[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30290.1

[Show Plain Result]


## Summary of Sequence Search
    1::1417
    1::1417      0.0 100% 1417 aa  RPOC_FRATM RecName: Full=DNA-directed RNA polymerase subunit beta';  
    1::1417      0.0 100% 1417 aa  RPOC_FRATW RecName: Full=DNA-directed RNA polymerase subunit beta';  
    1::1417      0.0 100% 1417 aa  RPOC_FRATT RecName: Full=DNA-directed RNA polymerase subunit beta';  
    1::1417      0.0 100% 1417 aa  RPOC_FRATN RecName: Full=DNA-directed RNA polymerase subunit beta';  
    1::1417      0.0 100% 1417 aa  RPOC_FRAT1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    1::1417      0.0 100% 1417 aa  RPOC_FRATO RecName: Full=DNA-directed RNA polymerase subunit beta';  
    1::1417      0.0 100% 1417 aa  RPOC_FRATH RecName: Full=DNA-directed RNA polymerase subunit beta';  
    1::1416      0.0  95% 1416 aa  RPOC_FRAP2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1368      0.0  63% 1399 aa  RPOC_PSEPF RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1368      0.0  63% 1399 aa  RPOC_PSEE4 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1368      0.0  63% 1399 aa  RPOC_PSEF5 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1376      0.0  62% 1399 aa  RPOC_PSEA7 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1368      0.0  62% 1399 aa  RPOC_PSEU5 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1368      0.0  63% 1399 aa  RPOC_PSEPG RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1376      0.0  62% 1399 aa  RPOC_PSEAE RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1376      0.0  62% 1399 aa  RPOC_PSEAB RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1368      0.0  63% 1399 aa  RPOC_PSEPW RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1368      0.0  63% 1399 aa  RPOC_PSEPK RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1368      0.0  63% 1399 aa  RPOC_PSEP1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1368      0.0  62% 1399 aa  RPOC_PSEFS RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1375      0.0  62% 1399 aa  RPOC_PSEU2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1375      0.0  62% 1399 aa  RPOC_PSE14 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1375      0.0  62% 1399 aa  RPOC_PSESM RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1368      0.0  62% 1399 aa  RPOC_PSEMY RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1389      0.0  63% 1407 aa  RPOC_CELJU RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1355      0.0  63% 1401 aa  RPOC_LEGPH RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1355      0.0  63% 1401 aa  RPOC_LEGPC RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1355      0.0  63% 1401 aa  RPOC_LEGPA RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1355      0.0  63% 1401 aa  RPOC_LEGPL RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1374      0.0  62% 1410 aa  RPOC_SACD2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1378      0.0  61% 1404 aa  RPOC_SHEAM RecName: Full=DNA-directed RNA polymerase subunit beta';  
   21::1360      0.0  61% 1397 aa  RPOC_ACIAD RecName: Full=DNA-directed RNA polymerase subunit beta';  
   21::1360      0.0  61% 1397 aa  RPOC_ACIBY RecName: Full=DNA-directed RNA polymerase subunit beta';  
   21::1360      0.0  61% 1397 aa  RPOC_ACIBT RecName: Full=DNA-directed RNA polymerase subunit beta';  
   21::1360      0.0  61% 1397 aa  RPOC_ACIBC RecName: Full=DNA-directed RNA polymerase subunit beta';  
   21::1360      0.0  61% 1397 aa  RPOC_ACIBS RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1378      0.0  62% 1401 aa  RPOC_VIBF1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1396      0.0  61% 1403 aa  RPOC_NITOC RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1378      0.0  61% 1405 aa  RPOC_SHESR RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1378      0.0  61% 1405 aa  RPOC_SHEON RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1378      0.0  61% 1405 aa  RPOC_SHESM RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1363      0.0  61% 1400 aa  RPOC_MARMS RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1400      0.0  62% 1400 aa  RPOC_VIBPA RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1378      0.0  62% 1401 aa  RPOC_VIBCH RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1378      0.0  62% 1401 aa  RPOC_VIBC3 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1400      0.0  61% 1400 aa  RPOC_VIBVY RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1400      0.0  61% 1400 aa  RPOC_VIBVU RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1383      0.0  62% 1430 aa  RPOC_HALHL RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1391      0.0  61% 1426 aa  RPOC_ALHEH RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1378      0.0  61% 1405 aa  RPOC_SHESA RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1372      0.0  61% 1408 aa  RPOC_NITMU RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1385      0.0  60% 1404 aa  RPOC_AZOSB RecName: Full=DNA-directed RNA polymerase subunit beta';  
   11::1392      0.0  61% 1420 aa  RPOC_HAEDU RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1376      0.0  61% 1408 aa  RPOC_THICR RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1367      0.0  61% 1406 aa  RPOC_COLP3 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1400      0.0  61% 1400 aa  RPOC_VIBHB RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1392      0.0  61% 1396 aa  RPOC_HAHCH RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1385      0.0  60% 1409 aa  RPOC_AZOSE RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1376      0.0  61% 1404 aa  RPOC_NITEU RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1378      0.0  60% 1405 aa  RPOC_SHESW RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1378      0.0  60% 1405 aa  RPOC_SHEPC RecName: Full=DNA-directed RNA polymerase subunit beta';  
   16::1368      0.0  61% 1400 aa  RPOC_ALCBS RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1378      0.0  60% 1405 aa  RPOC_SHEB9 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1378      0.0  60% 1405 aa  RPOC_SHEB8 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1378      0.0  60% 1405 aa  RPOC_SHEB2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1385      0.0  60% 1396 aa  RPOC_CHRVO RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1372      0.0  60% 1409 aa  RPOC_METFK RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1368      0.0  60% 1410 aa  RPOC_SHEDO RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1383      0.0  61% 1404 aa  RPOC_XANC5 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1383      0.0  61% 1404 aa  RPOC_XANAC RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1387      0.0  61% 1404 aa  RPOC_PHOPR RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1364      0.0  61% 1406 aa  RPOC_STRMK RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1394      0.0  61% 1404 aa  RPOC_NITEC RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1384      0.0  61% 1405 aa  RPOC_XANCP RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1384      0.0  61% 1405 aa  RPOC_XANC8 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1384      0.0  61% 1405 aa  RPOC_XANOR RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1384      0.0  61% 1405 aa  RPOC_XANOP RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1384      0.0  61% 1405 aa  RPOC_XANOM RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1384      0.0  61% 1405 aa  RPOC_XANCB RecName: Full=DNA-directed RNA polymerase subunit beta';  
   11::1380      0.0  61% 1423 aa  RPOC_ACTP7 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1368      0.0  60% 1404 aa  RPOC_SHEHH RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1380      0.0  60% 1408 aa  RPOC_SHEFN RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1386      0.0  61% 1414 aa  RPOC_COXBN RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1385      0.0  60% 1404 aa  RPOC_MARAV RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1379      0.0  60% 1400 aa  RPOC_METCA RecName: Full=DNA-directed RNA polymerase subunit beta';  
   11::1378      0.0  61% 1412 aa  RPOC_ACTP2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1386      0.0  61% 1414 aa  RPOC_COXBU RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1386      0.0  61% 1414 aa  RPOC_COXBR RecName: Full=DNA-directed RNA polymerase subunit beta';  
   11::1416      0.0  60% 1420 aa  RPOC_BLOFL RecName: Full=DNA-directed RNA polymerase subunit beta';  
   11::1378      0.0  61% 1423 aa  RPOC_ACTPJ RecName: Full=DNA-directed RNA polymerase subunit beta';  
   11::1392      0.0  60% 1417 aa  RPOC_PASMU RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1364      0.0  61% 1404 aa  RPOC_SHELP RecName: Full=DNA-directed RNA polymerase subunit beta';  
   11::1403      0.0  60% 1416 aa  RPOC_BLOPB RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1368      0.0  61% 1404 aa  RPOC_SHEPW RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1372      0.0  61% 1419 aa  RPOC_ACTSZ RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1378      0.0  59% 1398 aa  RPOC_THIDA RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1377      0.0  61% 1406 aa  RPOC_PHOLL RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1368      0.0  60% 1405 aa  RPOC_SHEWM RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1372      0.0  61% 1402 aa  RPOC_DICNV RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1362      0.0  61% 1406 aa  RPOC_PSYIN RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1368      0.0  60% 1404 aa  RPOC_SHEPA RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1368      0.0  60% 1405 aa  RPOC_SHESH RecName: Full=DNA-directed RNA polymerase subunit beta';  
   11::1371      0.0  61% 1420 aa  RPOC_MANSM RecName: Full=DNA-directed RNA polymerase subunit beta';  
   11::1395      0.0  60% 1420 aa  RPOC_HAES2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1363      0.0  59% 1412 aa  RPOC_BORPD RecName: Full=DNA-directed RNA polymerase subunit beta';  
   11::1395      0.0  60% 1420 aa  RPOC_HAES1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1362      0.0  61% 1407 aa  RPOC_XYLFT RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1362      0.0  61% 1407 aa  RPOC_XYLF2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1373      0.0  60% 1413 aa  RPOC_BURM1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  62% 1407 aa  RPOC_ENTS8 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1369      0.0  61% 1409 aa  RPOC_SHEVI RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1362      0.0  61% 1411 aa  RPOC_XYLFM RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1362      0.0  61% 1407 aa  RPOC_XYLFA RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1380      0.0  61% 1411 aa  RPOC_IDILO RecName: Full=DNA-directed RNA polymerase subunit beta';  
   11::1392      0.0  60% 1416 aa  RPOC_HAEIE RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1379      0.0  58% 1414 aa  RPOC_HERAR RecName: Full=DNA-directed RNA polymerase subunit beta';  
   11::1392      0.0  60% 1416 aa  RPOC_HAEI8 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   11::1392      0.0  60% 1415 aa  RPOC_HAEIN RecName: Full=DNA-directed RNA polymerase subunit beta';  
   11::1392      0.0  60% 1416 aa  RPOC_HAEIG RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1363      0.0  59% 1413 aa  RPOC_BORA1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1370      0.0  59% 1391 aa  RPOC_NEIMF RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1363      0.0  60% 1405 aa  RPOC_CHRSD RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1373      0.0  60% 1413 aa  RPOC_BURVG RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1363      0.0  59% 1414 aa  RPOC_BORPE RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1363      0.0  59% 1414 aa  RPOC_BORPA RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1363      0.0  59% 1414 aa  RPOC_BORBR RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1370      0.0  60% 1409 aa  RPOC_RALSO RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1384      0.0  60% 1412 aa  RPOC_BURTA RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1373      0.0  60% 1413 aa  RPOC_BURCM RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1373      0.0  60% 1413 aa  RPOC_BURA4 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1384      0.0  60% 1412 aa  RPOC_BURPS RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1384      0.0  60% 1412 aa  RPOC_BURP6 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1384      0.0  60% 1412 aa  RPOC_BURP1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1384      0.0  60% 1412 aa  RPOC_BURP0 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1406 aa  RPOC_YERPY RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1406 aa  RPOC_YERPS RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1406 aa  RPOC_YERPP RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1406 aa  RPOC_YERPN RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1406 aa  RPOC_YERPG RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1406 aa  RPOC_YERPE RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1406 aa  RPOC_YERPB RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1406 aa  RPOC_YERPA RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1406 aa  RPOC_YERP3 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1381      0.0  59% 1403 aa  RPOC_DECAR RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1384      0.0  60% 1412 aa  RPOC_BURMS RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1384      0.0  60% 1412 aa  RPOC_BURMA RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1384      0.0  60% 1412 aa  RPOC_BURM9 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1401      0.0  62% 1434 aa  RPOC_TOLAT RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1384      0.0  59% 1413 aa  RPOC_BURCH RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1384      0.0  59% 1413 aa  RPOC_BURCC RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1384      0.0  59% 1413 aa  RPOC_BURCA RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1406 aa  RPOC_YERE8 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1370      0.0  60% 1391 aa  RPOC_NEIMA RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1384      0.0  59% 1413 aa  RPOC_BURCJ RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1378      0.0  59% 1408 aa  RPOC_BAUCH RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1373      0.0  59% 1406 aa  RPOC_PSYWF RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1373      0.0  60% 1412 aa  RPOC_BURXL RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1384      0.0  59% 1414 aa  RPOC_BURS3 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1373      0.0  60% 1412 aa  RPOC_BURPP RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1370      0.0  60% 1391 aa  RPOC_NEIMB RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1370      0.0  60% 1391 aa  RPOC_NEIG1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1384      0.0  60% 1412 aa  RPOC_BURM7 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1370      0.0  60% 1391 aa  RPOC_NEIM0 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1373      0.0  59% 1413 aa  RPOC_BURP8 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_CITK8 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1367      0.0  59% 1395 aa  RPOC_PSEA6 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1370      0.0  60% 1391 aa  RPOC_NEIG2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  60% 1413 aa  RPOC_BUCAP RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1377      0.0  61% 1406 aa  RPOC_SODGM RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1370      0.0  60% 1414 aa  RPOC_CUPTR RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1383      0.0  59% 1420 aa  RPOC_POLNS RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1370      0.0  59% 1415 aa  RPOC_RALEH RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_ERWT9 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1370      0.0  59% 1415 aa  RPOC_RALEJ RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1377      0.0  60% 1405 aa  RPOC_WIGBR RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1391      0.0  61% 1434 aa  RPOC_AERS4 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1391      0.0  62% 1434 aa  RPOC_AERHH RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1377      0.0  60% 1407 aa  RPOC_LEPCP RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1408 aa  RPOC_SERP5 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1373      0.0  60% 1412 aa  RPOC_METPP RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1370      0.0  59% 1413 aa  RPOC_RALME RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1361      0.0  59% 1390 aa  RPOC_PSEHT RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_ENT38 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1361      0.0  60% 1409 aa  RPOC_DELAS RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1379      0.0  60% 1407 aa  RPOC_SALPA RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1367      0.0  59% 1398 aa  RPOC_PSEPU RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1383      0.0  59% 1420 aa  RPOC_POLSQ RecName: Full=DNA-directed RNA polymerase subunit beta';  
   11::1376      0.0  60% 1399 aa  RPOC_PSYCK RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1399      0.0  59% 1406 aa  RPOC_PSYA2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_SALPB RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_SALTY RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_SALTI RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_SALCH RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_SALAR RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1362      0.0  61% 1411 aa  RPOC_ACIAC RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1367      0.0  60% 1390 aa  RPOC_ALTMD RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1362      0.0  60% 1411 aa  RPOC_VEREI RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1368      0.0  58% 1414 aa  RPOC_JANMA RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_SHISS RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_SHIFL RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_SHIDS RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_SHIBS RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_ECOLI RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_ECOLC RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_ECOHS RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_ECODH RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_ECO57 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_ECO24 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_SHIB3 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1375      0.0  59% 1408 aa  RPOC_POLSJ RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1396      0.0  60% 1407 aa  RPOC_ERWCT RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_ECOSM RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_SHIF8 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_ECOUT RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_ECOK1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_KLEP7 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_ECOL6 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1373      0.0  59% 1405 aa  RPOC_RHOFD RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1368      0.0  61% 1407 aa  RPOC_ECOL5 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1368      0.0  60% 1407 aa  RPOC_BUCAI RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1373      0.0  59% 1409 aa  RPOC_VARPS RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1362      0.0  60% 1409 aa  RPOC_DIAST RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1362      0.0  60% 1409 aa  RPOC_ACISJ RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1356      0.0  57% 1393 aa  RPOC_VESOH RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1371      0.0  59% 1404 aa  RPOC_BUCBP RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1351      0.0  57% 1377 aa  RPOC_GEOUR RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1352      0.0  57% 1392 aa  RPOC_GEOMG RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1351      0.0  56% 1377 aa  RPOC_GEOSF RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1356      0.0  58% 1395 aa  RPOC_RUTMC RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1375      0.0  59% 1404 aa  RPOC_POLNA RecName: Full=DNA-directed RNA polymerase subunit beta';  
