[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30317.1

[Show Plain Result]


## Summary of Sequence Search
    1::484
    8::483     1e-90  39%  483 aa  TRKH_SHIFL RecName: Full=Trk system potassium uptake protein trkH;
    8::483     1e-90  39%  483 aa  TRKH_ECOLI RecName: Full=Trk system potassium uptake protein trkH;
    8::483     1e-90  39%  483 aa  TRKH_ECO57 RecName: Full=Trk system potassium uptake protein trkH;
    8::483     5e-89  38%  483 aa  TRKH_SALTY RecName: Full=Trk system potassium uptake protein trkH;
   14::487     7e-72  36%  487 aa  TRKH_HAEIN RecName: Full=Trk system potassium uptake protein trkH;
   14::484     3e-56  29%  485 aa  TRKG_ECOLI RecName: Full=Trk system potassium uptake protein trkG;
   30::461     1e-20  28%  474 aa  Y1485_METJA RecName: Full=Uncharacterized cation transporter
   76::217     2e-04  34%  244 aa  NS3B_CVPRM RecName: Full=Non-structural protein 3b;       
   76::217     2e-04  34%  244 aa  NS3B_CVPPU RecName: Full=Putative non-structural protein 3b;       
   76::217     2e-04  34%  244 aa  NS3B_CVPFS RecName: Full=Non-structural protein 3b;       
    1::484

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxKIIGIFLMFLSLTMLSPLLVDYIYDEDNAYPFVLSFTVTFLCGFLLWFISRKSNKKLSNRDGF
TRKH_SHIFL      -------RIVGLLVILFSGTMIIPGLVALIYRDGAGRAFTQTFFVALAIGSMLWWPNRKEKGELKSREGF
TRKH_ECOLI      -------RIVGLLVILFSGTMIIPGLVALIYRDGAGRAFTQTFFVALAIGSMLWWPNRKEKGELKSREGF
TRKH_ECO57      -------RIVGLLVILFSGTMIIPGLVALIYRDGAGRAFTQTFFVALAIGSMLWWPNRKEKGELKSREGF
TRKH_SALTY      -------RIVGLLVILFSGTMILPGLVALIYRDGAGRAFTQTFFVALAIGSILWWPNRREKGELKSREGF
TRKH_HAEIN      -------------VMCFSGTMLVPAFVALIYGDGGGKAFMQAFMLSLIAGTLLWWPCHHHKQELRSRDGF
TRKG_ECOLI      ----------GFLVWLYSLSMLPPMVVALFYKEKSLXXXXXXXXXXXCIGGGAWYTTKKSGIQLRTRDGF
Y1485_METJA     ---------------------LVPCIVSVYYNENTFLNFLIPGLFFSIFGFVLKRATKPKNLKLHHT--M
NS3B_CVPRM      ---------VGILMFILSMTLLGPMLIAYGYYIDGVTTTVLSLRFAYLAYF--WYVNSRFEFILYNTTTL
NS3B_CVPPU      ---------VGILMFILSMTLLGPMLIAYGYYIDGVTTTVLSLRFVYLAYF--WYVNSRFEFILYNTTTL
NS3B_CVPFS      ---------VGILMFILSMTLLGPMLIAYGYYIDGVTTTVLSLRFAYLAYF--WYVNSRFEFILYNTTTL


                         .         .         *         .         .         .         .:140
query           LIVTLVWIFVTVFGAIPYMSFPGLNLSFTNAVFESVSXXXXXXXXVIEGLDKLPHSILFYRQQTEFFGGM
TRKH_SHIFL      LIVVLFWTVLGSVGALPFIFSESPNLTITDAFFESFSXXXXXXXXXXXXXDSLPHAILFYRQMLQWFGGM
TRKH_ECOLI      LIVVLFWTVLGSVGALPFIFSESPNLTITDAFFESFSXXXXXXXXXXXXXDSLPHAILFYRQMLQWFGGM
TRKH_ECO57      LIVVLFWTVLGSVGALPFIFSESPNLTITDAFFESFSXXXXXXXXXXXXXDSLPHAILFYRQMLQWFGGM
TRKH_SALTY      LIVVLFWTVLGSVGALPFIFSESPNLTITDAFFESFSXXXXXXXXXXXXXDSLPHAILFYRQMLQWFGGM
TRKH_HAEIN      LIVVAFWLVLGSLATLPLLLFDSPHLTIASAVFEAFSGLTTTGATVMTGLDNLPKSILFYRQFLQWLGGM
TRKG_ECOLI      IIIVMFWILFSVISAFPLWIDSELNLTFIDALFEGVSGITTTGATVIDDVSSLPRAYLYYRSQLNFXXXX
Y1485_METJA     VASALAWLIASFIGAIPYLSID--YFSYVDAVYESMSAWTTTGMTLIPNVEVLPKSILFWRSFQQWIGGV
NS3B_CVPRM      MFVSHSSIYVTLYGGINYMFVNDLTLHFVDPMLVSIA---------IRG---LAHADLTVVRAVELLNGD
NS3B_CVPPU      MFVSHSSIYVTLYGGINYMFVNDLTLHFVDPMLVSIA---------IRG---LAHADLTVVRAVELLNGD
NS3B_CVPFS      MFVSHSSIYVTLYGGINYMFVNDLTLHFVDPMLVSIA---------IRG---LAHADLTVVRAVELLNGD


