[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30340.1

[Show Plain Result]


## Summary of Sequence Search
    1::274
   16::267     2e-46  40%  269 aa  YBBO_ECOLI RecName: Full=Uncharacterized oxidoreductase ybbO;      
   16::267     2e-46  40%  269 aa  YBBO_ECOL6 RecName: Full=Uncharacterized oxidoreductase ybbO;      
    9::271     5e-29  32%  284 aa  VDLC_HELPY RecName: Full=Probable short-chain type
    3::258     3e-28  33%  271 aa  VDLC_HELPJ RecName: Full=Probable short-chain type
    2::276     5e-25  30%  280 aa  YUSZ_BACSU RecName: Full=Uncharacterized oxidoreductase yusZ;      
    1::192     2e-22  34%  292 aa  YQ53_SCHPO RecName: Full=Uncharacterized oxidoreductase C162.03;   
    6::205     3e-21  31%  311 aa  RDH8_HUMAN RecName: Full=Retinol dehydrogenase 8;       
    5::218     4e-21  27%  296 aa  YAEB_SCHPO RecName: Full=Uncharacterized oxidoreductase C23D3.11;  
    7::189     1e-19  36%  259 aa  YQJQ_BACSU RecName: Full=Uncharacterized oxidoreductase yqjQ;      
   28::215     1e-18  34%  317 aa  H17B6_RAT RecName: Full=Hydroxysteroid 17-beta dehydrogenase 6;    
    7::207     2e-18  32%  257 aa  YXJF_BACSU RecName: Full=Uncharacterized oxidoreductase yxjF;      
   38::234     6e-18  32%  309 aa  DRS7B_DANRE RecName: Full=Dehydrogenase/reductase SDR family member
    1::277     2e-17  28%  312 aa  RDH8_BOVIN RecName: Full=Retinol dehydrogenase 8;       
   54::322     2e-17  28%  343 aa  BDH_MOUSE RecName: Full=D-beta-hydroxybutyrate dehydrogenase,
   10::277     2e-17  27%  297 aa  AYR1_YEAST RecName: Full=NADPH-dependent 1-acyldihydroxyacetone
   39::233     2e-17  31%  309 aa  DRS7B_XENTR RecName: Full=Dehydrogenase/reductase SDR family member
    2::195     6e-17  32%  258 aa  BDHA_RHIME RecName: Full=D-beta-hydroxybutyrate dehydrogenase;     
    6::193     6e-17  33%  253 aa  BACC2_BACSU RecName: Full=Bacilysin biosynthesis oxidoreductase
   55::247     8e-17  31%  323 aa  DRS7B_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
   39::233     1e-16  29%  323 aa  DRS7B_XENLA RecName: Full=Dehydrogenase/reductase SDR family member
   54::322     1e-16  26%  343 aa  BDH_RAT RecName: Full=D-beta-hydroxybutyrate dehydrogenase,
    2::195     2e-16  32%  344 aa  DHB1_RAT RecName: Full=Estradiol 17-beta-dehydrogenase 1;       
    3::186     3e-16  29%  231 aa  Y2778_STAA8 RecName: Full=Uncharacterized oxidoreductase
    3::186     3e-16  29%  231 aa  Y2488_STAAC RecName: Full=Uncharacterized oxidoreductase SACOL2488;
    3::186     3e-16  29%  231 aa  Y2422_STAA3 RecName: Full=Uncharacterized oxidoreductase
   30::207     3e-16  33%  319 aa  DHRS9_RAT RecName: Full=Dehydrogenase/reductase SDR family member
   47::251     3e-16  32%  317 aa  DHRS7_ANOGA RecName: Full=Dehydrogenase/reductase SDR family
    3::186     4e-16  29%  231 aa  Y2403_STAAW RecName: Full=Uncharacterized oxidoreductase MW2403;   
    3::186     4e-16  29%  231 aa  Y2370_STAAS RecName: Full=Uncharacterized oxidoreductase SAS2370;  
   53::263     4e-16  33%  339 aa  DHRS7_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   55::323     4e-16  28%  344 aa  BDH_BOVIN RecName: Full=D-beta-hydroxybutyrate dehydrogenase,
   30::215     5e-16  33%  317 aa  H17B6_MOUSE RecName: Full=Hydroxysteroid 17-beta dehydrogenase 6;  