   27::1352      0.0  57% 1382 aa  RPOC_GEOSM RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1347      0.0  58% 1375 aa  RPOC_BDEBA RecName: Full=DNA-directed RNA polymerase subunit beta';  
   27::1352      0.0  57% 1382 aa  RPOC_GEOBB RecName: Full=DNA-directed RNA polymerase subunit beta';  
   19::1350      0.0  56% 1385 aa  RPOC_GEOLS RecName: Full=DNA-directed RNA polymerase subunit beta';  
   33::1374      0.0  56% 1412 aa  RPOC_MAGSM RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1376      0.0  56% 1409 aa  RPOC_PELPD RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1361      0.0  55% 1405 aa  RPOC_MARMM RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1368      0.0  56% 1394 aa  RPOC_ANASK RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1368      0.0  56% 1394 aa  RPOC_ANADE RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1350      0.0  56% 1396 aa  RPOC_PELCD RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1354      0.0  57% 1403 aa  RPOC_MYXXD RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1364      0.0  56% 1395 aa  RPOC_ANADF RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1371      0.0  56% 1410 aa  RPOC_BUCCC RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1374      0.0  55% 1413 aa  RPOC_SILPO RecName: Full=DNA-directed RNA polymerase subunit beta';  
    1::1362      0.0  55% 1410 aa  RPOC_SILST RecName: Full=DNA-directed RNA polymerase subunit beta';  
   16::1348      0.0  55% 1381 aa  RPOC_SYNAS RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1394      0.0  58% 1427 aa  RPOC_SORC5 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    1::1362      0.0  55% 1414 aa  RPOC_ROSDO RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1384      0.0  54% 1398 aa  RPOC_RHILO RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1378      0.0  55% 1415 aa  RPOC_DINSH RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1388      0.0  54% 1399 aa  RPOC_MESSB RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1364      0.0  54% 1405 aa  RPOC_METPB RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1351      0.0  55% 1427 aa  RPOC_SPHAL RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1393      0.0  53% 1394 aa  RPOC_CAUSK RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1375      0.0  54% 1398 aa  RPOC_BRAJA RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1375      0.0  55% 1396 aa  RPOC_CAUCR RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1362      0.0  55% 1402 aa  RPOC_PARDP RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1371      0.0  54% 1394 aa  RPOC_BEII9 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1371      0.0  54% 1371 aa  RPOC_THEYD RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1385      0.0  53% 1393 aa  RPOC_RHORT RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1364      0.0  53% 1405 aa  RPOC_METEP RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1364      0.0  53% 1405 aa  RPOC_METC4 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1376      0.0  54% 1400 aa  RPOC_RHOPS RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1383      0.0  54% 1397 aa  RPOC_PARL1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   20::1378      0.0  55% 1402 aa  RPOC_RHOPA RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1361      0.0  54% 1399 aa  RPOC_OLICO RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1376      0.0  55% 1400 aa  RPOC_RHOPT RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1398      0.0  55% 1430 aa  RPOC_RHOCS RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1376      0.0  53% 1404 aa  RPOC_JANSC RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1376      0.0  54% 1400 aa  RPOC_RHOP2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1367      0.0  54% 1403 aa  RPOC_METRJ RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1363      0.0  54% 1415 aa  RPOC_RHOS5 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   10::1374      0.0  56% 1398 aa  RPOC_GLUDA RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1376      0.0  54% 1401 aa  RPOC_RHOPB RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1376      0.0  54% 1399 aa  RPOC_NITWN RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1363      0.0  54% 1415 aa  RPOC_RHOS4 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1363      0.0  54% 1415 aa  RPOC_RHOS1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1359      0.0  55% 1387 aa  RPOC_GRABC RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1372      0.0  53% 1393 aa  RPOC_AZOC5 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1377      0.0  53% 1400 aa  RPOC_BRUO2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1377      0.0  53% 1400 aa  RPOC_BRUME RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1377      0.0  53% 1400 aa  RPOC_BRUMB RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1377      0.0  53% 1400 aa  RPOC_BRUC2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   16::1345      0.0  56% 1349 aa  RPOC_DESPS RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1377      0.0  53% 1400 aa  RPOC_BRUSU RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1377      0.0  53% 1400 aa  RPOC_BRUSI RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1376      0.0  54% 1399 aa  RPOC_NITHX RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1380      0.0  53% 1400 aa  RPOC_METS4 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1377      0.0  53% 1400 aa  RPOC_BRUAB RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1377      0.0  53% 1400 aa  RPOC_BRUA2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1377      0.0  53% 1400 aa  RPOC_BRUA1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1378      0.0  53% 1402 aa  RPOC_BARHE RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1353      0.0  54% 1427 aa  RPOC_NOVAD RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1389      0.0  53% 1402 aa  RPOC_RHIEC RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1380      0.0  53% 1400 aa  RPOC_METNO RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1388      0.0  52% 1402 aa  RPOC_AGRT5 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1388      0.0  52% 1401 aa  RPOC_RHIME RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1376      0.0  55% 1386 aa  RPOC_DESDG RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1354      0.0  54% 1388 aa  RPOC_ACICJ RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1389      0.0  53% 1402 aa  RPOC_RHIE6 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1379      0.0  53% 1403 aa  RPOC_BART1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1388      0.0  52% 1401 aa  RPOC_SINMW RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1384      0.0  53% 1385 aa  RPOC_DESVV RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1384      0.0  53% 1385 aa  RPOC_DESVH RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1377      0.0  52% 1400 aa  RPOC_OCHA4 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1372      0.0  54% 1399 aa  RPOC_BRASB RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1352      0.0  54% 1423 aa  RPOC_SPHWW RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1372      0.0  53% 1399 aa  RPOC_BRASO RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1389      0.0  52% 1402 aa  RPOC_RHIL3 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1379      0.0  53% 1403 aa  RPOC_BARBK RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1351      0.0  54% 1351 aa  RPOC_SYNFM RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1361      0.0  54% 1402 aa  RPOC_HYPNA RecName: Full=DNA-directed RNA polymerase subunit beta';  
   26::1388      0.0  54% 1388 aa  RPOC_LAWIP RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1388      0.0  53% 1402 aa  RPOC_BARQU RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1376      0.0  53% 1400 aa  RPOC_RHOP5 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1427      0.0  55% 1439 aa  RPOC_GLUOX RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1368      0.0  54% 1438 aa  RPOC_ERYLH RecName: Full=DNA-directed RNA polymerase subunit beta';  
   13::1351      0.0  53% 1391 aa  RPOC_ZYMMO RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1372      0.0  52% 1394 aa  RPOC_XANP2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1352      0.0  52% 1403 aa  RPOC_SOLUE RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1354      0.0  52% 1389 aa  RPOC_PELUB RecName: Full=DNA-directed RNA polymerase subunit beta';  
   12::1370      0.0  52% 1372 aa  RPOC_RICTY RecName: Full=DNA-directed RNA polymerase subunit beta';  
   12::1370      0.0  52% 1372 aa  RPOC_RICPR RecName: Full=DNA-directed RNA polymerase subunit beta';  
   12::1354      0.0  53% 1361 aa  RPOC_RICBR RecName: Full=DNA-directed RNA polymerase subunit beta';  
   12::1369      0.0  53% 1372 aa  RPOC_RICB8 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   12::1370      0.0  52% 1372 aa  RPOC_RICRS RecName: Full=DNA-directed RNA polymerase subunit beta';  
   12::1370      0.0  52% 1372 aa  RPOC_RICRO RecName: Full=DNA-directed RNA polymerase subunit beta';  
   12::1350      0.0  51% 1403 aa  RPOC_ACIBL RecName: Full=DNA-directed RNA polymerase subunit beta';  
   12::1370      0.0  52% 1372 aa  RPOC_RICAH RecName: Full=DNA-directed RNA polymerase subunit beta';  
   12::1369      0.0  52% 1372 aa  RPOC_RICCN RecName: Full=DNA-directed RNA polymerase subunit beta';  
   12::1370      0.0  52% 1372 aa  RPOC_RICFE RecName: Full=DNA-directed RNA polymerase subunit beta';  
   12::1370      0.0  52% 1378 aa  RPOC_RICCK RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1372      0.0  52% 1374 aa  RPOC_RICM5 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   13::1350      0.0  51% 1375 aa  RPOC_NEOSM RecName: Full=DNA-directed RNA polymerase subunit beta';  
   13::1393      0.0  52% 1410 aa  RPOC_EHRCJ RecName: Full=DNA-directed RNA polymerase subunit beta';  
   13::1358      0.0  52% 1415 aa  RPOC_ANAMM RecName: Full=DNA-directed RNA polymerase subunit beta';  
   13::1358      0.0  52% 1415 aa  RPOC_ANAMF RecName: Full=DNA-directed RNA polymerase subunit beta';  
   13::1397      0.0  51% 1410 aa  RPOC_EHRCR RecName: Full=DNA-directed RNA polymerase subunit beta';  
   13::1387      0.0  51% 1411 aa  RPOC_EHRRG RecName: Full=DNA-directed RNA polymerase subunit beta';  
   13::1387      0.0  51% 1411 aa  RPOC_EHRRW RecName: Full=DNA-directed RNA polymerase subunit beta';  
   13::1358      0.0  52% 1409 aa  RPOC_ANAPZ RecName: Full=DNA-directed RNA polymerase subunit beta';  
   19::1373      0.0  51% 1385 aa  RPOC_ELUMP RecName: Full=DNA-directed RNA polymerase subunit beta';  
 1439::2794      0.0  51% 2839 aa  RPOBC_WOLTR RecName: Full=Bifunctional DNA-directed RNA polymerase
   16::1379      0.0  51% 1396 aa  RPOC_ORITI RecName: Full=DNA-directed RNA polymerase subunit beta';  
   16::1379      0.0  50% 1396 aa  RPOC_ORITB RecName: Full=DNA-directed RNA polymerase subunit beta';  
 1439::2788      0.0  51% 2837 aa  RPOBC_WOLPM RecName: Full=Bifunctional DNA-directed RNA polymerase
   18::1355      0.0  48% 1398 aa  RPOC_AKKM8 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   28::1353      0.0  50% 1384 aa  RPOC_OPITP RecName: Full=DNA-directed RNA polymerase subunit beta';  
   20::1356      0.0  50% 1390 aa  RPOC_METI4 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    4::1385      0.0  48% 1388 aa  RPOC_PARUW RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1376      0.0  50% 1433 aa  RPOC_LEPBP RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1376      0.0  50% 1433 aa  RPOC_LEPBA RecName: Full=DNA-directed RNA polymerase subunit beta';  
    4::1299      0.0  49% 1319 aa  RPOC_FUSNN RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1394      0.0  48% 1429 aa  RPOC_RHOBA RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1381      0.0  49% 1393 aa  RPOC_CHLFF RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1381      0.0  49% 1393 aa  RPOC_CHLPN RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1381      0.0  49% 1393 aa  RPOC_CHLCV RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1381      0.0  49% 1393 aa  RPOC_CHLAB RecName: Full=DNA-directed RNA polymerase subunit beta';  
    5::1377      0.0  50% 1377 aa  RPOC_BORBZ RecName: Full=DNA-directed RNA polymerase subunit beta';  
    5::1377      0.0  49% 1377 aa  RPOC_BORBU RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1393      0.0  49% 1433 aa  RPOC_PORGI RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1393      0.0  49% 1433 aa  RPOC_PORG3 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1396      0.0  48% 1427 aa  RPOC_BACFR RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1396      0.0  48% 1427 aa  RPOC_BACFN RecName: Full=DNA-directed RNA polymerase subunit beta';  
    5::1377      0.0  49% 1377 aa  RPOC_BORHD RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1366      0.0  50% 1377 aa  RPOC_BORGA RecName: Full=DNA-directed RNA polymerase subunit beta';  
   13::1405      0.0  48% 1438 aa  RPOC_CYTH3 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1377      0.0  49% 1377 aa  RPOC_BORAP RecName: Full=DNA-directed RNA polymerase subunit beta';  
    5::1377      0.0  49% 1377 aa  RPOC_BORDL RecName: Full=DNA-directed RNA polymerase subunit beta';  
    5::1377      0.0  49% 1377 aa  RPOC_BORT9 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    5::1377      0.0  49% 1377 aa  RPOC_BORRA RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1383      0.0  49% 1396 aa  RPOC_CHLTR RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1383      0.0  48% 1396 aa  RPOC_CHLTB RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1383      0.0  49% 1396 aa  RPOC_CHLTA RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1383      0.0  48% 1396 aa  RPOC_CHLT2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1371      0.0  50% 1404 aa  RPOC_LEPIN RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1371      0.0  50% 1404 aa  RPOC_LEPIC RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1383      0.0  49% 1396 aa  RPOC_CHLMU RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1400      0.0  49% 1404 aa  RPOC_LEPBJ RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1394      0.0  48% 1431 aa  RPOC_PARD8 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1400      0.0  49% 1404 aa  RPOC_LEPBL RecName: Full=DNA-directed RNA polymerase subunit beta';  
   11::1419      0.0  48% 1433 aa  RPOC_GRAFK RecName: Full=DNA-directed RNA polymerase subunit beta';  
   17::1412      0.0  48% 1438 aa  RPOC_FLAPJ RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1395      0.0  47% 1427 aa  RPOC_BACTN RecName: Full=DNA-directed RNA polymerase subunit beta';  
   13::1396      0.0  47% 1428 aa  RPOC_BACV8 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    5::1386      0.0  47% 1416 aa  RPOC_TREPS RecName: Full=DNA-directed RNA polymerase subunit beta';  
    5::1386      0.0  47% 1416 aa  RPOC_TREPA RecName: Full=DNA-directed RNA polymerase subunit beta';  
   15::1410      0.0  47% 1436 aa  RPOC_FLAJ1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   13::1433      0.0  48% 1433 aa  RPOC_AMOA5 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1393      0.0  47% 1424 aa  RPOC_TREDE RecName: Full=DNA-directed RNA polymerase subunit beta';  
   12::1458      0.0  47% 1499 aa  RPOC_CHLT3 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1462      0.0  48% 1502 aa  RPOC_CHLCH RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1462      0.0  48% 1484 aa  RPOC_PROVI RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1462      0.0  48% 1498 aa  RPOC_PELLD RecName: Full=DNA-directed RNA polymerase subunit beta';  
   10::1398      0.0  47% 1405 aa  RPOC_AZOPC RecName: Full=DNA-directed RNA polymerase subunit beta';  
    5::1393      0.0  47% 1448 aa  RPOC_SALRD RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1462      0.0  48% 1496 aa  RPOC_CHLL2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1484      0.0  47% 1499 aa  RPOC_PROA2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   13::1484      0.0  47% 1497 aa  RPOC_PELPB RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1462      0.0  47% 1498 aa  RPOC_CHLPB RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1463      0.0  48% 1490 aa  RPOC_CHLTE RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1462      0.0  47% 1492 aa  RPOC_CHLPD RecName: Full=DNA-directed RNA polymerase subunit beta';  
   11::212       0.0  52% 1576 aa  RPOC_AQUPY RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1479      0.0  47% 1494 aa  RPOC_CHLP8 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   11::212       0.0  54% 1574 aa  RPOC_AQUAE RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::209       0.0  52% 1563 aa  RPOC_HYDS0 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::983       0.0  56% 1152 aa  RPOC_CARHZ RecName: Full=DNA-directed RNA polymerase subunit beta';  
  271::1549      0.0  50% 1579 aa  RPOC_SULSY RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1007      0.0  56% 1184 aa  RPOC_THEP3 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   21::150       0.0  48% 1593 aa  RPOC_UNCTG RecName: Full=DNA-directed RNA polymerase subunit beta';  
   16::1256      0.0  50% 1507 aa  RPOC_NITSB RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1000      0.0  55% 1164 aa  RPOC_MOOTA RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1007      0.0  55% 1183 aa  RPOC_THETN RecName: Full=DNA-directed RNA polymerase subunit beta';  
   13::1002      0.0  55% 1161 aa  RPOC_DESHY RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1008      0.0  54% 1178 aa  RPOC_CLOBM RecName: Full=DNA-directed RNA polymerase subunit beta';  
   14::1015      0.0  54% 1185 aa  RPOC_CLONN RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1008      0.0  54% 1178 aa  RPOC_CLOBK RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1007      0.0  55% 1184 aa  RPOC_THEPX RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1007      0.0  54% 1165 aa  RPOC_CLOTH RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1000      0.0  54% 1161 aa  RPOC_CLOD6 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    5::1007      0.0  53% 1182 aa  RPOC_CLOAB RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1008      0.0  54% 1178 aa  RPOC_CLOBH RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1008      0.0  54% 1178 aa  RPOC_CLOB1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1007      0.0  55% 1135 aa  RPOC_CLOTE RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::987       0.0  57% 1154 aa  RPOC_DESAP RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1008      0.0  53% 1178 aa  RPOC_CLOBL RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1002      0.0  56% 1185 aa  RPOC_DESRM RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1021      0.0  53% 1180 aa  RPOC_HELMI RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::997       0.0  57% 1170 aa  RPOC_PELTS RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1018      0.0  54% 1178 aa  RPOC_CLOPS RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1018      0.0  54% 1178 aa  RPOC_CLOPE RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1018      0.0  54% 1178 aa  RPOC_CLOP1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1081      0.0  52% 1177 aa  RPOC_CLOBA RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1103      0.0  51% 1177 aa  RPOC_CLOBB RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1014      0.0  53% 1179 aa  RPOC_ALKOO RecName: Full=DNA-directed RNA polymerase subunit beta';  