                         +         .         .         .         .         *         .:210
query           GIIVLSVAILPLLGVGGMQLYKAEVSGQWKDDKIAPKISSTAKALWMVYLLLTFLCFISYLLVGVEPFDA
TRKH_SHIFL      XXXXXXXXXXXXXXXGGMQLYRAEMPGPLKDNKMRPRIAETAKTLWLIYVLLTVACALALWFAGMDAFDA
TRKH_ECOLI      XXXXXXXXXXXXXXXGGMQLYRAEMPGPLKDNKMRPRIAETAKTLWLIYVLLTVACALALWFAGMDAFDA
TRKH_ECO57      XXXXXXXXXXXXXXXGGMQLYRAEMPGPLKDNKMRPRIAETAKTLWLIYVLLTVACALALWFAGMDAFDA
TRKH_SALTY      XXXXXXXXXXXXXXXGGMQLYRAEMPGPLKDNKMRPRIAETAKTLWLIYVLLTVACALALWFAGMPAFDA
TRKH_HAEIN      XXXXXXXXXXXXXXXXXTQLYRAESSGPLKDQKSLPKISEVAKALWIIYASLTVLCAIAYWLSGMNLFDA
TRKG_ECOLI      XXXXXXXXXXXXXXXXXXKLYQSEMPGPFKDDKLTPRLADTSRTLWITYSLLGIACIVCYRLAGMPLFDA
Y1485_METJA     GILVLSALVLARSGTVAYLLYTSEA----RQERIMPSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXFWDA
NS3B_CVPRM      FIYVFSQE--PVVGV-------------------------------------------------------
NS3B_CVPPU      FIYVFSQE--PVVGV-------------------------------------------------------
NS3B_CVPFS      FIYVFSQE--PVVGV-------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ICYTFSTVSTGGFAPSDASMTDKPLGMLIVCAIFLFLGATSFKAHYIALSKFKISHYFRNIEFKAYFYFL
TRKH_SHIFL      IGHSFATIAIGGFSTHDASIGDSPTINTII-AIFLLISGCNYGLHFSLLSGRSLKVYWRDPEFRM-FIGV
TRKH_ECOLI      IGHSFATIAIGGFSTHDASIGDSPTINTII-AIFLLISGCNYGLHFSLLSGRSLKVYWRDPEFRM-FIGV
TRKH_ECO57      IGHSFATIAIGGFSTHDASIGDSPTINTII-AIFLLISGCNYGLHFSLLSGRSLKVYWRDPEFRM-FIGV
TRKH_SALTY      IGHSFSTIAIGGFSTHDASVGDSPTINTII-AIFLLISGCNYGLHFSLLSGRSLKVYWRDPEFRM-FIGV
TRKH_HAEIN      IGHSFSTISNGGFSTHDASIYFNQASIYWVTTIFMLIGGVNFSLHFLALGKRNIRNYWKDPEFR--FFLT
TRKG_ECOLI      ICHGISTVSLGGFSTHSESIGYFNNYLVLVAGSFSLLSAFNFTLWYIVISRKTIKPLIRDIELR--FFLL
Y1485_METJA     LNLTMTGISTGGMSISNYSFPYNDFAKXXXXXXXXXXXXXSFSIHH----KLLTGKYFNDIQ--------
NS3B_CVPRM      ----------------------------------------------------------------------
NS3B_CVPPU      ----------------------------------------------------------------------
NS3B_CVPFS      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           FFTSFIVCITIITHTNDLSNIFSIVTNSIFQVISISSSAGFVSDNNYYLWPSFLPIMLMFXXXXXXXXXX
TRKH_SHIFL      QFTLVVICTLVLWFHNVYSSALMTINQAFFQVVSMATTAGFTTDS-IARWPLFLPVLLLCSAFIGGCAGS
TRKH_ECOLI      QFTLVVICTLVLWFHNVYSSALMTINQAFFQVVSMATTAGFTTDS-IARWPLFLPVLLLCSAFIGGCAGS
TRKH_ECO57      QFTLVVICTLVLWFHNVYSSALMTINQAFFQVVSMATTAGFTTDS-IARWPLFLPVLLLCSAFIGGCAGS