    6::258     5e-16  29%  328 aa  DHB1_HUMAN RecName: Full=Estradiol 17-beta-dehydrogenase 1;        
   55::249     7e-16  32%  325 aa  DRS7B_PONAB RecName: Full=Dehydrogenase/reductase SDR family member
    6::258     7e-16  29%  328 aa  DHB1_PANTR RecName: Full=Estradiol 17-beta-dehydrogenase 1;        
   55::249     9e-16  33%  325 aa  DRS7B_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   24::305     9e-16  28%  313 aa  DR9C7_MOUSE RecName: Full=Short chain dehydrogenase/reductase
    3::186     2e-15  29%  231 aa  Y2478_STAAM RecName: Full=Uncharacterized oxidoreductase SAV2478;  
    3::186     2e-15  29%  231 aa  Y2266_STAAN RecName: Full=Uncharacterized oxidoreductase SA2266;   
  111::249     2e-15  32%  325 aa  DRS7B_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
   30::295     2e-15  31%  319 aa  DHRS9_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
    2::205     2e-15  28%  236 aa  YI78_SCHPO RecName: Full=Uncharacterized oxidoreductase
   30::207     3e-15  32%  319 aa  DHRS9_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   23::214     3e-15  31%  273 aa  TRN1_DATST RecName: Full=Tropinone reductase 1;       
   54::295     3e-15  30%  326 aa  DHRS7_DROME RecName: Full=Dehydrogenase/reductase SDR family
    6::198     3e-15  31%  344 aa  DHB1_MOUSE RecName: Full=Estradiol 17-beta-dehydrogenase 1;        
   11::202     4e-15  29%  260 aa  TRN2_HYONI RecName: Full=Tropinone reductase 2;       
  134::249     4e-15  34%  325 aa  DRS7B_RAT RecName: Full=Dehydrogenase/reductase SDR family member
   30::295     4e-15  29%  319 aa  DHRS9_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
    5::201     4e-15  31%  261 aa  ACT3_STRCO RecName: Full=Putative ketoacyl reductase;       
    7::193     6e-15  27%  230 aa  Y2049_STAEQ RecName: Full=Uncharacterized oxidoreductase SERP2049; 
    7::193     6e-15  27%  230 aa  Y2036_STAES RecName: Full=Uncharacterized oxidoreductase SE_2036;  
    7::195     6e-15  32%  246 aa  Y1627_STAS1 RecName: Full=Uncharacterized oxidoreductase SSP1627;  
   15::205     7e-15  35%  260 aa  DHR11_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
    7::184     2e-14  33%  248 aa  YKVO_BACSU RecName: Full=Uncharacterized oxidoreductase ykvO;      
    1::225     2e-14  31%  248 aa  Y452_LISIN RecName: Full=Uncharacterized oxidoreductase Lin0452;   
    2::187     2e-14  30%  244 aa  FABG_STAES RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    2::187     2e-14  30%  244 aa  FABG_STAEQ RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   55::338     2e-14  26%  343 aa  BDH_HUMAN RecName: Full=D-beta-hydroxybutyrate dehydrogenase,
    3::186     2e-14  28%  231 aa  Y2567_STAAR RecName: Full=Uncharacterized oxidoreductase SAR2567;  
   10::200     2e-14  36%  255 aa  DHR11_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
    6::156     2e-14  36%  254 aa  BACC_BACAM RecName: Full=Bacilysin biosynthesis oxidoreductase
   11::202     3e-14  28%  260 aa  TRN2_DATST RecName: Full=Tropinone reductase 2;       
    2::180     3e-14  31%  241 aa  PHBB_RHIME RecName: Full=Acetoacetyl-CoA reductase;       