   13::985       0.0  53% 1509 aa  RPOC_SULNB RecName: Full=DNA-directed RNA polymerase subunit beta';
    2::1008      0.0  54% 1178 aa  RPOC_CLOB8 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1018      0.0  52% 1174 aa  RPOC_CLOK5 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    9::1366      0.0  48% 1508 aa  RPOC_CAMFF RecName: Full=DNA-directed RNA polymerase subunit beta';  
   11::1011      0.0  53% 1168 aa  RPOC_CALS8 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1013      0.0  52% 1171 aa  RPOC_ALKMQ RecName: Full=DNA-directed RNA polymerase subunit beta';  
 1394::2346      0.0  54% 2883 aa  RPOBC_WOLSU RecName: Full=Bifunctional DNA-directed RNA polymerase
    7::1010      0.0  54% 1179 aa  RPOC_SYMTH RecName: Full=DNA-directed RNA polymerase subunit beta';  
   22::976       0.0  54% 1511 aa  RPOC_ARCB4 RecName: Full=DNA-directed RNA polymerase subunit beta';
    6::979       0.0  55% 1199 aa  RPOC_GEOKA RecName: Full=DNA-directed RNA polymerase subunit beta';
    7::1019      0.0  54% 1206 aa  RPOC_BACHD RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::979       0.0  55% 1199 aa  RPOC_GEOTN RecName: Full=DNA-directed RNA polymerase subunit beta';
    7::1040      0.0  54% 1199 aa  RPOC_BACLD RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1040      0.0  53% 1199 aa  RPOC_BACSU RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1039      0.0  53% 1203 aa  RPOC_BACCR RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1039      0.0  53% 1203 aa  RPOC_BACHK RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1039      0.0  53% 1203 aa  RPOC_BACCZ RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1039      0.0  53% 1203 aa  RPOC_BACC1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1039      0.0  53% 1203 aa  RPOC_BACAN RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1039      0.0  53% 1203 aa  RPOC_BACAH RecName: Full=DNA-directed RNA polymerase subunit beta';  
    9::982       0.0  53% 1517 aa  RPOC_CAMJ8 RecName: Full=DNA-directed RNA polymerase subunit beta';
    9::982       0.0  53% 1517 aa  RPOC_CAMJR RecName: Full=DNA-directed RNA polymerase subunit beta';
    9::982       0.0  53% 1517 aa  RPOC_CAMJJ RecName: Full=DNA-directed RNA polymerase subunit beta';
    7::1040      0.0  53% 1199 aa  RPOC_BACP2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    9::982       0.0  53% 1517 aa  RPOC_CAMJE RecName: Full=DNA-directed RNA polymerase subunit beta';
    7::1039      0.0  53% 1203 aa  RPOC_BACWK RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1018      0.0  53% 1053 aa  RPOC_LISGR RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1020      0.0  53% 1203 aa  RPOC_OCEIH RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::1008      0.0  52% 1181 aa  RPOC_SYNWW RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1022      0.0  53% 1199 aa  RPOC_EXIS2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   21::970       0.0  53% 1503 aa  RPOC_SULDN RecName: Full=DNA-directed RNA polymerase subunit beta';
    7::1040      0.0  54% 1206 aa  RPOC_BACSK RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1040      0.0  53% 1204 aa  RPOC_BACCN RecName: Full=DNA-directed RNA polymerase subunit beta';  
   16::1376      0.0  46% 1517 aa  RPOC_CAMLR RecName: Full=DNA-directed RNA polymerase subunit beta';  
 1388::2349      0.0  52% 2894 aa  RPOBC_HELHP RecName: Full=Bifunctional DNA-directed RNA polymerase
    7::1040      0.0  53% 1201 aa  RPOC_LISIN RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1040      0.0  52% 1201 aa  RPOC_LISMF RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1040      0.0  52% 1201 aa  RPOC_LISW6 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1040      0.0  52% 1201 aa  RPOC_LISMO RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1070      0.0  53% 1227 aa  RPOC_LYSSC RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1040      0.0  52% 1199 aa  RPOC_BACA2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1019      0.0  53% 1217 aa  RPOC_ENTFA RecName: Full=DNA-directed RNA polymerase subunit beta';  
 1386::2349      0.0  54% 2890 aa  RPOBC_HELAH RecName: Full=Bifunctional DNA-directed RNA polymerase
 1386::2349      0.0  53% 2890 aa  RPOBC_HELPS RecName: Full=Bifunctional DNA-directed RNA polymerase
 1386::2349      0.0  54% 2890 aa  RPOBC_HELPJ RecName: Full=Bifunctional DNA-directed RNA polymerase
 1386::2349      0.0  53% 2890 aa  RPOBC_HELPY RecName: Full=Bifunctional DNA-directed RNA polymerase
 1386::2349      0.0  53% 2890 aa  RPOBC_HELPH RecName: Full=Bifunctional DNA-directed RNA polymerase
    4::1428      0.0  49% 1464 aa  RPOC_SULMW RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1046      0.0  51% 1218 aa  RPOC_NATTJ RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1022      0.0  52% 1216 aa  RPOC_STRA5 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1022      0.0  52% 1216 aa  RPOC_STRA3 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1022      0.0  52% 1216 aa  RPOC_STRA1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1022      0.0  53% 1207 aa  RPOC_STAES RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1022      0.0  53% 1207 aa  RPOC_STAEQ RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1022      0.0  52% 1206 aa  RPOC_STAHJ RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::1154      0.0  47% 1159 aa  RPOC_PORCN RecName: Full=DNA-directed RNA polymerase subunit beta';  
    1::1027      0.0  51% 1255 aa  RPOC_CLOPH RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  52% 1211 aa  RPOC_STRS7 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  52% 1211 aa  RPOC_STRE4 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1009      0.0  51% 1202 aa  RPOC_FINM2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1022      0.0  52% 1207 aa  RPOC_STAAR RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1022      0.0  52% 1207 aa  RPOC_STAAW RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1022      0.0  52% 1057 aa  RPOC_STAAU RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1022      0.0  52% 1207 aa  RPOC_STAAS RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1022      0.0  52% 1207 aa  RPOC_STAAN RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1022      0.0  52% 1207 aa  RPOC_STAAM RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1022      0.0  52% 1207 aa  RPOC_STAAC RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1022      0.0  52% 1207 aa  RPOC_STAA8 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1022      0.0  52% 1207 aa  RPOC_STAA3 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  52% 1212 aa  RPOC_STRU0 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1022      0.0  52% 1207 aa  RPOC_STAAB RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  52% 1213 aa  RPOC_STRPM RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  52% 1213 aa  RPOC_STRPF RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  52% 1207 aa  RPOC_STRPC RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  52% 1207 aa  RPOC_STRPB RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  52% 1213 aa  RPOC_STRP8 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  52% 1213 aa  RPOC_STRPD RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1053      0.0  51% 1053 aa  RPOC_BROTH RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  52% 1213 aa  RPOC_STRP1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  52% 1213 aa  RPOC_STRPG RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  52% 1207 aa  RPOC_STRP3 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  52% 1213 aa  RPOC_STRP6 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1022      0.0  52% 1207 aa  RPOC_STAS1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::992       0.0  51% 1207 aa  RPOC_LACLA RecName: Full=DNA-directed RNA polymerase subunit beta';
    6::1021      0.0  51% 1209 aa  RPOC_STRMU RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  51% 1215 aa  RPOC_STRGC RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1118      0.0  47% 1207 aa  RPOC_LACLS RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  51% 1215 aa  RPOC_STRSY RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  51% 1215 aa  RPOC_STRS2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::992       0.0  50% 1207 aa  RPOC_LACLM RecName: Full=DNA-directed RNA polymerase subunit beta';
    7::980       0.0  52% 1215 aa  RPOC_LACF3 RecName: Full=DNA-directed RNA polymerase subunit beta';
    6::1021      0.0  51% 1215 aa  RPOC_STRSV RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  51% 1212 aa  RPOC_STRTD RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  51% 1212 aa  RPOC_STRT2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  51% 1212 aa  RPOC_STRT1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1020      0.0  50% 1214 aa  RPOC_LACSS RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1019      0.0  50% 1213 aa  RPOC_LACPL RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1179      0.0  51% 1212 aa  RPOC_PEDPA RecName: Full=DNA-directed RNA polymerase subunit beta';
    6::1020      0.0  50% 1220 aa  RPOC_LACC3 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1020      0.0  50% 1220 aa  RPOC_LACCB RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1180      0.0  49% 1215 aa  RPOC_LACBA RecName: Full=DNA-directed RNA polymerase subunit beta';
    6::1021      0.0  50% 1225 aa  RPOC_STRR6 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  50% 1225 aa  RPOC_STRZT RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  50% 1225 aa  RPOC_STRZP RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  50% 1225 aa  RPOC_STRZJ RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  50% 1225 aa  RPOC_STRPS RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  50% 1225 aa  RPOC_STRPN RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  50% 1225 aa  RPOC_STRPJ RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  50% 1225 aa  RPOC_STRPI RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  50% 1225 aa  RPOC_STRP7 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  50% 1225 aa  RPOC_STRP4 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1021      0.0  50% 1225 aa  RPOC_STRP2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1181      0.0  51% 1221 aa  RPOC_LACS1 RecName: Full=DNA-directed RNA polymerase subunit beta';
    6::1054      0.0  51% 1055 aa  RPOC_PEDAC RecName: Full=DNA-directed RNA polymerase subunit beta';
    6::980       0.0  51% 1211 aa  RPOC_LACRJ RecName: Full=DNA-directed RNA polymerase subunit beta';
    6::980       0.0  51% 1211 aa  RPOC_LACRD RecName: Full=DNA-directed RNA polymerase subunit beta';
    7::985       0.0  51% 1233 aa  RPOC_OENOB RecName: Full=DNA-directed RNA polymerase subunit beta';
    6::1119      0.0  47% 1223 aa  RPOC_LACGA RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1042      0.0  48% 1220 aa  RPOC_LEUCK RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1125      0.0  45% 1221 aa  RPOC_LACDB RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1125      0.0  45% 1221 aa  RPOC_LACDA RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1120      0.0  47% 1224 aa  RPOC_LACJO RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::1190      0.0  48% 1220 aa  RPOC_LEUMM RecName: Full=DNA-directed RNA polymerase subunit beta';
    3::1672      0.0  46% 1676 aa  RPOC_CYAME RecName: Full=Bifunctional DNA-directed RNA polymerase
    6::1056      0.0  48% 1217 aa  RPOC_LACH4 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::1056      0.0  48% 1217 aa  RPOC_LACAC RecName: Full=DNA-directed RNA polymerase subunit beta';  
   18::954       0.0  51%  989 aa  RPOC_STRPY RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1182      0.0  44% 1254 aa  RPOC_MESFL RecName: Full=DNA-directed RNA polymerase subunit beta';  
  129::1136      0.0  46% 1353 aa  RPOC_ONYPE RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1038      0.0  48% 1255 aa  RPOC_MYCCT RecName: Full=DNA-directed RNA polymerase subunit beta';  
  157::1154      0.0  48% 1375 aa  RPOC_ACHLI RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1038      0.0  47% 1255 aa  RPOC_MYCMS RecName: Full=DNA-directed RNA polymerase subunit beta';  
   19::1017      0.0  47% 1054 aa  RPOC_WEIPA RecName: Full=DNA-directed RNA polymerase subunit beta';  
   19::884       0.0  51% 1046 aa  RPOC_WEIHE RecName: Full=DNA-directed RNA polymerase subunit beta';
  320::1228      0.0  50% 1504 aa  RPOC_ROSS1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
  129::1136      0.0  46% 1353 aa  RPOC_AYWBP RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  50% 1290 aa  RPOC_NOCSJ RecName: Full=DNA-directed RNA polymerase subunit beta';  
  213::1046      0.0  53% 1296 aa  RPOC_BEUC1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
  320::1432      0.0  52% 1502 aa  RPOC_ROSCS RecName: Full=DNA-directed RNA polymerase subunit beta';  
    3::167       0.0  52% 1299 aa  RPOC_ARTAT RecName: Full=DNA-directed RNA polymerase subunit beta';  
   19::918       0.0  50% 1004 aa  RPOC_OENOE RecName: Full=DNA-directed RNA polymerase subunit beta';
    3::167       0.0  52% 1299 aa  RPOC_ARTCA RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  50% 1297 aa  RPOC_SALTO RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  52% 1304 aa  RPOC_ACIC1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  52% 1297 aa  RPOC_SALAI RecName: Full=DNA-directed RNA polymerase subunit beta';  
    3::167       0.0  54% 1299 aa  RPOC_ARTS2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  52% 1291 aa  RPOC_THEFY RecName: Full=DNA-directed RNA polymerase subunit beta';  
  325::1228      0.0  51% 1500 aa  RPOC_CHLAD RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::138       0.0  53% 1291 aa  RPOC_LEIXX RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  54% 1293 aa  RPOC_KINRD RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  54% 1295 aa  RPOC_FRASC RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  54% 1296 aa  RPOC_FRAAA RecName: Full=DNA-directed RNA polymerase subunit beta';  
  320::1228      0.0  50% 1503 aa  RPOC_CHLSY RecName: Full=DNA-directed RNA polymerase subunit beta';  
  320::1228      0.0  50% 1503 aa  RPOC_CHLAA RecName: Full=DNA-directed RNA polymerase subunit beta';  
    3::137       0.0  52% 1296 aa  RPOC_KOCRD RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::136       0.0  53% 1299 aa  RPOC_CLAM3 RecName: Full=DNA-directed RNA polymerase subunit beta';  
  216::1261      0.0  47% 1295 aa  RPOC_DEHE1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::136       0.0  53% 1299 aa  RPOC_CLAMS RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  52% 1303 aa  RPOC_SACEN RecName: Full=DNA-directed RNA polymerase subunit beta';  
    4::143       0.0  53% 1295 aa  RPOC_RUBXD RecName: Full=DNA-directed RNA polymerase subunit beta';  
   16::1173      0.0  43% 1286 aa  RPOC_MYCGA RecName: Full=DNA-directed RNA polymerase subunit beta';  
  631::1473      0.0  48% 1496 aa  RPOC_MAGSA RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  51% 1299 aa  RPOC_STRCO RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::163       0.0  51% 1299 aa  RPOC_RENSM RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  49% 1295 aa  RPOC_DEHSB RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  49% 1295 aa  RPOC_DEHSC RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  54% 1296 aa  RPOC_FRASN RecName: Full=DNA-directed RNA polymerase subunit beta';  
    1::137       0.0  47% 1293 aa  RPOC_PROAC RecName: Full=DNA-directed RNA polymerase subunit beta';  
   19::975       0.0  48%  989 aa  RPOC_LEUPS RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  49% 1299 aa  RPOC_STRGG RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  52% 1298 aa  RPOC_MICLC RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  51% 1299 aa  RPOC_STRAW RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  50% 1316 aa  RPOC_MYCTU RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  50% 1316 aa  RPOC_MYCTA RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  50% 1316 aa  RPOC_MYCBT RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  50% 1316 aa  RPOC_MYCBP RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  50% 1316 aa  RPOC_MYCBO RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  51% 1319 aa  RPOC_MYCA9 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::137       0.0  50% 1337 aa  RPOC_BIFAA RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::138       0.0  50% 1315 aa  RPOC_MYCSS RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::138       0.0  50% 1315 aa  RPOC_MYCSK RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::138       0.0  50% 1315 aa  RPOC_MYCSJ RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::138       0.0  50% 1543 aa  RPOC_HERA2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  50% 1345 aa  RPOC_BIFA0 RecName: Full=DNA-directed RNA polymerase subunit beta';  
  236::1234      0.0  51% 1286 aa  RPOC_TROWT RecName: Full=DNA-directed RNA polymerase subunit beta';
  236::1234      0.0  51% 1286 aa  RPOC_TROW8 RecName: Full=DNA-directed RNA polymerase subunit beta';
    7::137       0.0  51% 1333 aa  RPOC_COREF RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  51% 1317 aa  RPOC_MYCS2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::136       0.0  50% 1318 aa  RPOC_RHOOB RecName: Full=DNA-directed RNA polymerase subunit beta';  
  227::1265      0.0  51% 1317 aa  RPOC_MYCVP RecName: Full=DNA-directed RNA polymerase subunit beta';  
  229::1034      0.0  50% 1333 aa  RPOC_CORGL RecName: Full=DNA-directed RNA polymerase subunit beta';  
  229::1034      0.0  50% 1333 aa  RPOC_CORGB RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::136       0.0  50% 1318 aa  RPOC_RHOSR RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  51% 1316 aa  RPOC_MYCGI RecName: Full=DNA-directed RNA polymerase subunit beta';  
  229::1141      0.0  48% 1336 aa  RPOC_CORDI RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  50% 1316 aa  RPOC_MYCUA RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  49% 1317 aa  RPOC_NOCFA RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  50% 1316 aa  RPOC_MYCMM RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  51% 1316 aa  RPOC_MYCA1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
   13::1446      0.0  53% 1447 aa  RPOC_DESOH RecName: Full=DNA-directed RNA polymerase subunit beta';
    7::137       0.0  51% 1316 aa  RPOC_MYCPA RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  49% 1316 aa  RPOC_MYCLE RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  49% 1316 aa  RPOC_MYCLB RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::136       0.0  49% 1318 aa  RPOC_RHOE4 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  50% 1331 aa  RPOC_CORA7 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::138       0.0  48% 1345 aa  RPOC_BIFLO RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::138       0.0  48% 1345 aa  RPOC_BIFLD RecName: Full=DNA-directed RNA polymerase subunit beta';  
  229::1273      0.0  49% 1323 aa  RPOC_CORU7 RecName: Full=DNA-directed RNA polymerase subunit beta';  
  229::1028      0.0  49% 1332 aa  RPOC_CORK4 RecName: Full=DNA-directed RNA polymerase subunit beta';  
  434::1627      0.0  42% 1649 aa  RPOC_THEAB RecName: Full=DNA-directed RNA polymerase subunit beta';  
   21::1119      0.0  46% 1290 aa  RPOC_MYCPN RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::137       0.0  49% 1323 aa  RPOC_CORJK RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::587     e-178  56%  625 aa  RPOC1_ANASP RecName: Full=DNA-directed RNA polymerase subunit
   15::1116    e-178  44% 1292 aa  RPOC_MYCGE RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::571     e-178  58%  625 aa  RPOC1_ANAVT RecName: Full=DNA-directed RNA polymerase subunit