TRKH_SALTY      QLTLVVICTLVLWFHNIYDSALTTLNQAFFQVVSMATTAGFTTDS-IARWPLFLPVLLLCSAFIGGCAGS
TRKH_HAEIN      MQIIFIGIVSLSLYGYGLSDINEAVTKGALQLTSMSMTAGYTIFDIDNL-PPFIGLLLVISAVIXXXXXX
TRKG_ECOLI      IALGVIIVTSFQVWHIGMYDLHGSFIHSFFLASSMLTDNG-LATQDYASWPTHTIVFLLLSSFFGGCIGS
Y1485_METJA     --TKYALIVTAFXXXXXXXXXXXXXXXXLFTVVSAMTSTGFTT-INVGNXXXXXXXXXXXXXXXXXXXXX
NS3B_CVPRM      ----------------------------------------------------------------------
NS3B_CVPPU      ----------------------------------------------------------------------
NS3B_CVPFS      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           XXXXLKMIRAILFKEKAILEARRVIHPQGVFTVKLGDIHISEQALNRVSGFISVYIIIFXXXXXXXXXXX
TRKH_SHIFL      TGGGLKVIRILLLFKQGNRELKRLVHPNAVYSIKLGNRALPERILEAVWGFFSAYALVFIVSMLAIIATG
TRKH_ECOLI      TGGGLKVIRILLLFKQGNRELKRLVHPNAVYSIKLGNRALPERILEAVWGFFSAYALVFIVSMLAIIATG
TRKH_ECO57      TGGGLKVIRILLLFKQGNRELKRLVHPNAVYSIKLGNRALPERILEAVWGFFSAYALVFIVSMLAIIATG
TRKH_SALTY      TGGGLKVIRILLLFKQGNRELKRLVHPNAVYSIKLGNRALPERILEAVWGFFSAYALVFIVSMLAIIATG
TRKH_HAEIN      XXXXLKAIRTLILWKQIDRELHSLIHPNLVQPIRIGKNRLAPRMIESIWAFFIIFILVYWGCVFAVILCG
TRKG_ECOLI      TCGGIKSLRFLILFKQSKHEINQLSHPRALLSVNVGGKIVTDRVMRSVWSXXXXXXXXXXXXXXXXNGMG
Y1485_METJA     XXXXVKIIRFLVILKALLYEIKEIIYPKAVIHEHLDDMDLNYRIIREAFVVFFLYCLSFLTALIFIALGY
NS3B_CVPRM      ----------------------------------------------------------------------
NS3B_CVPPU      ----------------------------------------------------------------------
NS3B_CVPFS      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           XDIPTAFSTIATTLSNVGPGLGDIGSNFKNLPKEALWICNFAMIAGRLEIFTILVLFMPDFWRK
TRKH_SHIFL      VDDFSAFASVVATLNNLGPGLGVVADNFTSMNPVAKWILIANMLFGRLEVFTLLVLFTPTFWRE
TRKH_ECOLI      VDDFSAFASVVATLNNLGPGLGVVADNFTSMNPVAKWILIANMLFGRLEVFTLLVLFTPTFWRE
TRKH_ECO57      VDDFSAFASVVATLNNLGPGLGVVADNFTSMNPVAKWILIANMLFGRLEVFTLLVLFTPTFWRE
TRKH_SALTY      VDDFSAFASVVATLNNLGPGLGVVADNFASMNPVAKWILIANMLFGRLEVFTLLVLFTPTFWRE
TRKH_HAEIN      MNTFDAMGAVFATLTNAGPGLGFIHESFIGVPESAKLVFSFAMICGRLEMFSLIVLFIPSYWKK
TRKG_ECOLI      YDFLTSFATVAACINNMGLGFGATASSFGVLNDIAKCLMCIAMILGRLEIYPVIILFSGFFWR-
Y1485_METJA     NPYDSIFDAVSFT-SNIGISLGVVTLKTPVIGKIAGII---AMWIGRLEIIPVLVLF-------
NS3B_CVPRM      ----------------------------------------------------------------
NS3B_CVPPU      ----------------------------------------------------------------
NS3B_CVPFS      ----------------------------------------------------------------