    3::199     4e-14  28%  246 aa  FABG_BACSU RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    6::199     5e-14  31%  251 aa  Y325_THEMA RecName: Full=Uncharacterized oxidoreductase TM_0325;   
   30::257     5e-14  31%  317 aa  H17B6_HUMAN RecName: Full=Hydroxysteroid 17-beta dehydrogenase 6;  
    7::220     6e-14  32%  263 aa  UCPA_SALTY RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
    7::220     6e-14  32%  263 aa  UCPA_SALTI RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
   30::301     6e-14  33%  317 aa  RDH16_HUMAN RecName: Full=Retinol dehydrogenase 16;       
   13::207     6e-14  32%  254 aa  KDUD_BACSU RecName: Full=2-dehydro-3-deoxy-D-gluconate
   16::201     6e-14  32%  260 aa  DHRS4_RABIT RecName: Full=Dehydrogenase/reductase SDR family member
    6::193     8e-14  31%  253 aa  BACC_BACSU RecName: Full=Bacilysin biosynthesis oxidoreductase
   30::301     1e-13  30%  317 aa  RDH2_RAT RecName: Full=Retinol dehydrogenase 2;       
    1::204     1e-13  28%  248 aa  PHAB_ACISR RecName: Full=Acetoacetyl-CoA reductase;       
   14::214     1e-13  30%  267 aa  LVR_LEIAQ RecName: Full=Levodione reductase;       
    1::209     1e-13  34%  248 aa  Y432_LISMO RecName: Full=Uncharacterized oxidoreductase Lmo0432;   
   30::255     1e-13  29%  317 aa  RDH3_RAT RecName: Full=Retinol dehydrogenase 3;       
   30::255     2e-13  29%  317 aa  RDH7_RAT RecName: Full=Retinol dehydrogenase 7;       
    2::180     2e-13  29%  242 aa  PHAB_PARDE RecName: Full=Acetoacetyl-CoA reductase;       
    7::183     2e-13  29%  241 aa  FABG_RICPR RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    4::188     2e-13  29%  242 aa  FABG_HAEIN RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   53::261     2e-13  29%  338 aa  DHRS7_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
   30::280     3e-13  28%  316 aa  RDH7_MOUSE RecName: Full=Retinol dehydrogenase 7;       
   77::262     3e-13  30%  320 aa  FABG_CUPLA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   14::205     4e-13  32%  267 aa  YM71_YEAST RecName: Full=Uncharacterized oxidoreductase YMR226C;   
   35::212     4e-13  29%  332 aa  KDSR_HUMAN RecName: Full=3-ketodihydrosphingosine reductase;       
   15::205     4e-13  34%  260 aa  DHR11_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
   82::224     5e-13  29%  238 aa  YOXD_BACSU RecName: Full=Uncharacterized oxidoreductase yoxD;      
   19::195     5e-13  29%  268 aa  TRNH_DATST RecName: Full=Tropinone reductase homolog;       
  102::301     5e-13  24%  311 aa  DRS7C_XENTR RecName: Full=Dehydrogenase/reductase SDR family member
    5::190     5e-13  35%  250 aa  CPNA_COMTE RecName: Full=Cyclopentanol dehydrogenase;       
    5::190     5e-13  35%  250 aa  CPNA_COMS9 RecName: Full=Cyclopentanol dehydrogenase;       
   35::240     7e-13  30%  292 aa  DHI1_HUMAN RecName: Full=Corticosteroid 11-beta-dehydrogenase
   10::213     9e-13  30%  253 aa  Y945_MYCTU RecName: Full=Uncharacterized oxidoreductase
   35::212     9e-13  28%  332 aa  KDSR_MOUSE RecName: Full=3-ketodihydrosphingosine reductase;       
   24::203     9e-13  31%  313 aa  DR9C7_BOVIN RecName: Full=Short chain dehydrogenase/reductase
  196::359     1e-12  33%  430 aa  MAS12_AGRRH RecName: Full=Agropine synthesis reductase;       