    6::587     e-177  56%  625 aa  RPOC1_NOSP7 RecName: Full=DNA-directed RNA polymerase subunit
    6::605     e-176  57%  608 aa  RPOC1_GLOVI RecName: Full=DNA-directed RNA polymerase subunit
    6::609     e-176  55%  622 aa  RPOC1_CYAP4 RecName: Full=DNA-directed RNA polymerase subunit
    6::560     e-175  59%  627 aa  RPOC1_SYNJA RecName: Full=DNA-directed RNA polymerase subunit
    6::584     e-175  57%  627 aa  RPOC1_SYNJB RecName: Full=DNA-directed RNA polymerase subunit
    6::565     e-173  56%  622 aa  RPOC1_THEEB RecName: Full=DNA-directed RNA polymerase subunit
    8::178     e-173  50% 1524 aa  RPOC_THEAQ RecName: Full=DNA-directed RNA polymerase subunit beta';  
    6::558     e-172  56%  623 aa  RPOC1_ACAM1 RecName: Full=DNA-directed RNA polymerase subunit
    8::160     e-171  51% 1524 aa  RPOC_THET2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    7::613     e-171  53%  626 aa  RPOC1_MICAN RecName: Full=DNA-directed RNA polymerase subunit
    8::160     e-171  51% 1524 aa  RPOC_THET8 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::611     e-170  54%  625 aa  RPOC1_CYAP8 RecName: Full=DNA-directed RNA polymerase subunit
    6::559     e-170  57%  672 aa  RPOC1_TRIEI RecName: Full=DNA-directed RNA polymerase subunit
    7::564     e-169  57%  625 aa  RPOC1_CYAP7 RecName: Full=DNA-directed RNA polymerase subunit
    6::558     e-168  57%  624 aa  RPOC1_SYNE7 RecName: Full=DNA-directed RNA polymerase subunit
    6::558     e-167  57%  624 aa  RPOC1_SYNP6 RecName: Full=DNA-directed RNA polymerase subunit
    8::565     e-167  58%  623 aa  RPOC1_RHDSA RecName: Full=DNA-directed RNA polymerase subunit
    8::563     e-165  58%  623 aa  RPOC1_GUITH RecName: Full=DNA-directed RNA polymerase subunit
    8::627     e-165  58%  629 aa  RPOC1_PORPU RecName: Full=DNA-directed RNA polymerase subunit
    2::590     e-164  52%  636 aa  RPOC1_SYNP2 RecName: Full=DNA-directed RNA polymerase subunit
    8::566     e-164  59%  629 aa  RPOC1_PORYE RecName: Full=DNA-directed RNA polymerase subunit
   12::569     e-164  55%  634 aa  RPOC1_PROMM RecName: Full=DNA-directed RNA polymerase subunit
   12::574     e-163  55%  634 aa  RPOC1_SYNSC RecName: Full=DNA-directed RNA polymerase subunit
  457::1506    e-163  46% 1537 aa  RPOC_DEIGD RecName: Full=DNA-directed RNA polymerase subunit beta';  
   12::574     e-163  54%  634 aa  RPOC1_PROM3 RecName: Full=DNA-directed RNA polymerase subunit
    6::583     e-163  58%  621 aa  RPOC1_NOSCO RecName: Full=DNA-directed RNA polymerase subunit
   12::574     e-163  54%  634 aa  RPOC1_SYNPX RecName: Full=DNA-directed RNA polymerase subunit
    8::614     e-162  52%  628 aa  RPOC1_CYAA5 RecName: Full=DNA-directed RNA polymerase subunit
   12::569     e-162  54%  634 aa  RPOC1_SYNPW RecName: Full=DNA-directed RNA polymerase subunit
   12::574     e-162  54%  634 aa  RPOC1_PROM9 RecName: Full=DNA-directed RNA polymerase subunit
    8::572     e-162  57%  628 aa  RPOC1_GRATL RecName: Full=DNA-directed RNA polymerase subunit
   12::574     e-162  55%  634 aa  RPOC1_PROM0 RecName: Full=DNA-directed RNA polymerase subunit
   12::574     e-162  55%  634 aa  RPOC1_PROMS RecName: Full=DNA-directed RNA polymerase subunit
   12::574     e-162  54%  634 aa  RPOC1_PROM2 RecName: Full=DNA-directed RNA polymerase subunit
   12::574     e-162  54%  635 aa  RPOC1_PROMT RecName: Full=DNA-directed RNA polymerase subunit
   12::574     e-161  54%  635 aa  RPOC1_PROM1 RecName: Full=DNA-directed RNA polymerase subunit
  231::1033    e-161  45% 1288 aa  RPOC_MYCPE RecName: Full=DNA-directed RNA polymerase subunit beta';  
   12::569     e-161  54%  634 aa  RPOC1_SYNS3 RecName: Full=DNA-directed RNA polymerase subunit
   12::574     e-161  54%  634 aa  RPOC1_PROMP RecName: Full=DNA-directed RNA polymerase subunit
   12::574     e-161  54%  634 aa  RPOC1_PROM5 RecName: Full=DNA-directed RNA polymerase subunit
    2::1516    e-160  46% 1546 aa  RPOC_DEIRA RecName: Full=DNA-directed RNA polymerase subunit beta';  
    8::572     e-160  53%  626 aa  RPOC1_SYNY3 RecName: Full=DNA-directed RNA polymerase subunit
   12::574     e-160  53%  634 aa  RPOC1_SYNS9 RecName: Full=DNA-directed RNA polymerase subunit
   21::583     e-160  57%  643 aa  RPOC1_PAUCH RecName: Full=DNA-directed RNA polymerase subunit
   12::574     e-160  54%  634 aa  RPOC1_SYNR3 RecName: Full=DNA-directed RNA polymerase subunit
  435::1629    e-159  46% 1650 aa  RPOC_THELT RecName: Full=DNA-directed RNA polymerase subunit beta';  
   12::574     e-159  53%  633 aa  RPOC1_PROM4 RecName: Full=DNA-directed RNA polymerase subunit
  435::1628    e-158  47% 1649 aa  RPOC_THEM4 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1287    e-158  44% 1305 aa  RPOC_UREPA RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1287    e-158  44% 1305 aa  RPOC_UREP2 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    2::1287    e-157  44% 1305 aa  RPOC_UREU1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    4::570     e-157  55%  636 aa  RPOC1_CYAPA RecName: Full=DNA-directed RNA polymerase subunit
   12::574     e-157  53%  634 aa  RPOC1_PROMA RecName: Full=DNA-directed RNA polymerase subunit
  329::1297    e-152  48% 1643 aa  RPOC_PETMO RecName: Full=DNA-directed RNA polymerase subunit beta';  
  435::1357    e-150  51% 1690 aa  RPOC_THENN RecName: Full=DNA-directed RNA polymerase subunit beta';  
    3::552     e-150  53%  609 aa  RPOC1_EMIHU RecName: Full=DNA-directed RNA polymerase subunit
  435::1671    e-149  45% 1690 aa  RPOC_THEMA RecName: Full=DNA-directed RNA polymerase subunit beta';  
  435::1447    e-149  48% 1690 aa  RPOC_THESQ RecName: Full=DNA-directed RNA polymerase subunit beta';  
  435::1447    e-149  49% 1690 aa  RPOC_THEP1 RecName: Full=DNA-directed RNA polymerase subunit beta';  
  434::1629    e-148  46% 1650 aa  RPOC_FERNB RecName: Full=DNA-directed RNA polymerase subunit beta';  
    9::581     e-148  52%  717 aa  RPOC1_CHLAT RecName: Full=DNA-directed RNA polymerase subunit
   11::557     e-145  52%  633 aa  RPOC1_CYACA RecName: Full=DNA-directed RNA polymerase subunit
   11::1151    e-126  44% 1464 aa  RPOC_MYCA5 RecName: Full=DNA-directed RNA polymerase subunit beta';
    5::593     e-124  49%  679 aa  RPOC1_PHYPA RecName: Full=DNA-directed RNA polymerase subunit
    3::596     e-123  48%  666 aa  RPOC1_CHAVU RecName: Full=DNA-directed RNA polymerase subunit
    2::646     e-123  47%  687 aa  RPOC1_ANGEV RecName: Full=DNA-directed RNA polymerase subunit
    5::597     e-122  48%  684 aa  RPOC1_MARPO RecName: Full=DNA-directed RNA polymerase subunit
    1::601     e-121  48%  674 aa  RPOC1_PSINU RecName: Full=DNA-directed RNA polymerase subunit
    6::600     e-120  47%  699 aa  RPOC1_ANEMR RecName: Full=DNA-directed RNA polymerase subunit
   10::596     e-118  47%  681 aa  RPOC1_ANTFO RecName: Full=DNA-directed RNA polymerase subunit
   18::1405    e-118  45% 1478 aa  RPOC_MYCAP RecName: Full=DNA-directed RNA polymerase subunit beta';
    2::589     e-117  47%  661 aa  RPOC1_CHAGL RecName: Full=DNA-directed RNA polymerase subunit
    1::1388    e-117  44% 1412 aa  RPOC_MYCHJ RecName: Full=DNA-directed RNA polymerase subunit beta';
    1::1388    e-117  44% 1412 aa  RPOC_MYCH7 RecName: Full=DNA-directed RNA polymerase subunit beta';
    1::1388    e-117  44% 1412 aa  RPOC_MYCH2 RecName: Full=DNA-directed RNA polymerase subunit beta';
    9::1388    e-116  44% 1424 aa  RPOC_MYCMO RecName: Full=DNA-directed RNA polymerase subunit beta';
    7::1140    e-115  44% 1426 aa  RPOC_MYCPU RecName: Full=DNA-directed RNA polymerase subunit beta';
    1::552     e-115  50%  691 aa  RPOC1_CUSRE RecName: Full=DNA-directed RNA polymerase subunit
   10::607     e-114  47%  694 aa  RPOC1_ADICA RecName: Full=DNA-directed RNA polymerase subunit
    6::614     e-114  51%  684 aa  RPOC1_NYMAL RecName: Full=DNA-directed RNA polymerase subunit
    1::681     e-114  46%  691 aa  RPOC1_CUSEX RecName: Full=DNA-directed RNA polymerase subunit
   13::552     e-113  52%  687 aa  RPOC1_IPOPU RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-113  51%  677 aa  RPOC1_SPIOL RecName: Full=DNA-directed RNA polymerase subunit
    6::551     e-113  52%  688 aa  RPOC1_SINAL RecName: Full=DNA-directed RNA polymerase subunit
    1::550     e-113  52%  690 aa  RPOC1_LEMMI RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-112  49%  680 aa  RPOC1_ARAHI RecName: Full=DNA-directed RNA polymerase subunit
    1::550     e-112  51%  693 aa  RPOC1_NUPAD RecName: Full=DNA-directed RNA polymerase subunit
    6::539     e-112  50%  676 aa  RPOC1_FAGEA RecName: Full=DNA-directed RNA polymerase subunit
    6::546     e-112  51%  687 aa  RPOC1_SILLA RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-112  51%  680 aa  RPOC1_NASOF RecName: Full=DNA-directed RNA polymerase subunit
    6::545     e-112  48%  682 aa  RPOC1_LOTJA RecName: Full=DNA-directed RNA polymerase subunit
    9::1209    e-112  44% 1492 aa  RPOC_MYCS5 RecName: Full=DNA-directed RNA polymerase subunit beta';
    6::543     e-112  52%  681 aa  RPOC1_SOLLC RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-112  52%  681 aa  RPOC1_SOLBU RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-112  51%  680 aa  RPOC1_OLIPU RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-112  52%  681 aa  RPOC1_NICSY RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-112  51%  680 aa  RPOC1_LEPVR RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-112  51%  680 aa  RPOC1_DRANE RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-112  51%  680 aa  RPOC1_CAPBU RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-112  52%  681 aa  RPOC1_ATRBE RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-112  51%  680 aa  RPOC1_ARATH RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-112  51%  680 aa  RPOC1_LOBMA RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-112  48%  680 aa  RPOC1_CUCSA RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-112  51%  680 aa  RPOC1_BARVE RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-111  48%  684 aa  RPOC1_MORIN RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-111  48%  680 aa  RPOC1_MANES RecName: Full=DNA-directed RNA polymerase subunit
    6::546     e-111  51%  683 aa  RPOC1_COFAR RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-111  51%  685 aa  RPOC1_GOSHI RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-111  48%  680 aa  RPOC1_CITSI RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-111  52%  681 aa  RPOC1_NICTO RecName: Full=DNA-directed RNA polymerase subunit
    9::149     e-111  56%  668 aa  RPOC1_MESVI RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-111  51%  680 aa  RPOC1_CARPA RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-111  51%  680 aa  RPOC1_AETGR RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-111  51%  680 aa  RPOC1_CRUWA RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-111  51%  680 aa  RPOC1_AETCO RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-110  51%  682 aa  RPOC1_PANGI RecName: Full=DNA-directed RNA polymerase subunit
    6::569     e-110  48%  682 aa  RPOC1_ACOGR RecName: Full=DNA-directed RNA polymerase subunit
    6::598     e-110  47%  682 aa  RPOC1_ACOCL RecName: Full=DNA-directed RNA polymerase subunit
    6::598     e-110  47%  682 aa  RPOC1_ACOAM RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-110  51%  680 aa  RPOC1_RANMC RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-110  47%  679 aa  RPOC1_PHAAO RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-110  51%  680 aa  RPOC1_NANDO RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-110  49%  685 aa  RPOC1_BUXMI RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-110  48%  679 aa  RPOC1_OENPA RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-110  48%  679 aa  RPOC1_OENGL RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-110  48%  679 aa  RPOC1_OENEH RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-110  48%  679 aa  RPOC1_OENBI RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-110  48%  679 aa  RPOC1_OENAR RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-110  52%  682 aa  RPOC1_EUCGG RecName: Full=DNA-directed RNA polymerase subunit
   10::566     e-110  47%  715 aa  RPOC1_ZYGCR RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-110  47%  676 aa  RPOC1_LOLPR RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-110  47%  683 aa  RPOC1_WHEAT RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-109  48%  681 aa  RPOC1_CYCTA RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-109  47%  682 aa  RPOC1_AGRST RecName: Full=DNA-directed RNA polymerase subunit
   10::543     e-109  48%  683 aa  RPOC1_MAIZE RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-109  52%  682 aa  RPOC1_PLAOC RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-109  47%  682 aa  RPOC1_HORVU RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-109  47%  682 aa  RPOC1_BRADI RecName: Full=DNA-directed RNA polymerase subunit
   10::543     e-109  48%  683 aa  RPOC1_SORBI RecName: Full=DNA-directed RNA polymerase subunit
   10::543     e-109  48%  683 aa  RPOC1_SACOF RecName: Full=DNA-directed RNA polymerase subunit
   10::543     e-109  48%  683 aa  RPOC1_SACHY RecName: Full=DNA-directed RNA polymerase subunit
    6::546     e-109  47%  685 aa  RPOC1_DIOEL RecName: Full=DNA-directed RNA polymerase subunit
    6::545     e-109  47%  684 aa  RPOC1_PHAVU RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-109  47%  682 aa  RPOC1_ORYSJ RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-109  47%  682 aa  RPOC1_ORYSI RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-109  47%  682 aa  RPOC1_ORYSA RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-109  47%  682 aa  RPOC1_ORYNI RecName: Full=DNA-directed RNA polymerase subunit
    1::550     e-108  48%  689 aa  RPOC1_ILLOL RecName: Full=DNA-directed RNA polymerase subunit
    6::547     e-108  48%  688 aa  RPOC1_CHLSC RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-108  50%  678 aa  RPOC1_CALFG RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-108  50%  682 aa  RPOC1_VITVI RecName: Full=DNA-directed RNA polymerase subunit
    6::549     e-108  46%  687 aa  RPOC1_SOLTU RecName: Full=DNA-directed RNA polymerase subunit
    6::544     e-108  48%  681 aa  RPOC1_LIRTU RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-108  50%  688 aa  RPOC1_PIPCE RecName: Full=DNA-directed RNA polymerase subunit
    6::668     e-107  44%  691 aa  RPOC1_JASNU RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-107  51%  677 aa  RPOC1_DAUCA RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-107  48%  680 aa  RPOC1_AMBTC RecName: Full=DNA-directed RNA polymerase subunit
    4::173     e-107  56%  843 aa  RPOC1_ODOSI RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-107  48%  681 aa  RPOC1_DRIGR RecName: Full=DNA-directed RNA polymerase subunit
    6::542     e-107  51%  680 aa  RPOC1_TOBAC RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-106  51%  680 aa  RPOC1_CERDE RecName: Full=DNA-directed RNA polymerase subunit
    6::545     e-106  47%  687 aa  RPOC1_SOYBN RecName: Full=DNA-directed RNA polymerase subunit
    1::550     e-106  49%  689 aa  RPOC1_POPTR RecName: Full=DNA-directed RNA polymerase subunit
    4::122     e-106  56%  696 aa  RPOC1_PHATR RecName: Full=DNA-directed RNA polymerase subunit
    6::611     e-105  49%  696 aa  RPOC1_PINKO RecName: Full=DNA-directed RNA polymerase subunit
    6::543     e-105  49%  682 aa  RPOC1_POPAL RecName: Full=DNA-directed RNA polymerase subunit
    6::541     e-105  50%  694 aa  RPOC1_GOSBA RecName: Full=DNA-directed RNA polymerase subunit
    6::670     e-105  43%  698 aa  RPOC1_CRYJA RecName: Full=DNA-directed RNA polymerase subunit
   17::550     e-104  49%  696 aa  RPOC1_GUIAB RecName: Full=DNA-directed RNA polymerase subunit
   10::543     e-104  49%  689 aa  RPOC1_LACSA RecName: Full=DNA-directed RNA polymerase subunit
   92::271     e-104  49%  863 aa  RPOC1_NEPOL RecName: Full=DNA-directed RNA polymerase subunit
   10::543     e-103  49%  689 aa  RPOC1_HELAN RecName: Full=DNA-directed RNA polymerase subunit
    3::611     e-103  47%  696 aa  RPOC1_PINTH RecName: Full=DNA-directed RNA polymerase subunit
    4::130     e-103  56%  732 aa  RPOC1_THAPS RecName: Full=DNA-directed RNA polymerase subunit
    5::565     e-102  49%  701 aa  RPOC1_PELHO RecName: Full=DNA-directed RNA polymerase subunit
    4::599     e-102  42%  676 aa  RPOC1_HUPLU RecName: Full=DNA-directed RNA polymerase subunit
    4::686     3e-98  43%  696 aa  RPOC1_WELMI RecName: Full=DNA-directed RNA polymerase subunit
    4::162     6e-97  47%  740 aa  RPOC1_OSTTA RecName: Full=DNA-directed RNA polymerase subunit
    3::541     3e-96  40%  586 aa  RPOC1_EUGGR RecName: Full=DNA-directed RNA polymerase subunit
    4::559     8e-95  44%  747 aa  RPOC1_GNEPA RecName: Full=DNA-directed RNA polymerase subunit
   12::716     5e-93  38% 1318 aa  RPOC2_SYNP6 RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   12::716     5e-93  38% 1318 aa  RPOC2_SYNE7 RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   32::717     4e-89  37% 1302 aa  RPOC2_SYNJA RecName: Full=DNA-directed RNA polymerase subunit beta'; 
    5::717     8e-87  36% 1317 aa  RPOC2_SYNY3 RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   11::525     1e-86  38% 1331 aa  RPOC2_SYNP2 RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   38::145     1e-86  57% 1021 aa  RPOC1_OLTVI RecName: Full=DNA-directed RNA polymerase subunit
   32::562     3e-86  40% 1304 aa  RPOC2_SYNJB RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   41::718     1e-85  37% 1364 aa  RPOC2_SYNS9 RecName: Full=DNA-directed RNA polymerase subunit beta'; 
    5::1228    1e-85  43% 1306 aa  RPOC2_CYAA5 RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   19::618     4e-85  37% 1330 aa  RPOC2_ACAM1 RecName: Full=DNA-directed RNA polymerase subunit beta'; 
    6::488     5e-85  34% 1292 aa  RPOC_CARRP RecName: Full=DNA-directed RNA polymerase subunit beta';  
   10::727     1e-84  36% 1324 aa  RPOC2_THEEB RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   36::628     1e-84  37% 1366 aa  RPOC2_PROMS RecName: Full=DNA-directed RNA polymerase subunit beta'; 
    5::652     3e-84  38% 1415 aa  RPOC2_TRIEI RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   10::608     3e-84  36% 1262 aa  RPOC2_GLOVI RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   36::740     5e-84  34% 1366 aa  RPOC2_PROMP RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   10::1272    6e-84  45% 1349 aa  RPOC2_NOSP7 RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   28::170     6e-84  54% 1578 aa  RPOC1_PSEAK RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   36::1268    2e-83  44% 1366 aa  RPOC2_PROM9 RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   14::628     2e-83  36% 1366 aa  RPOC2_PROM2 RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   36::628     2e-83  37% 1366 aa  RPOC2_PROM0 RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   36::481     3e-83  41% 1366 aa  RPOC2_PROM5 RecName: Full=DNA-directed RNA polymerase subunit beta'; 
    4::517     9e-83  39% 1334 aa  RPOC2_MICAN RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   38::481     1e-82  41% 1367 aa  RPOC2_PROMA RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   59::484     3e-82  43% 1369 aa  RPOC2_PROM1 RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   59::484     4e-82  43% 1369 aa  RPOC2_PROMT RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   38::757     7e-82  37% 1366 aa  RPOC2_PROM4 RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   39::479     1e-81  42% 1362 aa  RPOC2_SYNSC RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   40::549     2e-81  38% 1365 aa  RPOC2_SYNS3 RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   41::740     2e-81  34% 1368 aa  RPOC2_SYNR3 RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   11::515     2e-81  38% 1224 aa  RPOC2_PORPU RecName: Full=DNA-directed RNA polymerase subunit beta'';
