAS-----RNLIKQYLSEGYAVLLDRYTDSSVAYQGFGRNLGKEIVEELNDFATDGLIPDLTFYIDVDV
KTHY_ROSS1      FSAARAQLVSEVIRPYLEQGGIVLCDRYADSTFAYQGYGLGRDLAELRVITAAATGGLRPDITFYLDISA
KTHY_RICTY      AMAARYDHMVRKIIPALKDGYIVICDRFIDSTACYQGLELENGIDLVYSLHTTLMPSLMPDITFFIDVEP
KTHY_PSEAB      MFAARAQHIAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEVRIAALESFVQGDLRPDLTLVFDLPV
KTHY_LACF3      YAASRRQHVVETLKPALEAGKLILCDRYLDSSIAYQGGGRELGIDRIWELNQYAIDGLLPDLTIFLDLPV
KTHY_MYCGE      FAAARTEHISKLIKPAIEKEQLVISDRFVFSSFAYQGLSKKIGIDTVKQINHHALRNMMPNFTFILDCNF
KTHY_RICFE      AMAARYDHMVRKIIPALQDGHIVICDRFIDSTACYQGLELENGIDLVYNLHKTLMPSLMPDITFFIDVEP
KTHY_OLICO      FAAARDDHVHQVIEPALKKGVWVLCDRFTDSTAAYQGAAGKVDAAFIEALTHATIGDLEPDLTLILDVPV
KTHY_THESQ      FLAS-----RNLIKQYLSEGYAVLLDRYTDSSVAYQGFGRNLGKEIVEELNDLATDGLIPDLTFYIDVDV
KTHY_RICRS      AMAARYDHMARKIIPALQEGHIVICDRFIDSTVCYQGLELENGIDLVYNLHKTLMPSLMPDITFFIDVEP
KTHY_RICRO      AMAARYDHMARKIIPALQEGHIVICDRFIDSTVCYQGLELENGIDLVYNLHKTLMPSLMPDITFFIDVEP
KTHY_MYCGA      FCASRNEHLKKKILPALNENKIAICDRFVVSSWIYQGLIKNAGYEKVKKINEYVTDGLEPDLTILFDVDP
KTHY_SILPO      FTAARRDHLERTIEPALAAGRVVICDRFADSTRMYQGLSRG-DLRQLVDQLHALMIGREPDLTLLVDMDP
KTHY_RICPR      AMAARYDHMARKIIPALKDGYIVICDRFIDSTACYQGLELENGIDLVYSLHKTLMPSLMPDITFFIDVEP
KTHY_HALHL      VFAARAEHLAQVIRPTLDAGRWVISDRFTDATYAYQGGGRGLGDERIAVLERWVHGGFTPDRTLLLDVDP
KTHY_DICNV      ILAARHEHLQTVILPHLAAGTWVISDRFNDATYAYQGYGRGIDLKIIKTLEQIIQASFQPDLACILCLPE
KTHY_BDEBA      YEASRSQHVDQVIRPALAAGTWVLCDRFAASSVAFQSGGRAISEADVVMLNTFATGGLKADITVLLDLSV
KTHY_ACIAC      VFAGRRDHLRSVIAPALVRGEVVLCDRFTDATFAYQGAGRGFDRAVLAQLERITQSGLQPHLTLWFDLAP
KTHY_RICPU      AMAARYDHMARKIIPALQEGHIVICDRFIDSTVCYQGLELENGIDLVYNLHKTLMPSLMPDITFFIDVEP
KTHY_NITWN      FAAARDDHVHTVIKPALEQGIWVLCDRFADSTRVYQGQLGNVLPGVLNAMERVTIGDLKPDLTVILDVPV
KTHY_AYWBP      FAADRAEHLSKLIIPALQQNKIVICDRYLDSTIAYQVYARGLSKDFVLNINNLALN-YMPNITFYLDLDP
KTHY_OENOB      FAAARAQHMVEKIEPALADGKIVLSDRFVDSSIAYQGGGRELGIEAVGEINNFATNGXXXXXXXXXXXPS
KTHY_THEP1      FLAS-----RNLIKRYLSEGYVVLLDRYTDSSVAYQGFGRNLGKEIVEKLNDFATDSLVPDLTFYIDVDV
KTHY_RICCK      AMAARYDHMVRKIIPVLKEGYIVICDRFLDSTACYQGLELENGIDLVYNLHKTLMPPLMPDITFFIDVEP
KTHY_CHLTE      FAASRAELVQQVIQPALENDSDVILDRFFDSTTAYQGYGRGLDLDMLAEINRIASCRLVPDVTFYLDLTP
KTHY_RHOFD      VFAARRDHLQQLIEPALARGDVVLCDRFTDATFAYQGAGRGFDLQSIQGLEPDFIR--NPDLTVWFDLXX
KTHY_DINSH      FTAARRDHLERLIQPALAEGRDVITDRFADSTRVYQGATRG----DLRALVDSLMIGREPDLTFVIDMPP
KTHY_LACPL      YAAARRQHIVQTIQPALQNDQLVLCDRYIDSSVAYQGAGRGIGEQAVYDMNQFATAGLTADLTLYFDVDA
KTHY_JANSC      FTAARRDHLERTIRPALASGRDV