    6::191     1e-12  26%  244 aa  FABG_BUCAP RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    4::222     1e-12  28%  261 aa  DHKR_STRCM RecName: Full=Monensin polyketide synthase putative
   15::202     2e-12  29%  256 aa  GNO_GLUOX RecName: Full=Gluconate 5-dehydrogenase;       
   35::212     2e-12  26%  331 aa  KDSR_BOVIN RecName: Full=3-ketodihydrosphingosine reductase;       
    6::182     2e-12  29%  244 aa  FABG_VIBHA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    6::182     2e-12  28%  244 aa  FABG_VIBCH RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   82::366     2e-12  24%  381 aa  DHB2_MOUSE RecName: Full=Estradiol 17-beta-dehydrogenase 2;        
   11::178     2e-12  31%  244 aa  CBR2_PIG RecName: Full=Carbonyl reductase [NADPH] 2;       
    3::183     2e-12  30%  256 aa  BUDC_KLEPN RecName: Full=Acetoin(diacetyl) reductase;       
   38::201     3e-12  32%  260 aa  HSD_MYCTU RecName: Full=3-alpha-(or 20-beta)-hydroxysteroid
   38::201     3e-12  32%  260 aa  HSD_MYCBO RecName: Full=3-alpha-(or 20-beta)-hydroxysteroid
   70::334     3e-12  23%  339 aa  BDH_CHICK RecName: Full=D-beta-hydroxybutyrate dehydrogenase,
   19::197     3e-12  27%  261 aa  YGCW_ECOLI RecName: Full=Uncharacterized oxidoreductase ygcW;      
    2::185     3e-12  31%  249 aa  SDH_RHIRD RecName: Full=Serine 3-dehydrogenase;       
    8::188     5e-12  27%  248 aa  FABG_AQUAE RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   95::219     6e-12  32%  334 aa  KDSR_DICDI RecName: Full=3-ketodihydrosphingosine reductase;       
   24::305     6e-12  28%  313 aa  DR9C7_HUMAN RecName: Full=Short chain dehydrogenase/reductase
    5::194     6e-12  28%  245 aa  BDH2_MOUSE RecName: Full=3-hydroxybutyrate dehydrogenase type 2;   
    4::189     8e-12  29%  248 aa  Y4EK_RHISN RecName: Full=Uncharacterized short-chain type
    6::185     8e-12  31%  247 aa  FABG_PSEAE RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    2::183     8e-12  29%  257 aa  BUTA_STAEQ RecName: Full=Acetoin(diacetyl) reductase;       
   35::240     1e-11  28%  291 aa  DHI1_SAISC RecName: Full=Corticosteroid 11-beta-dehydrogenase
   35::230     1e-11  30%  292 aa  DHI1_MESAU RecName: Full=Corticosteroid 11-beta-dehydrogenase
    6::182     2e-11  27%  244 aa  FABG_SHIFL RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   23::197     2e-11  27%  255 aa  FABG_MYCAV RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    6::182     2e-11  27%  244 aa  FABG_ECOLI RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    7::189     2e-11  27%  234 aa  Y0419_STAS1 RecName: Full=Uncharacterized oxidoreductase SSP0419;  
    4::189     3e-11  29%  246 aa  FABG_STAAW RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    4::189     3e-11  29%  246 aa  FABG_STAAS RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    4::189     3e-11  29%  246 aa  FABG_STAAR RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    4::189     3e-11  29%  246 aa  FABG_STAAN RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    4::189     3e-11  29%  246 aa  FABG_STAAM RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    4::189     3e-11  29%  246 aa  FABG_STAAC RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    7::200     3e-11  33%  255 aa  DHR11_CHICK RecName: Full=Dehydrogenase/reductase SDR family member