   49::502     4e-81  41% 1374 aa  RPOC2_PROM3 RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   10::1266    5e-81  42% 1355 aa  RPOC2_ANAVT RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   10::1266    6e-81  42% 1355 aa  RPOC2_ANASP RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   49::502     8e-81  41% 1374 aa  RPOC2_PROMM RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   39::473     2e-80  41% 1363 aa  RPOC2_SYNPW RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   41::481     1e-79  43% 1364 aa  RPOC2_SYNPX RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   12::1178    2e-79  43% 1228 aa  RPOC2_GRATL RecName: Full=DNA-directed RNA polymerase subunit beta'';
    3::305     6e-79  52%  489 aa  RPC2B_CHLRE RecName: Full=DNA-directed RNA polymerase subunit beta'
   11::464     1e-78  38% 1226 aa  RPOC2_PORYE RecName: Full=DNA-directed RNA polymerase subunit beta'';
   16::1231    2e-77  40% 1269 aa  RPOC2_CYACA RecName: Full=DNA-directed RNA polymerase subunit beta'';
   16::1234    3e-77  44% 1303 aa  RPOC2_RHDSA RecName: Full=DNA-directed RNA polymerase subunit
   16::1282    9e-77  40% 1286 aa  RPOC2_GUITH RecName: Full=DNA-directed RNA polymerase subunit beta'';
   14::1228    8e-76  37% 1265 aa  RPOC2_CYAPA RecName: Full=DNA-directed RNA polymerase subunit beta'';
   30::569     1e-74  37% 1463 aa  RPOC2_NEPOL RecName: Full=DNA-directed RNA polymerase subunit beta'';
   24::1180    3e-74  42% 1223 aa  RPOC2_MESVI RecName: Full=DNA-directed RNA polymerase subunit beta'';
    7::1363    3e-74  42% 1396 aa  RPOC2_CHLAT RecName: Full=DNA-directed RNA polymerase subunit beta'';
   21::669     7e-74  37% 1372 aa  RPOC2_PAUCH RecName: Full=DNA-directed RNA polymerase subunit beta'';
    3::1387    1e-73  42% 1415 aa  RPOC2_PHATR RecName: Full=DNA-directed RNA polymerase subunit
   42::179     1e-73  53%  834 aa  RPOC1_STAPU RecName: Full=DNA-directed RNA polymerase subunit
   54::2605    2e-73  39% 2617 aa  RPOC2_OEDCA RecName: Full=DNA-directed RNA polymerase subunit beta'';
   35::1467    3e-73  40% 1481 aa  RPOC2_ODOSI RecName: Full=DNA-directed RNA polymerase subunit
   10::462     4e-73  43%  717 aa  RPOC2_NOSCO RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   51::209     4e-73  43% 1947 aa  RPOC1_OEDCA RecName: Full=DNA-directed RNA polymerase subunit beta'; 
   96::238     5e-73  51% 1529 aa  RPOC1_SCEOB RecName: Full=DNA-directed RNA polymerase subunit beta'; 
    8::1443    8e-71  39% 1446 aa  RPOC2_THAPS RecName: Full=DNA-directed RNA polymerase subunit beta'';
   66::2858    1e-70  44% 3120 aa  RPOC2_CHLRE RecName: Full=DNA-directed RNA polymerase subunit
    9::144     4e-70  47%  836 aa  RPOC1_CHLVU RecName: Full=DNA-directed RNA polymerase subunit
   10::1243    1e-69  40% 1267 aa  RPOC2_EMIHU RecName: Full=DNA-directed RNA polymerase subunit
   66::2551    7e-69  42% 2552 aa  RPOC2_SCEOB RecName: Full=DNA-directed RNA polymerase subunit
   77::1819    1e-67  40% 1859 aa  RPOC2_OLTVI RecName: Full=DNA-directed RNA polymerase subunit
   48::3442    1e-67  39% 3462 aa  RPOC2_PSEAK RecName: Full=DNA-directed RNA polymerase subunit
   11::1363    3e-66  41% 1412 aa  RPOC2_CHAVU RecName: Full=DNA-directed RNA polymerase subunit beta'';
    7::1010    4e-66  46% 1011 aa  RPOC2_OSTTA RecName: Full=DNA-directed RNA polymerase subunit
   34::1595    4e-66  40% 1595 aa  RPOC2_BIGNA RecName: Full=DNA-directed RNA polymerase subunit
   54::1555    1e-65  39% 1562 aa  RPOC2_CHLVU RecName: Full=DNA-directed RNA polymerase subunit
   42::141     6e-65  43%  760 aa  RPOC1_BIGNA RecName: Full=DNA-directed RNA polymerase subunit
   11::1016    3e-63  37% 1095 aa  RPOC2_ZYGCR RecName: Full=DNA-directed RNA polymerase subunit beta'';
   23::1120    5e-62  37% 1212 aa  RPOC2_CRYJA RecName: Full=DNA-directed RNA polymerase subunit beta'';
   11::1361    1e-61  37% 1373 aa  RPOC2_CHAGL RecName: Full=DNA-directed RNA polymerase subunit beta'';
   11::1266    2e-60  37% 1297 aa  RPOC2_WELMI RecName: Full=DNA-directed RNA polymerase subunit beta'';
   15::1320    6e-60  44% 1373 aa  RPOC2_AMBTC RecName: Full=DNA-directed RNA polymerase subunit
   24::1176    7e-59  38% 1224 aa  RPOC2_PINTH RecName: Full=DNA-directed RNA polymerase subunit beta'';
   24::1195    9e-59  38% 1209 aa  RPOC2_PINKO RecName: Full=DNA-directed RNA polymerase subunit beta'';
   12::1332    1e-58  37% 1408 aa  RPOC2_PSINU RecName: Full=DNA-directed RNA polymerase subunit beta'';
   20::1319    3e-58  39% 1339 aa  RPOC2_CYCTA RecName: Full=DNA-directed RNA polymerase subunit beta'';
    4::1351    4e-58  38% 1390 aa  RPOC2_DAUCA RecName: Full=DNA-directed RNA polymerase subunit
    5::1278    7e-58  37% 1330 aa  RPOC2_PHYPA RecName: Full=DNA-directed RNA polymerase subunit beta'';
    1::1320    7e-58  36% 1386 aa  RPOC2_MARPO RecName: Full=DNA-directed RNA polymerase subunit beta'';
    4::1330    7e-58  43% 1391 aa  RPOC2_COFAR RecName: Full=DNA-directed RNA polymerase subunit
   11::1338    4e-57  37% 1414 aa  RPOC2_ANGEV RecName: Full=DNA-directed RNA polymerase subunit
   15::1115    6e-57  37% 1250 aa  RPOC2_STAPU RecName: Full=DNA-directed RNA polymerase subunit
    1::1313    6e-57  36% 1376 aa  RPOC2_ANEMR RecName: Full=DNA-directed RNA polymerase subunit beta'';
   10::827     2e-56  37%  830 aa  RPOC2_EUGGR RecName: Full=DNA-directed RNA polymerase subunit
    1::1392    3e-55  37% 1445 aa  RPOC2_ANTFO RecName: Full=DNA-directed RNA polymerase subunit
   11::1183    5e-55  39% 1420 aa  RPOC2_ADICA RecName: Full=DNA-directed RNA polymerase subunit beta'';
    3::571     6e-55  35%  575 aa  RPOC1_ASTLO RecName: Full=DNA-directed RNA polymerase subunit
   11::1324    8e-55  42% 1383 aa  RPOC2_AETGR RecName: Full=DNA-directed RNA polymerase subunit
   11::1325    3e-54  42% 1379 aa  RPOC2_OLIPU RecName: Full=DNA-directed RNA polymerase subunit
   11::1325    5e-54  42% 1379 aa  RPOC2_NASOF RecName: Full=DNA-directed RNA polymerase subunit
   11::1325    5e-54  42% 1373 aa  RPOC2_LEPVR RecName: Full=DNA-directed RNA polymerase subunit
   11::1325    5e-54  42% 1381 aa  RPOC2_DRANE RecName: Full=DNA-directed RNA polymerase subunit
   11::1325    5e-54  42% 1371 aa  RPOC2_ARAHI RecName: Full=DNA-directed RNA polymerase subunit
   11::1325    7e-54  42% 1379 aa  RPOC2_CRUWA RecName: Full=DNA-directed RNA polymerase subunit
   11::1325    7e-54  42% 1379 aa  RPOC2_CAPBU RecName: Full=DNA-directed RNA polymerase subunit
   11::1322    7e-54  42% 1376 aa  RPOC2_ARATH RecName: Full=DNA-directed RNA polymerase subunit
   11::1326    7e-54  42% 1385 aa  RPOC2_AETCO RecName: Full=DNA-directed RNA polymerase subunit
   11::1325    9e-54  42% 1371 aa  RPOC2_LOBMA RecName: Full=DNA-directed RNA polymerase subunit
   15::1333    9e-54  40% 1394 aa  RPOC2_CUCSA RecName: Full=DNA-directed RNA polymerase subunit
    4::1331    2e-53  36% 1394 aa  RPOC2_VITVI RecName: Full=DNA-directed RNA polymerase subunit beta'';
   11::1325    2e-53  42% 1379 aa  RPOC2_BARVE RecName: Full=DNA-directed RNA polymerase subunit
    4::1318    3e-53  40% 1384 aa  RPOC2_SINAL RecName: Full=DNA-directed RNA polymerase subunit
   11::1513    4e-53  35% 1534 aa  RPOC2_SACOF RecName: Full=DNA-directed RNA polymerase subunit beta'';
   11::1513    4e-53  35% 1534 aa  RPOC2_SACHY RecName: Full=DNA-directed RNA polymerase subunit beta'';
    4::1341    4e-53  38% 1388 aa  RPOC2_PHAAO RecName: Full=DNA-directed RNA polymerase subunit beta'';
    1::1325    4e-53  38% 1383 aa  RPOC2_OENPA RecName: Full=DNA-directed RNA polymerase subunit
    1::1325    4e-53  38% 1383 aa  RPOC2_OENGL RecName: Full=DNA-directed RNA polymerase subunit
    1::1325    4e-53  38% 1383 aa  RPOC2_OENEH RecName: Full=DNA-directed RNA polymerase subunit
    1::1325    4e-53  38% 1383 aa  RPOC2_OENBI RecName: Full=DNA-directed RNA polymerase subunit
    1::1325    4e-53  38% 1383 aa  RPOC2_OENAR RecName: Full=DNA-directed RNA polymerase subunit
    1::1336    4e-53  41% 1403 aa  RPOC2_CITSI RecName: Full=DNA-directed RNA polymerase subunit
    4::1331    6e-53  38% 1392 aa  RPOC2_EUCGG RecName: Full=DNA-directed RNA polymerase subunit
    4::1315    7e-53  40% 1361 aa  RPOC2_SPIOL RecName: Full=DNA-directed RNA polymerase subunit
   11::1324    7e-53  39% 1387 aa  RPOC2_CARPA RecName: Full=DNA-directed RNA polymerase subunit
   11::1499    9e-53  35% 1520 aa  RPOC2_SORBI RecName: Full=DNA-directed RNA polymerase subunit beta'';
   15::1324    9e-53  41% 1381 aa  RPOC2_LACSA RecName: Full=DNA-directed RNA polymerase subunit
   11::1342    1e-52  41% 1390 aa  RPOC2_POPTR RecName: Full=DNA-directed RNA polymerase subunit
   11::1342    1e-52  41% 1390 aa  RPOC2_POPAL RecName: Full=DNA-directed RNA polymerase subunit
   11::1506    1e-52  35% 1527 aa  RPOC2_MAIZE RecName: Full=DNA-directed RNA polymerase subunit beta'';
   11::1133    1e-52  41% 1332 aa  RPOC2_LOTJA RecName: Full=DNA-directed RNA polymerase subunit
   11::1326    1e-52  39% 1389 aa  RPOC2_CHLSC RecName: Full=DNA-directed RNA polymerase subunit
   11::447     2e-52  35% 1386 aa  RPOC2_SOYBN RecName: Full=DNA-directed RNA polymerase subunit beta'';
    4::1328    2e-52  41% 1389 aa  RPOC2_MORIN RecName: Full=DNA-directed RNA polymerase subunit
   11::1330    2e-52  41% 1393 aa  RPOC2_GOSHI RecName: Full=DNA-directed RNA polymerase subunit
   11::1445    3e-52  38% 1466 aa  RPOC2_LOLPR RecName: Full=DNA-directed RNA polymerase subunit
    4::1336    3e-52  41% 1397 aa  RPOC2_JASNU RecName: Full=DNA-directed RNA polymerase subunit
   15::1324    4e-52  41% 1381 aa  RPOC2_GUIAB RecName: Full=DNA-directed RNA polymerase subunit
   11::1469    5e-52  38% 1479 aa  RPOC2_WHEAT RecName: Full=DNA-directed RNA polymerase subunit
    4::1331    5e-52  41% 1392 aa  RPOC2_SOLLC RecName: Full=DNA-directed RNA polymerase subunit
   11::1316    5e-52  37% 1377 aa  RPOC2_NANDO RecName: Full=DNA-directed RNA polymerase subunit beta'';
   15::1324    5e-52  41% 1362 aa  RPOC2_HELAN RecName: Full=DNA-directed RNA polymerase subunit
   11::1445    5e-52  38% 1466 aa  RPOC2_AGRST RecName: Full=DNA-directed RNA polymerase subunit
    4::1331    6e-52  41% 1392 aa  RPOC2_SOLTU RecName: Full=DNA-directed RNA polymerase subunit
    4::1331    6e-52  41% 1392 aa  RPOC2_SOLBU RecName: Full=DNA-directed RNA polymerase subunit
   11::1467    6e-52  38% 1477 aa  RPOC2_HORVU RecName: Full=DNA-directed RNA polymerase subunit
   11::1328    6e-52  41% 1391 aa  RPOC2_GOSBA RecName: Full=DNA-directed RNA polymerase subunit
   15::1324    6e-52  36% 1382 aa  RPOC2_DIOEL RecName: Full=DNA-directed RNA polymerase subunit beta'';
    4::1328    6e-52  41% 1389 aa  RPOC2_ATRBE RecName: Full=DNA-directed RNA polymerase subunit
   23::165     6e-52  41%  834 aa  RPOC1_HELSJ RecName: Full=DNA-directed RNA polymerase subunit
   18::1331    8e-52  42% 1392 aa  RPOC2_TOBAC RecName: Full=DNA-directed RNA polymerase subunit
   18::1331    8e-52  42% 1392 aa  RPOC2_NICSY RecName: Full=DNA-directed RNA polymerase subunit
   15::1326    1e-51  39% 1387 aa  RPOC2_PLAOC RecName: Full=DNA-directed RNA polymerase subunit
   11::1452    1e-51  38% 1513 aa  RPOC2_ORYSJ RecName: Full=DNA-directed RNA polymerase subunit
   11::1452    1e-51  38% 1513 aa  RPOC2_ORYSI RecName: Full=DNA-directed RNA polymerase subunit
   11::1452    1e-51  38% 1513 aa  RPOC2_ORYSA RecName: Full=DNA-directed RNA polymerase subunit
   11::1452    1e-51  38% 1513 aa  RPOC2_ORYNI RecName: Full=DNA-directed RNA polymerase subunit
    4::1330    1e-51  41% 1393 aa  RPOC2_MANES RecName: Full=DNA-directed RNA polymerase subunit
    4::1334    1e-51  39% 1401 aa  RPOC2_IPOPU RecName: Full=DNA-directed RNA polymerase subunit
    4::1331    1e-51  40% 1392 aa  RPOC2_NICTO RecName: Full=DNA-directed RNA polymerase subunit
    4::1326    2e-51  38% 1387 aa  RPOC2_PANGI RecName: Full=DNA-directed RNA polymerase subunit
   15::1321    2e-51  39% 1382 aa  RPOC2_LIRTU RecName: Full=DNA-directed RNA polymerase subunit
    4::1334    2e-51  41% 1379 aa  RPOC2_CUSEX RecName: Full=DNA-directed RNA polymerase subunit
   15::1325    2e-51  38% 1390 aa  RPOC2_CERDE RecName: Full=DNA-directed RNA polymerase subunit beta'';
  209::854     2e-51  34%  905 aa  RPOA1_THECE RecName: Full=DNA-directed RNA polymerase subunit A';  
   11::447     3e-51  31% 1366 aa  RPOC2_PHAVU RecName: Full=DNA-directed RNA polymerase subunit beta'';
   15::1328    3e-51  39% 1381 aa  RPOC2_DRIGR RecName: Full=DNA-directed RNA polymerase subunit
   11::1317    5e-51  38% 1373 aa  RPOC2_SILLA RecName: Full=DNA-directed RNA polymerase subunit
   11::1321    5e-51  39% 1383 aa  RPOC2_RANMC RecName: Full=DNA-directed RNA polymerase subunit
   11::1318    5e-51  36% 1366 aa  RPOC2_LEMMI RecName: Full=DNA-directed RNA polymerase subunit beta'';
  197::830     5e-51  31%  880 aa  RPOA1_SULSO RecName: Full=DNA-directed RNA polymerase subunit A';  
  274::887     5e-51  31%  971 aa  RPOA1_HALSA RecName: Full=DNA-directed RNA polymerase subunit A';  
   15::1324    7e-51  39% 1386 aa  RPOC2_ACOCL RecName: Full=DNA-directed RNA polymerase subunit
    5::1336    9e-51  37% 1376 aa  RPOC2_PELHO RecName: Full=DNA-directed RNA polymerase subunit
   15::1327    9e-51  38% 1401 aa  RPOC2_NYMAL RecName: Full=DNA-directed RNA polymerase subunit
    1::1320    9e-51  39% 1379 aa  RPOC2_CUSRE RecName: Full=DNA-directed RNA polymerase subunit
   15::1325    2e-50  40% 1377 aa  RPOC2_CALFG RecName: Full=DNA-directed RNA polymerase subunit
  197::830     2e-50  30%  880 aa  RPOA1_SULAC RecName: Full=DNA-directed RNA polymerase subunit A';  
   15::1331    6e-50  41% 1391 aa  RPOC2_BUXMI RecName: Full=DNA-directed RNA polymerase subunit
   16::1362    8e-49  40% 1380 aa  RPOC2_PIPCE RecName: Full=DNA-directed RNA polymerase subunit
    4::1365    2e-48  39% 1365 aa  RPOC2_FAGEA RecName: Full=DNA-directed RNA polymerase subunit
    5::839     2e-48  28%  885 aa  RPOA1_THEAC RecName: Full=DNA-directed RNA polymerase subunit A';  
  132::506     3e-48  49% 2430 aa  RPOC2_STIHE RecName: Full=DNA-directed RNA polymerase subunit
   48::224     3e-48  50%  277 aa  ARGE_LEPBI RecName: Full=Putative acetylornithine deacetylase;       
    1::203     2e-47  48%  203 aa  RPOC1_PROSC RecName: Full=DNA-directed RNA polymerase subunit
    1::203     2e-47  49%  203 aa  RPOC1_FISMU RecName: Full=DNA-directed RNA polymerase subunit
   10::815     8e-47  33%  817 aa  RPOC2_ASTLO RecName: Full=DNA-directed RNA polymerase subunit beta'';
    4::1324    1e-46  40% 1385 aa  RPOC2_ILLOL RecName: Full=DNA-directed RNA polymerase subunit
  206::838     7e-46  33%  889 aa  RPOA1_METVS RecName: Full=DNA-directed RNA polymerase subunit A';  
   28::1055    2e-45  36% 1058 aa  RPOC2_HELSJ RecName: Full=DNA-directed RNA polymerase subunit
    1::204     5e-44  47%  204 aa  RPOC1_PROV1 RecName: Full=DNA-directed RNA polymerase subunit
    1::201     9e-43  46%  204 aa  RPOC1_SYNPZ RecName: Full=DNA-directed RNA polymerase subunit
    1::144     3e-42  55%  203 aa  RPOC1_PROHO RecName: Full=DNA-directed RNA polymerase subunit
  199::823     6e-42  31%  870 aa  RPOA1_METTH RecName: Full=DNA-directed RNA polymerase subunit A';  
  229::1439    2e-41  32% 1733 aa  RPB1_YEAST RecName: Full=DNA-directed RNA polymerase II subunit
  339::1426    6e-41  34% 1460 aa  RPC1_YEAST RecName: Full=DNA-directed RNA polymerase III subunit
  346::1442    1e-40  34% 1457 aa  RPC1_DEBHA RecName: Full=DNA-directed RNA polymerase III subunit
   17::1440    1e-40  30% 1745 aa  RPB1_ASHGO RecName: Full=DNA-directed RNA polymerase II subunit
  335::1359    9e-40  35% 1390 aa  RPC1_BOVIN RecName: Full=DNA-directed RNA polymerase III subunit
  335::1359    2e-39  35% 1390 aa  RPC1_HUMAN RecName: Full=DNA-directed RNA polymerase III subunit
  335::1359    2e-39  35% 1390 aa  RPC1_CHICK RecName: Full=DNA-directed RNA polymerase III subunit
  329::1428    5e-39  34% 1450 aa  RPC1_DICDI RecName: Full=DNA-directed RNA polymerase III subunit
  242::1117    1e-37  32% 1840 aa  RPB1_ARATH RecName: Full=DNA-directed RNA polymerase II subunit
  289::1457    4e-37  34% 1727 aa  RPB1_DICDI RecName: Full=DNA-directed RNA polymerase II subunit
  244::1125    9e-37  30% 1970 aa  RPB1_MOUSE RecName: Full=DNA-directed RNA polymerase II subunit
  244::1125    9e-37  30% 1970 aa  RPB1_HUMAN RecName: Full=DNA-directed RNA polymerase II subunit
  195::1101    3e-34  33% 1599 aa  RPB1_ENCCU RecName: Full=DNA-directed RNA polymerase II subunit
    2::121     6e-34  35%  575 aa  RPOC1_PLAFA RecName: Full=DNA-directed RNA polymerase subunit
  297::1112    1e-32  31% 1495 aa  RPO1_MIMIV RecName: Full=DNA-directed RNA polymerase subunit 1;    
  199::818     3e-32  37%  865 aa  RPOA1_METTW RecName: Full=DNA-directed RNA polymerase subunit A';  
  307::1373    3e-32  38% 1405 aa  RPC1_SCHPO RecName: Full=DNA-directed RNA polymerase III subunit
  236::1445    2e-31  35% 1752 aa  RPB1_SCHPO RecName: Full=DNA-directed RNA polymerase II subunit
  316::1478    2e-31  42% 1530 aa  RPC1_TRYBB RecName: Full=DNA-directed RNA polymerase III subunit
  288::1020    3e-30  29% 1377 aa  RPB1_IIV3 RecName: Full=Probable DNA-directed RNA polymerase II
  328::1010    7e-30  35% 2452 aa  RPB1_PLAFD RecName: Full=DNA-directed RNA polymerase II subunit
  238::863     3e-29  36% 1852 aa  RPB1_CAEEL RecName: Full=DNA-directed RNA polymerase II subunit
  238::867     3e-29  35% 1853 aa  RPB1_CAEBR RecName: Full=DNA-directed RNA polymerase II subunit
  234::682     4e-29  35% 1579 aa  RPB1_PICGU RecName: Full=DNA-directed RNA polymerase II subunit
  294::1461    6e-29  35% 1887 aa  RPB1_DROME RecName: Full=DNA-directed RNA polymerase II subunit
  297::1467    3e-28  39% 1766 aa  RPB1B_TRYBB RecName: Full=DNA-directed RNA polymerase II subunit
  297::1467    3e-28  39% 1766 aa  RPB1A_TRYBB RecName: Full=DNA-directed RNA polymerase II subunit
  377::1240    9e-27  31% 1642 aa  RPA1_DROME RecName: Full=DNA-directed RNA polymerase I subunit
  430::1217    1e-26  31% 1664 aa  RPA1_YEAST RecName: Full=DNA-directed RNA polymerase I subunit RPA1; 
  417::1261    2e-26  33% 1720 aa  RPA1_HUMAN RecName: Full=DNA-directed RNA polymerase I subunit RPA1; 
  347::422     3e-26  27% 1026 aa  RPB1_IIV6 RecName: Full=Probable DNA-directed RNA polymerase II
  424::1268    4e-26  33% 1717 aa  RPA1_MOUSE RecName: Full=DNA-directed RNA polymerase I subunit RPA1; 
    1::132     2e-25  42% 1163 aa  RPOC2_PEA RecName: Full=DNA-directed RNA polymerase subunit beta'';  
  424::1268    6e-25  33% 1716 aa  RPA1_RAT RecName: Full=DNA-directed RNA polymerase I subunit RPA1;   
  329::2308    1e-24  34% 2339 aa  RPC1_PLAFA RecName: Full=DNA-directed RNA polymerase III subunit
  437::1045    8e-23  34% 1689 aa  RPA1_SCHPO RecName: Full=DNA-directed RNA polymerase I subunit
  207::384     5e-22  43%  603 aa  RPC1A_CHLRE RecName: Full=DNA-directed RNA polymerase subunit beta'
  403::1194    5e-22  40% 1744 aa  RPA1_TRYBB RecName: Full=DNA-directed RNA polymerase I subunit
  281::477     8e-20  37%  478 aa  RPB1_EUPOC RecName: Full=DNA-directed RNA polymerase II subunit
  398::995     4e-19  35% 1615 aa  RPA1_DICDI RecName: Full=DNA-directed RNA polymerase I subunit
  206::464     5e-19  43% 1341 aa  RPOA1_METJA RecName: Full=DNA-directed RNA polymerase subunit A';  
  271::1116    2e-18  35% 1450 aa  RPB1_ASFWA RecName: Full=Probable DNA-directed RNA polymerase
  271::1116    2e-18  35% 1450 aa  RPB1_ASFP4 RecName: Full=Probable DNA-directed RNA polymerase
  271::1116    2e-18  35% 1450 aa  RPB1_ASFM2 RecName: Full=Probable DNA-directed RNA polymerase
  271::1116    2e-18  35% 1450 aa  RPB1_ASFK5 RecName: Full=Probable DNA-directed RNA polymerase
  271::1116    2e-18  35% 1450 aa  RPB1_ASFB7 RecName: Full=Probable DNA-directed RNA polymerase
  683::1649    2e-17  41% 1741 aa  RPC1_GIALA RecName: Full=DNA-directed RNA polymerase III subunit
  116::953     6e-17  30%  960 aa  RPOC2_PLAFA RecName: Full=DNA-directed RNA polymerase subunit
  448::637     1e-14  35%  638 aa  RPA1_EUPOC RecName: Full=DNA-directed RNA polymerase I subunit
  268::470     1e-13  30% 1287 aa  RPO1_VACCW RecName: Full=DNA-directed RNA polymerase 147 kDa