   81::366     3e-11  28%  387 aa  DHB2_HUMAN RecName: Full=Estradiol 17-beta-dehydrogenase 2;        
   16::194     3e-11  32%  295 aa  ACR1_ACIBI RecName: Full=Fatty acyl-CoA reductase;       
   24::202     3e-11  32%  303 aa  ACR1_ACIAD RecName: Full=Fatty acyl-CoA reductase;       
   32::224     4e-11  28%  356 aa  YXNA_BACSU RecName: Full=Uncharacterized oxidoreductase yxnA;      
    8::186     5e-11  29%  263 aa  YVRD_BACSU RecName: Full=Uncharacterized oxidoreductase yvrD;      
   31::306     5e-11  27%  318 aa  RDH1_HUMAN RecName: Full=11-cis retinol dehydrogenase;       
    2::186     5e-11  30%  246 aa  NODG_AZOBR RecName: Full=Nodulation protein G;
    2::188     5e-11  31%  250 aa  HCDR_XANP2 RecName: Full=2-(R)-hydroxypropyl-CoM dehydrogenase;    
   35::211     5e-11  31%  292 aa  DHI1_RABIT RecName: Full=Corticosteroid 11-beta-dehydrogenase
   39::278     5e-11  29%  300 aa  DHB11_PONAB RecName: Full=Estradiol 17-beta-dehydrogenase 11;      
    3::183     5e-11  30%  241 aa  BUDC_KLETE RecName: Full=Acetoin(diacetyl) reductase;       
   63::194     7e-11  32%  247 aa  Y1385_MYCBO RecName: Full=Uncharacterized oxidoreductase Mb1385;   
   63::194     7e-11  32%  247 aa  Y1350_MYCTU RecName: Full=Uncharacterized oxidoreductase
   34::229     7e-11  28%  291 aa  DHI1A_XENLA RecName: Full=Hydroxysteroid 11-beta-dehydrogenase
   82::367     7e-11  25%  381 aa  DHB2_RAT RecName: Full=Estradiol 17-beta-dehydrogenase 2;       
   13::180     7e-11  28%  246 aa  DER_CHICK RecName: Full=D-erythrulose reductase;       
   43::224     9e-11  33%  286 aa  GS39_BACSU RecName: Full=General stress protein 39;       
    1::187     9e-11  27%  250 aa  FABL_BACSU RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   78::183     9e-11  32%  257 aa  BUTA_STAES RecName: Full=Acetoin(diacetyl) reductase;       
   13::201     1e-10  30%  260 aa  DHRS4_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
   35::232     1e-10  29%  292 aa  DHI1_MOUSE RecName: Full=Corticosteroid 11-beta-dehydrogenase
   39::278     1e-10  29%  300 aa  DHB11_HUMAN RecName: Full=Estradiol 17-beta-dehydrogenase 11;      
   42::188     1e-10  28%  273 aa  YXBG_BACSU RecName: Full=Uncharacterized oxidoreductase yxbG;      
    3::178     1e-10  29%  248 aa  YDFG_SHIFL RecName: Full=NADP-dependent L-serine/L-allo-threonine
    7::220     1e-10  30%  263 aa  UCPA_ECOLI RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
    7::220     1e-10  30%  263 aa  UCPA_ECO57 RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
   10::193     1e-10  29%  900 aa  FOX2_YEAST RecName: Full=Peroxisomal
   97::285     1e-10  24%  311 aa  DRS7C_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
   13::195     2e-10  26%  249 aa  RIDH_KLEAE RecName: Full=Ribitol 2-dehydrogenase;       
   13::188     2e-10  27%  246 aa  PHBB_RALEH RecName: Full=Acetoacetyl-CoA reductase;       
   31::236     2e-10  28%  288 aa  DHI1_RAT RecName: Full=Corticosteroid 11-beta-dehydrogenase isozyme
    2::181     2e-10  28%  237 aa  CBR4_DANRE RecName: Full=Carbonyl reductase family member 4;       
    3::178     2e-10  29%  248 aa  YDFG_ECOL6 RecName: Full=NADP-dependent L-serine/L-allo-threonine