  268::470     1e-13  30% 1286 aa  RPO1_VACCC RecName: Full=DNA-directed RNA polymerase 147 kDa
  268::470     1e-13  30% 1286 aa  RPO1_VARV RecName: Full=DNA-directed RNA polymerase 147 kDa
  268::470     1e-13  30% 1286 aa  RPO1_VACCA RecName: Full=DNA-directed RNA polymerase 147 kDa
  252::476     3e-12  29% 1287 aa  RPO1_FOWPV RecName: Full=DNA-directed RNA polymerase 147 kDa
   54::379     2e-10  53%  386 aa  RPOA2_METVS RecName: Full=DNA-directed RNA polymerase subunit A''; 
   66::253     2e-10  34%  349 aa  RPOA1_HALMO RecName: Full=DNA-directed RNA polymerase subunit A';  
    1::39      3e-10  72%   85 aa  RPOC2_GALSU RecName: Full=DNA-directed RNA polymerase subunit beta'';
   47::372     4e-10  53%  397 aa  RPOA2_META3 RecName: Full=DNA-directed RNA polymerase subunit A''; 
   43::368     8e-10  47%  380 aa  RPOA2_ARCFU RecName: Full=DNA-directed RNA polymerase subunit A''; 
   61::382     1e-09  37%  392 aa  RPOA2_METS5 RecName: Full=DNA-directed RNA polymerase subunit A''; 
   57::382     3e-09  44%  392 aa  RPOA2_SULTO RecName: Full=DNA-directed RNA polymerase subunit A''; 
  166::494     5e-09  28%  508 aa  RPOA2_THEAC RecName: Full=DNA-directed RNA polymerase subunit A'';   
  181::494     6e-09  44%  508 aa  RPOA2_THEVO RecName: Full=DNA-directed RNA polymerase subunit A''; 
   64::382     6e-09  45%  392 aa  RPOA2_SULSO RecName: Full=DNA-directed RNA polymerase subunit A''; 
   64::382     6e-09  45%  392 aa  RPOA2_SULIY RecName: Full=DNA-directed RNA polymerase subunit A''; 
   64::382     6e-09  45%  392 aa  RPOA2_SULIN RecName: Full=DNA-directed RNA polymerase subunit A''; 
   64::382     6e-09  45%  392 aa  RPOA2_SULIM RecName: Full=DNA-directed RNA polymerase subunit A''; 
   64::382     6e-09  45%  392 aa  RPOA2_SULIL RecName: Full=DNA-directed RNA polymerase subunit A''; 
   64::382     6e-09  45%  392 aa  RPOA2_SULIK RecName: Full=DNA-directed RNA polymerase subunit A''; 
   64::382     6e-09  45%  392 aa  RPOA2_SULIA RecName: Full=DNA-directed RNA polymerase subunit A''; 
  761::930     1e-08  34%  982 aa  RPOL_KLULA RecName: Full=Probable DNA-directed RNA polymerase;     
   54::391     1e-08  39%  391 aa  RPOA2_THEGJ RecName: Full=DNA-directed RNA polymerase subunit A''; 
   62::100     1e-08  54%  393 aa  RPOA2_SULAC RecName: Full=DNA-directed RNA polymerase subunit A''; 
   60::389     1e-08  34%  408 aa  RPOA2_METMA RecName: Full=DNA-directed RNA polymerase subunit A''; 
   57::375     1e-08  33%  397 aa  RPOA2_METAC RecName: Full=DNA-directed RNA polymerase subunit A''; 
   50::95      2e-08  57%  407 aa  RPOA2_AERPE RecName: Full=DNA-directed RNA polymerase subunit A''; 
   60::397     3e-08  48%  397 aa  RPOA2_PYRAB RecName: Full=DNA-directed RNA polymerase subunit A''; 
   58::391     4e-08  44%  391 aa  RPOA2_THEON RecName: Full=DNA-directed RNA polymerase subunit A''; 
   58::391     4e-08  38%  391 aa  RPOA2_PYRKO RecName: Full=DNA-directed RNA polymerase subunit A''; 
   60::379     4e-08  51%  397 aa  RPOA2_PYRHO RecName: Full=DNA-directed RNA polymerase subunit A''; 
   31::375     4e-08  37%  393 aa  RPOA2_HALMO RecName: Full=DNA-directed RNA polymerase subunit A''; 
   58::393     5e-08  44%  393 aa  RPOA2_THECE RecName: Full=DNA-directed RNA polymerase subunit A''; 
   60::397     5e-08  38%  397 aa  RPOA2_PYRFU RecName: Full=DNA-directed RNA polymerase subunit A''; 
   54::94      3e-07  51%  397 aa  RPOA2_HALSA RecName: Full=DNA-directed RNA polymerase subunit A''; 
   54::94      3e-07  51%  397 aa  RPOA2_HALS3 RecName: Full=DNA-directed RNA polymerase subunit A''; 
   54::384     3e-07  46%  395 aa  RPOA2_HALMA RecName: Full=DNA-directed RNA polymerase subunit A''; 
   51::372     2e-06  44%  379 aa  RPOA2_PYRAE RecName: Full=DNA-directed RNA polymerase subunit A''; 
   66::92      5e-06  70%  386 aa  RPOA2_METMP RecName: Full=DNA-directed RNA polymerase subunit A''; 
   66::92      5e-06  70%  386 aa  RPOA2_METM7 RecName: Full=DNA-directed RNA polymerase subunit A''; 
   66::92      5e-06  70%  386 aa  RPOA2_METM6 RecName: Full=DNA-directed RNA polymerase subunit A''; 
   66::370     5e-06  53%  386 aa  RPOA2_METM5 RecName: Full=DNA-directed RNA polymerase subunit A''; 
  138::164     7e-06  67%  449 aa  RPOA2_METTW RecName: Full=DNA-directed RNA polymerase subunit A''; 
  138::164     7e-06  67%  451 aa  RPOA2_METTH RecName: Full=DNA-directed RNA polymerase subunit A''; 
   76::133     1e-05  40%  462 aa  343L_IIV6 RecName: Full=Probable DNA-directed RNA polymerase
  797::859     4e-05  38%  859 aa  RPOA2_METJA RecName: Full=DNA-directed RNA polymerase subunit A'';   
  787::1152    2e-64  43% 1152 aa  RPOC_CARHZ RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1024->1366)
  918::1164    4e-62  47% 1184 aa  RPOC_THEP3 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1115->1363)
  918::1153    7e-62  50% 1183 aa  RPOC_THETN RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1115->1352)
  904::1151    2e-57  48% 1161 aa  RPOC_DESHY RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1115->1366)
  809::1153    7e-58  41% 1178 aa  RPOC_CLOBM RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1029->1351)
  816::1168    6e-61  41% 1185 aa  RPOC_CLONN RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1029->1360)
  809::1173    2e-58  41% 1178 aa  RPOC_CLOBK RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1029->1373)
  918::1153    3e-62  50% 1184 aa  RPOC_THEPX RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1115->1352)
  802::1157    2e-63  45% 1165 aa  RPOC_CLOTH RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1024->1356)
  804::1161    6e-55  39% 1161 aa  RPOC_CLOD6 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1029->1365)
  808::1171    1e-57  40% 1182 aa  RPOC_CLOAB RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1029->1371)
  809::1173    1e-58  41% 1178 aa  RPOC_CLOBH RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1029->1373)
  809::1173    1e-58  41% 1178 aa  RPOC_CLOB1 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1029->1373)
  814::1135    2e-46  37% 1135 aa  RPOC_CLOTE RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1021->1334)
  899::1132    1e-54  48% 1154 aa  RPOC_DESAP RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1115->1351)
  814::1173    2e-58  40% 1178 aa  RPOC_CLOBL RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1021->1373)
  904::1180    3e-58  48% 1185 aa  RPOC_DESRM RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1115->1389)
  899::1133    3e-54  48% 1170 aa  RPOC_PELTS RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1115->1352)
  809::1162    3e-59  40% 1178 aa  RPOC_CLOB8 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1029->1361)
  813::1157    2e-60  44% 1168 aa  RPOC_CALS8 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1029->1352)
  884::1164    4e-54  46% 1171 aa  RPOC_ALKMQ RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1087->1367)
  814::1155    2e-54  41% 1179 aa  RPOC_SYMTH RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1032->1351)
  943::1192    3e-55  48% 1199 aa  RPOC_GEOKA RecName: Full=DNA-directed RNA polymerase subunit beta';(query 1115->1358)
  906::1175    2e-54  47% 1206 aa  RPOC_BACHD RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1351)
  943::1192    6e-55  48% 1199 aa  RPOC_GEOTN RecName: Full=DNA-directed RNA polymerase subunit beta';(query 1115->1358)
  906::1177    2e-56  47% 1199 aa  RPOC_BACLD RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1351)
  906::1177    6e-55  47% 1199 aa  RPOC_BACSU RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1351)
  832::1202    1e-55  38% 1203 aa  RPOC_BACCR RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1029->1377)
  832::1202    4e-56  38% 1203 aa  RPOC_BACHK RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1029->1377)
  832::1202    4e-56  38% 1203 aa  RPOC_BACCZ RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1029->1377)
  832::1202    1e-56  38% 1203 aa  RPOC_BACC1 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1029->1377)
  832::1202    4e-56  38% 1203 aa  RPOC_BACAN RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1029->1377)
  832::1202    4e-56  38% 1203 aa  RPOC_BACAH RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1029->1377)
  906::1177    9e-56  47% 1199 aa  RPOC_BACP2 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1351)
  832::1202    3e-55  37% 1203 aa  RPOC_BACWK RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1029->1377)
  906::1052    1e-09  32% 1053 aa  RPOC_LISGR RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1226)
  832::1176    1e-54  42% 1203 aa  RPOC_OCEIH RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1029->1351)
  927::1181    1e-53  45% 1181 aa  RPOC_SYNWW RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1115->1371)
  906::1176    7e-45  42% 1199 aa  RPOC_EXIS2 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1351)
  906::1206    2e-51  45% 1206 aa  RPOC_BACSK RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1377)
  907::1203    3e-56  42% 1204 aa  RPOC_BACCN RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1377)
  906::1198    3e-48  41% 1201 aa  RPOC_LISIN RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1373)
  906::1198    4e-48  41% 1201 aa  RPOC_LISMF RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1373)
  906::1198    2e-48  41% 1201 aa  RPOC_LISW6 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1373)
  906::1198    2e-48  41% 1201 aa  RPOC_LISMO RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1373)
  934::1222    3e-53  45% 1227 aa  RPOC_LYSSC RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1370)
  906::1177    2e-55  47% 1199 aa  RPOC_BACA2 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1351)
  906::1179    2e-49  44% 1217 aa  RPOC_ENTFA RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1352)
  912::1181    6e-57  45% 1218 aa  RPOC_NATTJ RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1088->1351)
  906::1181    1e-48  42% 1216 aa  RPOC_STRA5 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  906::1181    1e-48  42% 1216 aa  RPOC_STRA3 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  906::1181    1e-48  42% 1216 aa  RPOC_STRA1 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  910::1181    2e-53  46% 1207 aa  RPOC_STAES RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1351)
  910::1181    2e-53  46% 1207 aa  RPOC_STAEQ RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1351)
  910::1191    7e-54  45% 1206 aa  RPOC_STAHJ RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1362)
  821::1172    5e-59  42% 1255 aa  RPOC_CLOPH RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1029->1351)
  906::1180    4e-49  43% 1211 aa  RPOC_STRS7 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1351)
  906::1180    4e-49  43% 1211 aa  RPOC_STRE4 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1351)
  807::1152    2e-58  42% 1202 aa  RPOC_FINM2 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1029->1352)
  910::1191    2e-54  45% 1207 aa  RPOC_STAAR RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1362)
  910::1191    2e-54  45% 1207 aa  RPOC_STAAW RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1362)
  910::1056    5e-14  36% 1057 aa  RPOC_STAAU RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1226)
  910::1191    2e-54  45% 1207 aa  RPOC_STAAS RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1362)
  910::1191    2e-54  45% 1207 aa  RPOC_STAAN RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1362)
  910::1191    2e-54  45% 1207 aa  RPOC_STAAM RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1362)
  910::1191    2e-54  45% 1207 aa  RPOC_STAAC RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1362)
  910::1191    2e-54  45% 1207 aa  RPOC_STAA8 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1362)
  910::1191    2e-54  45% 1207 aa  RPOC_STAA3 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1362)
  830::1181    3e-49  38% 1212 aa  RPOC_STRU0 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1024->1352)
  910::1191    2e-54  45% 1207 aa  RPOC_STAAB RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1362)
  906::1181    5e-49  42% 1213 aa  RPOC_STRPM RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  906::1181    5e-49  42% 1213 aa  RPOC_STRPF RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  906::1181    5e-49  42% 1207 aa  RPOC_STRPC RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  906::1181    5e-49  42% 1207 aa  RPOC_STRPB RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  906::1181    5e-49  42% 1213 aa  RPOC_STRP8 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  906::1181    5e-49  42% 1213 aa  RPOC_STRPD RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  943::1052    2e-11  36% 1053 aa  RPOC_BROTH RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1115->1226)
  906::1181    4e-49  42% 1213 aa  RPOC_STRP1 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  906::1181    5e-49  42% 1213 aa  RPOC_STRPG RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  906::1181    5e-49  42% 1207 aa  RPOC_STRP3 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  906::1181    5e-49  42% 1213 aa  RPOC_STRP6 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  910::1181    2e-54  46% 1207 aa  RPOC_STAS1 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1351)
  825::1179    7e-48  39% 1207 aa  RPOC_LACLA RecName: Full=DNA-directed RNA polymerase subunit beta';(query 1023->1351)
  906::1181    9e-48  42% 1209 aa  RPOC_STRMU RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  905::1180    3e-49  43% 1215 aa  RPOC_STRGC RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  905::1198    2e-50  43% 1215 aa  RPOC_STRSY RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1371)
  905::1198    2e-50  43% 1215 aa  RPOC_STRS2 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1371)
  825::1179    1e-47  39% 1207 aa  RPOC_LACLM RecName: Full=DNA-directed RNA polymerase subunit beta';(query 1023->1351)
  947::1201    9e-46  37% 1215 aa  RPOC_LACF3 RecName: Full=DNA-directed RNA polymerase subunit beta';(query 1118->1374)
  905::1180    1e-49  43% 1215 aa  RPOC_STRSV RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  906::1181    1e-48  42% 1212 aa  RPOC_STRTD RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  906::1181    1e-48  42% 1212 aa  RPOC_STRT2 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  906::1181    1e-48  42% 1212 aa  RPOC_STRT1 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  948::1180    4e-49  43% 1214 aa  RPOC_LACSS RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1119->1352)
  943::1180    3e-47  43% 1213 aa  RPOC_LACPL RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1115->1353)
  948::1188    4e-50  45% 1220 aa  RPOC_LACC3 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1119->1359)
  948::1188    4e-50  45% 1220 aa  RPOC_LACCB RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1119->1359)
  905::1180    3e-48  43% 1225 aa  RPOC_STRR6 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  905::1180    3e-48  43% 1225 aa  RPOC_STRZT RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  905::1180    3e-48  43% 1225 aa  RPOC_STRZP RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  905::1180    3e-48  43% 1225 aa  RPOC_STRZJ RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  905::1180    3e-48  43% 1225 aa  RPOC_STRPS RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  905::1180    3e-48  43% 1225 aa  RPOC_STRPN RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  905::1180    3e-48  43% 1225 aa  RPOC_STRPJ RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  905::1180    3e-48  43% 1225 aa  RPOC_STRPI RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  905::1180    3e-48  43% 1225 aa  RPOC_STRP7 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  905::1180    3e-48  43% 1225 aa  RPOC_STRP4 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  905::1180    3e-48  43% 1225 aa  RPOC_STRP2 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1352)
  947::1180    1e-44  40% 1211 aa  RPOC_LACRJ RecName: Full=DNA-directed RNA polymerase subunit beta';(query 1118->1352)
  947::1180    1e-44  40% 1211 aa  RPOC_LACRD RecName: Full=DNA-directed RNA polymerase subunit beta';(query 1118->1352)
  953::1186    2e-50  45% 1233 aa  RPOC_OENOB RecName: Full=DNA-directed RNA polymerase subunit beta';(query 1118->1352)
  950::1181    1e-45  42% 1220 aa  RPOC_LEUCK RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1120->1352)
  951::1184    2e-48  44% 1217 aa  RPOC_LACH4 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1119->1353)
  951::1184    9e-48  44% 1217 aa  RPOC_LACAC RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1119->1353)
  839::988     5e-12  33%  989 aa  RPOC_STRPY RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1226)
 1052::1328    2e-39  36% 1353 aa  RPOC_ONYPE RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1351)
  879::1249    7e-29  33% 1255 aa  RPOC_MYCCT RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1005->1366)
 1124::1357    1e-46  44% 1375 aa  RPOC_ACHLI RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1120->1355)
  879::1249    3e-28  31% 1255 aa  RPOC_MYCMS RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1005->1366)
  877::1046    3e-25  36% 1054 aa  RPOC_WEIPA RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1115->1284)
  877::1039    3e-24  34% 1046 aa  RPOC_WEIHE RecName: Full=DNA-directed RNA polymerase subunit beta';(query 1115->1278)
 1052::1328    2e-39  36% 1353 aa  RPOC_AYWBP RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1094->1351)
 1010::1252    1e-51  46% 1290 aa  RPOC_NOCSJ RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1120->1365)
 1011::1253    2e-50  47% 1296 aa  RPOC_BEUC1 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1120->1365)
 1014::1276    1e-52  46% 1299 aa  RPOC_ARTAT RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1120->1391)
  886::1003    5e-17  38% 1004 aa  RPOC_OENOE RecName: Full=DNA-directed RNA polymerase subunit beta';(query 1118->1236)
 1014::1276    1e-50  44% 1299 aa  RPOC_ARTCA RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1120->1391)
 1012::1260    2e-50  44% 1297 aa  RPOC_SALTO RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1115->1365)
  982::1277    1e-51  43% 1304 aa  RPOC_ACIC1 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1381)
 1012::1260    5e-51  44% 1297 aa  RPOC_SALAI RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1115->1365)
 1007::1276    3e-48  43% 1299 aa  RPOC_ARTS2 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1113->1391)
  974::1239    1e-53  45% 1291 aa  RPOC_THEFY RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1087->1351)
 1008::1272    2e-52  44% 1291 aa  RPOC_LEIXX RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1120->1386)
  829::1253    2e-50  39% 1293 aa  RPOC_KINRD RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 940->1365)
  973::1252    2e-49  44% 1295 aa  RPOC_FRASC RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1365)
  897::1252    2e-50  40% 1296 aa  RPOC_FRAAA RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 987->1365)
 1089::1430    6e-49  47% 1503 aa  RPOC_CHLSY RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1367)
 1089::1430    6e-49  47% 1503 aa  RPOC_CHLAA RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1095->1367)
 1008::1266    5e-55  48% 1296 aa  RPOC_KOCRD RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1116->1381)
 1016::1276    1e-53  44% 1299 aa  RPOC_CLAM3 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1120->1382)
 1016::1276    1e-53  44% 1299 aa  RPOC_CLAMS RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1120->1382)
  972::1249    3e-50  45% 1303 aa  RPOC_SACEN RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1351)
 1031::1285    1e-54  46% 1295 aa  RPOC_RUBXD RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1119->1366)
  981::1278    3e-54  43% 1299 aa  RPOC_STRCO RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1383)
 1007::1243    3e-51  47% 1299 aa  RPOC_RENSM RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1113->1351)
  970::1261    8e-39  48% 1295 aa  RPOC_DEHSB RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1120->1346)
  970::1261    6e-39  48% 1295 aa  RPOC_DEHSC RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1120->1346)
  973::1252    1e-48  43% 1296 aa  RPOC_FRASN RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1365)
  883::988     1e-10  34%  989 aa  RPOC_LEUPS RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1120->1226)
 1011::1240    4e-46  46% 1298 aa  RPOC_MICLC RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1120->1351)
  981::1278    4e-54  43% 1299 aa  RPOC_STRAW RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1383)
  987::1264    9e-54  48% 1316 aa  RPOC_MYCTU RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1351)
  987::1264    9e-54  48% 1316 aa  RPOC_MYCTA RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1351)
  987::1264    9e-54  48% 1316 aa  RPOC_MYCBT RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1351)
  987::1264    9e-54  48% 1316 aa  RPOC_MYCBP RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1351)
  987::1264    9e-54  48% 1316 aa  RPOC_MYCBO RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1351)
  924::1313    5e-52  40% 1337 aa  RPOC_BIFAA RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1018->1392)
  986::1263    1e-53  47% 1315 aa  RPOC_MYCSS RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1351)
  986::1263    1e-53  47% 1315 aa  RPOC_MYCSK RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1351)
  986::1263    1e-53  47% 1315 aa  RPOC_MYCSJ RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1351)
  930::1270    3e-50  41% 1345 aa  RPOC_BIFA0 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1020->1361)
  887::1286    3e-49  37% 1333 aa  RPOC_COREF RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 971->1352)
  986::1264    7e-51  48% 1318 aa  RPOC_RHOOB RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1351)
 1009::1286    3e-49  44% 1333 aa  RPOC_CORGL RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1092->1352)
 1009::1286    3e-49  44% 1333 aa  RPOC_CORGB RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1092->1352)
  986::1264    7e-51  48% 1318 aa  RPOC_RHOSR RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1351)
  987::1264    9e-53  48% 1316 aa  RPOC_MYCUA RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1351)
  986::1264    5e-49  47% 1317 aa  RPOC_NOCFA RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1351)
  987::1264    4e-53  48% 1316 aa  RPOC_MYCMM RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1351)
  987::1264    5e-54  49% 1316 aa  RPOC_MYCA1 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1351)
  987::1264    5e-54  49% 1316 aa  RPOC_MYCPA RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1351)
  987::1264    2e-53  48% 1316 aa  RPOC_MYCLE RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1351)
  987::1264    2e-53  48% 1316 aa  RPOC_MYCLB RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1351)
  986::1264    4e-51  48% 1318 aa  RPOC_RHOE4 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1082->1351)
 1031::1278    4e-48  46% 1345 aa  RPOC_BIFLO RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1120->1361)
 1031::1278    4e-48  46% 1345 aa  RPOC_BIFLD RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1120->1361)
 1003::1286    9e-48  44% 1332 aa  RPOC_CORK4 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1092->1365)
  998::1279    2e-34  34% 1290 aa  RPOC_MYCPN RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1076->1358)
 1000::1279    1e-35  35% 1292 aa  RPOC_MYCGE RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1076->1356)
 1214::1477    1e-55  47% 1524 aa  RPOC_THEAQ RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1087->1350)
 1251::1477    3e-55  50% 1524 aa  RPOC_THET2 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1120->1350)
 1251::1477    1e-55  51% 1524 aa  RPOC_THET8 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1120->1350)
 1261::1407    1e-15  36% 1649 aa  RPOC_THEM4 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 876->1015)
 1296::1477    1e-22  36% 1643 aa  RPOC_PETMO RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1120->1296)
 1330::1671    2e-14  33% 1690 aa  RPOC_THENN RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1076->1353)
 1287::1447    2e-15  40% 1690 aa  RPOC_THEMA RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 876->1015)
 1330::1671    2e-20  35% 1690 aa  RPOC_THESQ RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1076->1353)
 1330::1671    5e-20  34% 1690 aa  RPOC_THEP1 RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 1076->1353)
 1262::1406    1e-22  45% 1650 aa  RPOC_FERNB RecName: Full=DNA-directed RNA polymerase subunit beta';  (query 876->1015)
 1033::1434    8e-39  34% 1464 aa  RPOC_MYCA5 RecName: Full=DNA-directed RNA polymerase subunit beta';(query 1024->1384)
  995::1385    3e-39  33% 1426 aa  RPOC_MYCPU RecName: Full=DNA-directed RNA polymerase subunit beta';(query 998->1357)
 1163::1404    1e-30  37% 1492 aa  RPOC_MYCS5 RecName: Full=DNA-directed RNA polymerase subunit beta';(query 1119->1349)
   87::384     6e-05  31%  397 aa  RPOA2_HALSA RecName: Full=DNA-directed RNA polymerase subunit A''; (query 1115->1350)
   87::384     6e-05  31%  397 aa  RPOA2_HALS3 RecName: Full=DNA-directed RNA polymerase subunit A''; (query 1115->1350)
   84::370     2e-05  29%  386 aa  RPOA2_METMP RecName: Full=DNA-directed RNA polymerase subunit A''; (query 1115->1350)
   84::370     1e-05  30%  386 aa  RPOA2_METM7 RecName: Full=DNA-directed RNA polymerase subunit A''; (query 1115->1350)
   84::370     1e-05  30%  386 aa  RPOA2_METM6 RecName: Full=DNA-directed RNA polymerase subunit A''; (query 1115->1350)
    1::1417

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNNGILHQNYNSKKFDIIKISLASPEVIRSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_FRATM      MNNGILHQNYNSKKFDIIKISLASPEVIRSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_FRATW      MNNGILHQNYNSKKFDIIKISLASPEVIRSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_FRATT      MNNGILHQNYNSKKFDIIKISLASPEVIRSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_FRATN      MNNGILHQNYNSKKFDIIKISLASPEVIRSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_FRAT1      MNNGILHQNYNSKKFDIIKISLASPEVIRSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_FRATO      MNNGILHQNYNSKKFDIIKISLASPEVIRSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_FRATH      MNNGILHQNYNSKKFDIIKISLASPEVIRSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_FRAP2      MNNGILHQNYNSKKFDIIKISLASPEVIRSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_PSEPF      ------------EEFDAIRIGLASPEMIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_PSEE4      ------------EEFDAIRIGLASPEMIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_PSEF5      ------------EEFDAIRIGLASPEMIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_PSEA7      ------------EEFDAIRIGLASPEMIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_PSEU5      ------------EEFDAIKIALASPEMIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_PSEPG      ------------EEFDAIRIGLASPEMIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_PSEAE      ------------EEFDAIRIGLASPEMIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_PSEAB      ------------EEFDAIRIGLASPEMIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_PSEPW      ------------EEFDAIRIGLASPEMIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_PSEPK      ------------EEFDAIRIGLASPEMIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_PSEP1      ------------EEFDAIRIGLASPEMIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_PSEFS      ------------EEFDAIRIGLASPEMIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_PSEU2      ------------EEFDAIRIGLASPEMIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_PSE14      ------------EEFDAIRIGLASPEMIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_PSESM      ------------EEFDAIRIGLASPEMIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_PSEMY      ------------EEFDAIRIGLASPEMIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_CELJU      ------------EEFDSIRISLASPEMIRSWSFGEVKKPETINYRTFKPEREGLFCAKIFGPVKDYECLC
RPOC_LEGPH      ---GILKQQGQSEEFDAIKIALASPELIRSWSYGEVKKPETINYRTFKPERDGLFCAKTFGPVKDYECLC
RPOC_LEGPC      ---GILKQQGQSEEFDAIKIALASPELIRSWSYGEVKKPETINYRTFKPERDGLFCAKTFGPVKDYECLC
RPOC_LEGPA      ---GILKQQGQSEEFDAIKIALASPELIRSWSYGEVKKPETINYRTFKPERDGLFCAKTFGPVKDYECLC
RPOC_LEGPL      ---GILKQQGQSEEFDAIKIALASPELIRSWSYGEVKKPETINYRTFKPERDGLFCAKTFGPVKDYECLC
RPOC_SACD2      -----------SDEFDGIRIGLASPDMIRSWSYGEVKKPETINYRTFKPEREGLFCAKVFGPVKDYECLC
RPOC_SHEAM      -----LKQQGKTEEFEGIKIGLASPDLIRSWSFGEVKKPETINYRTFKPEREGLFCARIFGPVKDYECLC
RPOC_ACIAD      -------------EFDRIRIGLASPEMIKSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_ACIBY      -------------EFDRIRIGLASPEMIKSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_ACIBT      -------------EFDRIRIGLASPEMIKSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_ACIBC      -------------EFDRIRIGLASPEMIKSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_ACIBS      -------------EFDRIRIGLASPEMIKSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_VIBF1      -----LKAQHKTEEFDAIKIGLASPDQIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_NITOC      ----LLKQQNQVEEFDSIRIGLASPDMIRAWSYGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_SHESR      -----LKQQSKTEEFNGIKIGLASPDLIRSWSFGEVKKPETINYRTFKPEREGLFCARIFGPVKDYECLC
RPOC_SHEON      -----LKQQSKTEEFNGIKIGLASPDLIRSWSFGEVKKPETINYRTFKPEREGLFCARIFGPVKDYECLC
RPOC_SHESM      -----LKQQSKTEEFNGIKIGLASPDLIRSWSFGEVKKPETINYRTFKPEREGLFCARIFGPVKDYECLC
RPOC_MARMS      ---GLLKSQGQSDEFDAIRIGLASPDMIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_VIBPA      -----LKAQHKTEEFDAIKIGLSSPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_VIBCH      -----LKAQHKTEEFDAIKIGLASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_VIBC3      -----LKAQHKTEEFDAIKIGLASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_VIBVY      -----LKAQHKTEEFDAIKIGLSSPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_VIBVU      -----LKAQHKTEEFDAIKIGLSSPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_HALHL      --------------FDAIRIGLASPEMIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_ALHEH      --------------FDAIRIGLASPEMIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_SHESA      -----LKQQSKTEEFNGIKIGLASPDLIRSWSFGEVKKPETINYRTFKPEREGLFCARIFGPVKDYECLC
RPOC_NITMU      ----LFKQVTQKEEFDSIKIGLASPEKIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_AZOSB      ----------NEEEFDAITIGLASPDKIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_HAEDU      -------QSKSNDDFDVIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_THICR      ---GFLKKQNVSSDFDTIKVTLASPEKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIRDYECLC
RPOC_COLP3      -----LKQQNQTEDFDGIRIGLASPDLVRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_VIBHB      -----LKAQHKTEEFDAIKIGLSSPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_HAHCH      --NLLKNQNY-AHEFDSIRISLASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_AZOSE      ----------NEDQFDAITIGLASPDKIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_NITEU      ----LFKQVTQKEEFDSIKIGLASPEKIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_SHESW      -----LKQQSKTEEFNGIKIGLASPDLIRSWSFGEVKKPETINYRTFKPEREGLFCARIFGPVKDYECLC
RPOC_SHEPC      -----LKQQSKTEEFNGIKIGLASPDLIRSWSFGEVKKPETINYRTFKPEREGLFCARIFGPVKDYECLC
RPOC_ALCBS      -------------EFDKIRIALAPPDLIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_SHEB9      -----LKQQSKTEEFNGIKIGLASPDLIRSWSFGEVKKPETINYRTFKPEREGLFCARIFGPVKDYECLC
RPOC_SHEB8      -----LKQQSKTEEFNGIKIGLASPDLIRSWSFGEVKKPETINYRTFKPEREGLFCARIFGPVKDYECLC
RPOC_SHEB2      -----LKQQSKTEEFNGIKIGLASPDLIRSWSFGEVKKPETINYRTFKPEREGLFCARIFGPVKDYECLC
RPOC_CHRVO      ----LFKQVTQEEEFDAIKIGIASPDKIRSWSYGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_METFK      ----LFKQVTQEEEFDAIKIALASPEKIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_SHEDO      -----LKQQSKTEEFNGIKIGLASPDLIRSWSFGEVKKPETINYRTFKPEREGLFCARIFGPVKDYECLC
RPOC_XANC5      ----LFNQQRQTLDFDAIKIALASPDLIRSWSYGEVKKPETINYRTFKPERDGLFCAAIFGPIKDYECLC
RPOC_XANAC      ----LFNQQRQTLDFDAIKIALASPDLIRSWSYGEVKKPETINYRTFKPERDGLFCAAIFGPIKDYECLC
RPOC_PHOPR      -----LKAQHKTEEFDAIKIGLASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_STRMK      ----LFNQQRQTLDFDAIKIALASPDLIRSWSFGEVKKPETINYRTFKPERDGLFCAAIFGPVKDYECLC
RPOC_NITEC      ----LFKQVTQKEEFDSIKIGLASPEKIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_XANCP      ----LFNQQRQTLDFDAIKIALASPDLIRSWSYGEVKKPETINYRTFKPERDGLFCAAIFGPIKDYECLC
RPOC_XANC8      ----LFNQQRQTLDFDAIKIALASPDLIRSWSYGEVKKPETINYRTFKPERDGLFCAAIFGPIKDYECLC
RPOC_XANOR      ----LFNQQRQTLDFDAIKIALASPDLIRSWSYGEVKKPETINYRTFKPERDGLFCAAIFGPIKDYECLC
RPOC_XANOP      ----LFNQQRQTLDFDAIKIALASPDLIRSWSYGEVKKPETINYRTFKPERDGLFCAAIFGPIKDYECLC
RPOC_XANOM      ----LFNQQRQTLDFDAIKIALASPDLIRSWSYGEVKKPETINYRTFKPERDGLFCAAIFGPIKDYECLC
RPOC_XANCB      ----LFNQQRQTLDFDAIKIALASPDLIRSWSYGEVKKPETINYRTFKPERDGLFCAAIFGPIKDYECLC
RPOC_ACTP7      -------QSKSNDDFDVIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_SHEHH      -----LKQQSKTEEFDGIKIGLASPDLIRSWSFGEVKKPETINYRTFKPEREGLFCARIFGPVKDYECLC
RPOC_SHEFN      -----LKQQSKTEEFNGIKIGLASPDLIRSWSFGEVKKPETINYRTFKPEREGLFCARIFGPVKDYECLC
RPOC_COXBN      -----LKSEKHTAEFDALRIKLASPEEVRSWSYGEVKKPETINYRTFKPEREGLFCAKIFGPIKDYECLC
RPOC_MARAV      ----LLKSQNQSKEFDAIRIGLASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_METCA      -----LKRQTQSEEFDAIRISLASPDMIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPVSDYECLC
RPOC_ACTP2      -------QSKSNDDFDVIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_COXBU      -----LKSEKHTAEFDALRIKLASPEEVRSWSYGEVKKPETINYRTFKPEREGLFCAKIFGPIKDYECLC
RPOC_COXBR      -----LKSEKHTAEFDALRIKLASPEEVRSWSYGEVKKPETINYRTFKPEREGLFCAKIFGPIKDYECLC
RPOC_BLOFL      ------HSNGKIEEFNTIKIQLASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCSRIFGPIKDYECLC
RPOC_ACTPJ      -------QSKSNDDFDVIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_PASMU      -------QSKTSEDFDVIKIGLASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_SHELP      -----LKQQSKTEEFEGIKIGLASPDLIRSWSFGEVKKPETINYRTFKPEREGLFCARIFGPVKDYECLC
RPOC_BLOPB      -------QHTQIEEFNAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_SHEPW      -----LKQQSKTEEFEGIKIGLASPDLIRSWSFGEVKKPETINYRTFKPEREGLFCARIFGPVKDYECLC
RPOC_ACTSZ      --NFLKAQSKTAEDFDVIKIGLASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_THIDA      ----LFKQATHEEEFDAIKIGLASPDKIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_PHOLL      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_SHEWM      -----LKQQSKTEEFNGIKIGLASPDLIRSWSFGEVKKPETINYRTFKPEREGLFCARIFGPVKDYECLC
RPOC_DICNV      -----------AEDFDKIHIGLASPDVIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_PSYIN      -----LKQQNKTKEFDGIKIGLASPEMVRSWSFGEVKKPETINYRTFKPEREGLFCARIFGPIKDYECLC
RPOC_SHEPA      -----LKQQSKTEEFEGIKIGLASPDLIRSWSFGEVKKPETINYRTFKPEREGLFCARIFGPVKDYECLC
RPOC_SHESH      -----LKQQSKTEEFNGIKIGLASPDLIRSWSFGEVKKPETINYRTFKPEREGLFCARIFGPVKDYECLC
RPOC_MANSM      -------QSKTSEDFDVIKIGLASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_HAES2      -------QSKTSEDFDVIKIGLASPDMIRSWSYGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_BORPD      ----LFKQVSQDEQFDAIKIGIASPEKIRSWSYGEVRKPETINYRTFKPERDGLFCSKIFGPIKDYECLC
RPOC_HAES1      -------QSKTSEDFDVIKIGLASPDMIRSWSYGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_XYLFT      ----LFNQQRQTLDFDAIKIGLASPALIRSWSFGEVKKPETINYRTFKPERDGLFCAAIFGPIKDYECLC
RPOC_XYLF2      ----LFNQQRQTLDFDAIKIGLASPALIRSWSFGEVKKPETINYRTFKPERDGLFCAAIFGPIKDYECLC
RPOC_BURM1      ----LFKQVQQEEVFDAIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_ENTS8      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_SHEVI      -----LKQQSKTEEFNGIKIGLASPDLIRSWSFGEVKKPETINYRTFKPEREGLFCARIFGPVKDYECLC
RPOC_XYLFM      ----LFNQQRQTLDFDAIKIGLASPALIRSWSFGEVKKPETINYRTFKPERDGLFCAAIFGPIKDYECLC
RPOC_XYLFA      ----LFNQQRQTLDFDAIKIGLASPALIRSWSFGEVKKPETINYRTFKPERDGLFCAAIFGPIKDYECLC
RPOC_IDILO      ----LLKPTNQAEEFDGIRIALSSPDMIRSWSYGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_HAEIE      -------QSKTSEDFDVIKIGLASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_HERAR      ----LFKQVQQNEQFDAIKIGLASPEKIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_HAEI8      -------QSKTSEDFDVIKIGLASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_HAEIN      -------QSKTSEDFDVIKIGLASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_HAEIG      -------QSKTSEDFDVIKIGLASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_BORA1      ----LFKQVSQDEQFDAIKIGLASPEKIRSWSYGEVRKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_NEIMF      ------------EEFDAIKIGIASPETIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_CHRSD      ----VLKSQAQSEEFDAIKITLASPDMIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_BURVG      ----LFKQVQQEEVFDAIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_BORPE      ----LFKQVSQDEQFDAIKIGIASPEKIRSWSFGEVRKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_BORPA      ----LFKQVSQDEQFDAIKIGIASPEKIRSWSFGEVRKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_BORBR      ----LFKQVSQDEQFDAIKIGIASPEKIRSWSFGEVRKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_RALSO      ----LFRQVQQEEQFDAIKIGLASPEKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_BURTA      --------------FDAIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_BURCM      ----LFKQVQQEEVFDAIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_BURA4      ----LFKQVQQEEVFDAIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_BURPS      --------------FDAIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_BURP6      --------------FDAIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_BURP1      --------------FDAIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_BURP0      --------------FDAIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_YERPY      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_YERPS      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_YERPP      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_YERPN      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_YERPG      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_YERPE      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_YERPB      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_YERPA      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_YERP3      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_DECAR      ------------EEFDAITIGLASPDKIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_BURMS      --------------FDAIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_BURMA      --------------FDAIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_BURM9      --------------FDAIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_TOLAT      -----------TEEFDGIKIGLASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_BURCH      ----LFKQVQQEEVFDAIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_BURCC      ----LFKQVQQEEVFDAIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_BURCA      ----LFKQVQQEEVFDAIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_YERE8      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_NEIMA      ------------EEFDAIKIGIASPETIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_BURCJ      ----LFKQVQQEEVFDAIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_BAUCH      ----LLKAQAKTEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_PSYWF      ------------REFDSIQITLAAPETIKSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPVKDFECLC
RPOC_BURXL      --------------FDAIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_BURS3      ----LFKQVQQEEVFDAIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_BURPP      --------------FDAIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_NEIMB      ------------EEFDAIKIGIASPETIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_NEIG1      ------------EEFDAIKIGIASPETIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_BURM7      --------------FDAIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_NEIM0      ------------EEFDAIKIGIASPETIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_BURP8      ----LFKQVQQEEVFDAIKIGLASPDKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_CITK8      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_PSEA6      -----LKQQHKSEEFDNIRIGLASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_NEIG2      ------------EEFDAIKIGIASPETIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_BUCAP      -----------NEDFDAIKISLASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_SODGM      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERYGLFCARIFGPVKDYECLC
RPOC_CUPTR      ----LFKQVQQEEQFDAIKIGLASPEKIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_POLNS      ----LFKQTQGDEQFDVIKIGLASPEKIRSWSFGEVRKPEAINYRTFKPERDGLFCAKIFGPTKDYECLC
RPOC_RALEH      ----LFKQVQQEEQFDAIKIGLASPEKIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_ERWT9      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_RALEJ      ----LFKQVQQEEQFDAIKIGLASPEKIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_WIGBR      -----LKTNNKIEEFDTIKISLASPEIVRSWSFGEIKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_AERS4      -----------TEEFDSIKIGLASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_AERHH      -----------TEEFDSIKIGLASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_LEPCP      --------------FDAIKIGLASPEKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_SERP5      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_METPP      --------------FDAIKIGLASPEKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_RALME      ----LFKQVQQEEQFDAIKIGLASPEKIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_PSEHT      -----LKQQNKTEEFDAIRIGLASPDMVRSWSYGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_ENT38      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_DELAS      --------------FDAIKIGLASPEKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_SALPA      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_PSEPU      ------------EEFDAIRIGLASPEMIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_POLSQ      ----LFKQTQGDEQFDVIKIGLASPEKIRSWSFGEVRKPETINYRTFKPERDGLFCAKIFGPTKDYECLC
RPOC_PSYCK      -------------EFDSIQITLASPDVIKSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPVKDFECLC
RPOC_PSYA2      -------------EFDSIQITLASPDVIKSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPVKDFECLC
RPOC_SALPB      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_SALTY      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_SALTI      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_SALCH      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_SALAR      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_ACIAC      --------------FDAIRIGMASPEKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_ALTMD      -----LKQQNKTEEFDNIRIGLSSPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_VEREI      --------------FDAIRIGMASPEKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_JANMA      ----LFKQVQQNEQFDAIKIGLASPEKIRSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_SHISS      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_SHIFL      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_SHIDS      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_SHIBS      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_ECOLI      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_ECOLC      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_ECOHS      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_ECODH      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_ECO57      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_ECO24      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_SHIB3      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_POLSJ      --------------FDAIKIGMASPEKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_ERWCT      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_ECOSM      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_SHIF8      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_ECOUT      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_ECOK1      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_KLEP7      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_ECOL6      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_RHOFD      --------------FNAIKIGMASPEKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_ECOL5      -----------TEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_BUCAI      -----LKSQTKNEDFDAIKISLASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_VARPS      --------------FDAIKIGMASPEKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_DIAST      --------------FDAIKIGMASPEKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_ACISJ      --------------FDAIKIGMASPEKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_VESOH      --------------FDAIRVGLASPEKIRSWSYGEVKKPETINYRTFKPEREGLFCAKVFGPMKDFECLC
RPOC_BUCBP      ----IFKSQIKTDEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_GEOUR      --------------FSAIRISVSSPEKIRERSFGEVKKPETINYRTFKPERDGLFCAKIFGPTKDYECNC
RPOC_GEOMG      --------------FSAIRISVSSPEKIRERSFGEVKKPETINYRTFKPERDGLFCAKIFGPTKDYECNC
RPOC_GEOSF      --------------FSAIRISVSSPEKIRERSFGEVKKPETINYRTFKPERDGLFCAKIFGPTKDYECNC
RPOC_RUTMC      --------------FDAIRVGLASPEKIRSWSYGEVKKPETINYRTFRPEREGLFCAKIFGPMKDFECLC
RPOC_POLNA      --------------FDAIKIGMASPEKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_GEOSM      ------------------------PDKIRERSFGEVKKPETINYRTFKPERDGLFCAKIFGPTKDYECNC
RPOC_BDEBA      --------------FDAVRVSLASPEMIREWSFGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
RPOC_GEOBB      ------------------------PDKIRERSFGEVKKPETINYRTFKPERDGLFCAKIFGPTKDYECNC
RPOC_GEOLS      --------------FSAIRISISSPEKIRERSFGEVKKPETINYRTFKPERDGLFCAKIFGPTKDYECNC
RPOC_MAGSM      ------------QSFDGIRISIASPEKIRSWSFGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_PELPD      --------------FSAIRISVSSPEKIRERSHGEVKKPETINYRTFKPERDGLFCAKIFGPTKDYECNC
RPOC_MARMM      --------------FDRIRIALASPEKIHSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_ANASK      --------------FSAIRISLASPDKIRQWSHGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECNC
RPOC_ANADE      --------------FSAIRISLASPDKIRQWSHGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECNC
RPOC_PELCD      --------------FNAIRLSLVSPEKIRERSFGEVKKPETINYRTFKPERDGLFCAKIFGPTKDYECNC
RPOC_MYXXD      --------------FNAIRIALASPDKIRQWSHGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECNC
RPOC_ANADF      --------------FSAIRISLASPDKIRQWSHGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECNC
RPOC_BUCCC      ------------EEFDSIKISLASPEVIRSWSFGEVKKPETINYRTLNPERDGLFCARIFGPIKDYECLC
RPOC_SILPO      ------------KVFDEIKVSLASPERILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_SILST      MNQEITNNPFNPKVFDEIKVSLASPERILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_SYNAS      -------------RFNAIKISIASPDKILSWSYGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECLC
RPOC_SORC5      --------------FSAIRISLASPEKIREWSHGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECNC
RPOC_ROSDO      MNQELTNNPFNPKTFDEIKVSLASPERILSWSFGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_RHILO      --------------FDSIRISLASPEKILSWSFGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_DINSH      ------------KTFDEIKVSLASPERILSWSFGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_MESSB      -----------AQTFDSIRISLASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_METPB      ----LFNQQAQPQSFDQIKISISSPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_SPHAL      --------------FDMIKIGIASPERIRSWSFGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_CAUSK      --------------FDQIRISLASPEKIRSWSFGEIKKPETINYRTFKPERDGLFCARIFGPTKDYECLC
RPOC_BRAJA      --------------FDQIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_CAUCR      --------------FDQIRISLASPEKIRSWSFGEIKKPETINYRTFKPERDGLFCARIFGPTKDYECLC
RPOC_PARDP      ------------RQFDEIKISLASPEEILAWSYGEVKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_BEII9      --------------FDQIQISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_THEYD      ----------NPRDFDAIRIKLASPEKIREWSYGEVKKPETINYRTFKPEPEGLFCAKIFGPIKDWECLC
RPOC_RHORT      ----IFGQVSGTQAFDQIKISIASPEKIRSWSFGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_METEP      ----LFNQQAQPQSFDQIKISISSPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_METC4      ----LFNQQAQPQSFDQIKISISSPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_RHOPS      --------------FDQIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_PARL1      -----------TQTFDQIKISIASPERILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_RHOPA      --------------FDQIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_OLICO      --------------FDQIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_RHOPT      --------------FDQIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_RHOCS      ----IFGQPQGPQSFDQIRISIASPERIRSWSFGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_JANSC      ------------KAFDEIKVSLASPERILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_RHOP2      --------------FDQIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_METRJ      ----LFNQQAQPVSFDQIKISISSPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_RHOS5      ------------KTFDEIKISLASPERILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_GLUDA      ----ILGQTGQAMTFDQIKIQLASSEQIRSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_RHOPB      --------------FDQIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_NITWN      --------------FDQIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_RHOS4      ------------KTFDEIKISLASPERILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_RHOS1      ------------KTFDEIKISLASPERILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_GRABC      ----ILGQGGQSLSFDQIKIQMASPEQIRSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_AZOC5      --------------FDQIKISIASPEKISSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_BRUO2      -----------AQTFDSIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_BRUME      -----------AQTFDSIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_BRUMB      -----------AQTFDSIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_BRUC2      -----------AQTFDSIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_DESPS      -------------KFNKVKISLASPEQIIDWSHGEVKKPETINYRTFKPERDGLFCAKVFGPVKDFECNC
RPOC_BRUSU      -----------AQTFDSIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_BRUSI      -----------AQTFDSIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_NITHX      --------------FDQIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_METS4      ----LFNQQAQPQSFDQIKISISSPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_BRUAB      -----------AQTFDSIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_BRUA2      -----------AQTFDSIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_BRUA1      -----------AQTFDSIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_BARHE      -----------AQTFDSIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_NOVAD      --------------FDQIQIGLASPERIRSWSFGEIKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_RHIEC      -----------AQNFDSIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_METNO      ----LFNQQAQPQSFDQIKISISSPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_AGRT5      -----------AQHFDSIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_RHIME      -----------AQTFDSIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_DESDG      ----------NIRNLKAMQISIASPESIREWSYGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECNC
RPOC_ACICJ      ----ILGQTGQAATFDQIRIQIASPEQIRSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_RHIE6      -----------AQNFDSIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_BART1      -----------AQTFDSIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_SINMW      -----------AQTFDSIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_DESVV      ----------NIRNLKAIQITIASPENIREWSYGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECNC
RPOC_DESVH      ----------NIRNLKAIQITIASPENIREWSYGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECNC
RPOC_OCHA4      -----------AQTFDSIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_BRASB      --------------FDQIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_SPHWW      --------------FDQIQIGIASPERIRSWSFGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_BRASO      --------------FDQIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_RHIL3      -----------AQNFDSIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_BARBK      --------------FDSIRISIASPENILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_SYNFM      --------------FNAVKIMISSPERIREWSYGEVKKPETINYRTFKPERDGLFCARIFGPIKDYECNC
RPOC_HYPNA      ----MFNQNAPAPSFEAIRISIASPEKIRSWSSGEIKKPETINYRTFKPERDGLFCARIFGPTKDYECLC
RPOC_LAWIP      -----------------IQISIASPENIREWSYGEVKKPETINYRTFKPERDGLFCAKIFGPVKDYECNC
RPOC_BARQU      -----------AQTFDSIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_RHOP5      --------------FDQIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_GLUOX      ----ILGQTGQSVTFDQIKIQLASSEQVRSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_ERYLH      --------------FDQIQIGIASPERIRSWSFGEIKKPETINYRTFKPERDGLFCARIFGPVKDYECLC
RPOC_ZYMMO      ----------STEHFDHIQISLASPERIRSWSFGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_XANP2      --------------FNQIRITIASPDKIKSWSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECLC
RPOC_SOLUE      --------------FDSIRISLASPEKIRSWSHGEVTKPETINYRTFKPERDGLFCARIFGPTQDWECLC
RPOC_PELUB      -------QNFNS-----IKITLASPEKIKSWTYGEIKKPETINYRTFRPEKDGLFCARIFGPIKDYECLC
RPOC_RICTY      ----------NTQQFDQIRINIASPDQVRSWSFGEVTKPETINYRTFKPEKDGLFCARIFGPVKDYECLC
RPOC_RICPR      ----------NTQQFDQIRINIASPDQVRSWSFGEVTKPETINYRTFKPEKDGLFCARIFGPVKDYECLC
RPOC_RICBR      ----------NTQQFDQIRINIASPEQVRSWSFGEVIKPETINYRTFKPEKDGLFCARIFGPVKDYECLC
RPOC_RICB8      ----------NTQQFDQIRINIASPEQVRSWSFGEVIKPETINYRTFKPEKDGLFCARIFGPVKDYECLC
RPOC_RICRS      ----------NTQQFDQIRINIASPDQVRSWSFGEVTKPETINYRTFKPEKDGLFCARIFGPVKDYECLC
RPOC_RICRO      ----------NTQQFDQIRINIASPDQVRSWSFGEVTKPETINYRTFKPEKDGLFCARIFGPVKDYECLC
RPOC_ACIBL      ----------NITDFDAIRISLASPEKIRSWSHGEVTKPETINYRTFKPERDGLFCARIFGPVTDWECLC
RPOC_RICAH      ----------NTQQFDQIRINIASPDQVRSWSFGEVTKPETINYRTFKPEKDGLFCARIFGPVKDYECLC
RPOC_RICCN      ----------NTQQFDQIRINIASPDQVRSWSFGEVTKPETINYRTFKPEKDGLFCARIFGPVKDYECLC
RPOC_RICFE      ----------NTQQFDQIRINIASPDQVRSWSFGEVTKPETINYRTFKPEKDGLFCARIFGPVKDYECLC
RPOC_RICCK      ----------NTQQFDQIRINIASPDQVRSWSFGEVTKPETINYRTFKPEKDGLFCARIFGPVKDYECLC
RPOC_RICM5      ----------NTQQFDQIRINIASPDQVRSWSFGEVTKPETINYRTFKPEKDGLFCARIFGPVKDYECLC
RPOC_NEOSM      ----------SSVDFDGIKISLASADKIRSLSYGEVTKPETINYRTFKPEKNGLFCAKIFGPTKSYECLC
RPOC_EHRCJ      -----------AQSFDKICISIASPESIRAMSYGEIKDISTTNYRTFKVEKGGLFCPKIFGPVNDDECLC
RPOC_ANAMM      -----------AQSFDKICISIASPESIRAMSYGEIKDISTTNYRTFKVEKGGLFCPKIFGPVNDDECLC
RPOC_ANAMF      -----------AQSFDKICISIASPESIRAMSYGEIKDISTTNYRTFKVEKGGLFCPKIFGPVNDDECLC
RPOC_EHRCR      -----------AQSFDKICISIASPESIRAMSYGEIKDISTTNYRTFKVEKGGLFCPKIFGPVNDDECLC
RPOC_EHRRG      -----------AQSFDKICISIASPESIRAMSYGEIKDISTTNYRTFKVEKGGLFCPKIFGPVNDDECLC
RPOC_EHRRW      -----------AQSFDKICISIASPESIRAMSYGEIKDISTTNYRTFKVEKGGLFCPKIFGPVNDDECLC
RPOC_ANAPZ      -----------AQSFDKICISIASPESIRAMSYGEIKDISTTNYRTFKVEKGGLFCPKIFGPVNDDECLC
RPOC_ELUMP      --------------FDAIKLGIASPEQIMAWSHGEVKKPETINYRTLKPERDGLFCERIFGPTKDYECSC
RPOBC_WOLTR     ----ISHTNI-AQSFDKIGISIASPENIKSMSYGEVKDVSTANYRTFKVEKGGLFCPKIFGPVNDDECLC
RPOC_ORITI      ----------SSQAFNRVRINIASPEQIRSWSYGEVTKPETINYRTFKPEKDGLFCAKIFGPVKDYECLC
RPOC_ORITB      ----------SSQAFNQVRINIASPEQIRSWSYGEVTKPETINYRTFKPEKDGLFCAKIFGPVKDYECLC
RPOBC_WOLPM     ----ISHTNI-AQPFNEVSISIASPESIKRISCGEIEDVLTANYRTFKVEKGGLFCPKVFGPVNDDECLC
RPOC_AKKM8      ------------RTFDQVAITVADPDTIRSWSFGEVVNPETINYRTFKPEKGGLFCERIFGPTRDMECAC
RPOC_OPITP      --------------FDCVSITVASPETIRKWSKGEVKNPETINYRTFKPEPGGLFCQKIFGPVRDYECAC
RPOC_METI4      --------------FDEVRISIASPETIESWSKGEVRNPETINYRTFKPEKGGLFCERIFGPTKDWECAC
RPOC_PARUW      -------RNQQDGQFDKLTIKIASDDVIRNWSRGEIKKPETINYRTFKPEKGGLFCEKIFGPTRDWECAC
RPOC_LEPBP      -------RNYNS--FESITIRLASPERIKEWSFGEVKKPETINYRTLKPERDGLFCEKIFGTTKDWECYC
RPOC_LEPBA      -------RNYNS--FESITIRLASPERIKEWSFGEVKKPETINYRTLKPERDGLFCEKIFGTTKDWECYC
RPOC_FUSNN      ------------RNFEKIRIKLASPEKILEWSHGEVTKPETINYRTLNPERDGLFCEIIFGPTKDWECSC
RPOC_RHOBA      -----------------VRISLARPQDIKAWSFGEVKKPETINYRTYRPEKDGLFCERIFGPEKDWECAC
RPOC_CHLFF      --------------FDKLEIGIASDITIRDWSCGEIKKPETINYRTFKPEKGGLFCEKIFGPTKDWECCC
RPOC_CHLPN      --------------FDKLEIGIASDITIRDWSCGEIKKPETINYRTFKPEKGGLFCEKIFGPTKDWECCC
RPOC_CHLCV      --------------FDKLEIGIASDITIRDWSCGEIKKPETINYRTFKPEKGGLFCEKIFGPTKDWECCC
RPOC_CHLAB      --------------FDKLEIGIASDITIRDWSCGEIKKPETINYRTFKPEKGGLFCEKIFGPTKDWECCC
RPOC_BORBZ      ------------KDFERIKIKIASPDQIRNWSYGEVKKSETINYRTLRPEKDGLFCERIFGTTKEWECYC
RPOC_BORBU      ------------KDFERIKIKIASPDQIRNWSYGEVKKSETINYRTLRPEKDGLFCERIFGTTKEWECYC
RPOC_PORGI      -------ENKIKNNFSKIRITLASPEEILENSFGEVLKPETINYRTYKPERDGLFCERIFGPVKDFECHC
RPOC_PORG3      -------ENKIKNNFSKIRITLASPEEILENSFGEVLKPETINYRTYKPERDGLFCERIFGPVKDFECHC
RPOC_BACFR      -------ENKIKSNFSKISIGLASPEEILENSSGEVLKPETINYRTYKPERDGLFCERIFGPIKDYECHC
RPOC_BACFN      -------ENKIKSNFSKISIGLASPEEILENSSGEVLKPETINYRTYKPERDGLFCERIFGPIKDYECHC
RPOC_BORHD      ------------KDFEKIRIKIASRDQIRSWSYGEVKKSETINYRTLRPEKDGLFCERIFGTTKEWECYC
RPOC_BORGA      ----------------------ASPDQIRNWSYGEVKKSETINYRTLRPEKDGLFCERIFGTTKEWECYC
RPOC_CYTH3      --------------FTKVTISLASPESILEGSHGEVTQPETINYRTYKPEMGGLFCERIFGPVKDWECHC
RPOC_BORAP      ----------------------ASPDQIRNWSYGEVKKSETINYRTLRPEKDGLFCERIFGTTKEWECYC
RPOC_BORDL      ------------KDFEKIRIKIASPDQIRSWSYGEVKKSETINYRTLRPEKDGLFCERIFGTTKEWECYC
RPOC_BORT9      ------------KDFEKIRIKIASPDQIRSWSYGEVKKSETINYRTLRPEKDGLFCERIFGTTKEWECYC
RPOC_BORRA      ------------KDFEKIRIKIASPDQIRSWSYGEVKKSETINYRTLRPEKDGLFCERIFGTTKEWECYC
RPOC_CHLTR      --------------FDKLEIGIASDVTIRDWSCGEIKKPETINYRTFKPEKGGLFCEKIFGPTKDWECYC
RPOC_CHLTB      --------------FDKLEIGIASDVTIRDWSCGEIKKPETINYRTFKPEKGGLFCEKIFGPTKDWECYC
RPOC_CHLTA      --------------FDKLEIGIASDVTIRDWSCGEIKKPETINYRTFKPEKGGLFCEKIFGPTKDWECYC
RPOC_CHLT2      --------------FDKLEIGIASDVTIRDWSCGEIKKPETINYRTFKPEKGGLFCEKIFGPTKDWECYC
RPOC_LEPIN      --------------FESITIRLASPERIKEWSYGEVKKPETINYRTLKPEKDGLFCEKIFGTTKDWECYC
RPOC_LEPIC      --------------FESITIRLASPERIKEWSYGEVKKPETINYRTLKPEKDGLFCEKIFGTTKDWECYC
RPOC_CHLMU      --------------FDKLEIGIASDVTIRDWSCGEIKKPETINYRTFKPEKGGLFCEKIFGPTKDWECYC
RPOC_LEPBJ      --------------FESITIRLASPERIKEWSYGEVKKPETINYRTLKPEKDGLFCEKIFGTTKDWECYC
RPOC_PARD8      -------ENKIKSNFSKITIGLASPEEILENSSGEVLKPETINYRTYKPERDGLFCERIFGPIKDYECHC
RPOC_LEPBL      --------------FESITIRLASPERIKEWSYGEVKKPETINYRTLKPEKDGLFCEKIFGTTKDWECYC
RPOC_GRAFK      ------------QRFNQISIGLASPESILAESRGEVLKPETINYRTHKPERDGLFCERIFGPVKDYECAC
RPOC_FLAPJ      ------------KRFNKISIGLASPESILAESRGEVLKPETINYRTHKPERDGLFCERIFGPVKDFECAC
RPOC_BACTN      -------ENKTKSNFSKISIGLASPEEILENSSGEVLKPETINYRTYKPERDGLFCERIFGPIKDYECHC
RPOC_BACV8      --------------FSKISIGLASPEEILENSSGEVLKPETINYRTYKPERDGLFCERIFGPVKDYECHC
RPOC_TREPS      ------------RDFDSLQIKLASPDTIRAWSYGEVKKPETINYRTLRPEREGLFCERIFGTTKEWECFC
RPOC_TREPA      ------------RDFDSLQIKLASPDTIRAWSYGEVKKPETINYRTLRPEREGLFCERIFGTTKEWECFC
RPOC_FLAJ1      ------------KRFNKISIGLASPESILKESRGEVLKPETINYRTHKPERDGLFCERIFGPVKDFECAC
RPOC_AMOA5      --------------FSEIIISLASPESILERSRGEVTQPETINYRTYKPEMKGLFCERIFGPVKDWECHC
RPOC_TREDE      --------------FDSLMIRLASPDTIRAWSYGEVKKPETINYRTLRPERDGLFCERIFGTTKEWECFC
RPOC_CHLT3      ------------RDFTRIKISVASPESILARSRGEVLKPETINYRTYKPERDGLMCEKIFGPTK