   22::180     2e-10  27%  241 aa  PHBB_ZOORA RecName: Full=Acetoacetyl-CoA reductase;       
   15::176     2e-10  28%  247 aa  FABG_MYCTU RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   15::176     2e-10  28%  247 aa  FABG_MYCBO RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    1::194     2e-10  28%  258 aa  BUTA_STAAW RecName: Full=Acetoin(diacetyl) reductase;       
    1::194     2e-10  28%  258 aa  BUTA_STAAS RecName: Full=Acetoin(diacetyl) reductase;       
    1::194     2e-10  28%  258 aa  BUTA_STAAR RecName: Full=Acetoin(diacetyl) reductase;       
    1::194     2e-10  28%  258 aa  BUTA_STAAN RecName: Full=Acetoin(diacetyl) reductase;       
    1::194     2e-10  28%  258 aa  BUTA_STAAM RecName: Full=Acetoin(diacetyl) reductase;       
    1::194     2e-10  28%  258 aa  BUTA_STAAC RecName: Full=Acetoin(diacetyl) reductase;       
    5::195     3e-10  28%  259 aa  YI13_SCHPO RecName: Full=Uncharacterized oxidoreductase C521.03;   
    9::186     3e-10  29%  251 aa  Y484_MYCTU RecName: Full=Uncharacterized oxidoreductase
  196::359     3e-10  29%  430 aa  MAS11_AGRRH RecName: Full=Agropine synthesis reductase;       
   56::209     3e-10  24%  244 aa  FABG_BUCAI RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   35::237     3e-10  29%  286 aa  DHI1L_XENTR RecName: Full=Hydroxysteroid 11-beta-dehydrogenase
   42::244     4e-10  33%  291 aa  GRDH_DAUCA RecName: Full=Glucose and ribitol dehydrogenase;        
   38::240     4e-10  33%  288 aa  GRDH1_ARATH RecName: Full=Glucose and ribitol dehydrogenase homolog
    9::186     4e-10  31%  906 aa  FOX2_CANTR RecName: Full=Peroxisomal
   23::197     4e-10  26%  255 aa  FABG_MYCS2 RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   64::196     4e-10  28%  247 aa  FABG1_SYNY3 RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    3::178     6e-10  29%  248 aa  YDFG_ECO57 RecName: Full=NADP-dependent L-serine/L-allo-threonine
   38::241     6e-10  33%  289 aa  GRDH2_ARATH RecName: Full=Glucose and ribitol dehydrogenase homolog
    6::202     6e-10  28%  246 aa  FABG_THEMA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   97::220     6e-10  25%  311 aa  DRS7C_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
   98::286     6e-10  24%  312 aa  DRS7C_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   11::178     6e-10  28%  244 aa  CBR2_MOUSE RecName: Full=Carbonyl reductase [NADPH] 2;       
    3::178     7e-10  30%  248 aa  YDFG_SALTY RecName: Full=NADP-dependent L-serine/L-allo-threonine
    3::178     7e-10  30%  248 aa  YDFG_SALTI RecName: Full=NADP-dependent L-serine/L-allo-threonine
    3::178     7e-10  29%  248 aa  YDFG_ECOLI RecName: Full=NADP-dependent L-serine/L-allo-threonine
   10::189     7e-10  30%  254 aa  IDNO_ECOLI RecName: Full=Gluconate 5-dehydrogenase;       
   10::189     7e-10  30%  254 aa  IDNO_ECOL6 RecName: Full=Gluconate 5-dehydrogenase;       
   26::183     7e-10  28%  241 aa  FABG_RICTY RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    1::192     7e-10  25%  245 aa  FABG_BUCBP RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   80::196     7e-10  27%  258 aa  BDHA_RALEH RecName: Full=D-beta-hydroxybutyrate dehydrogenase;     
  108::282     1e-09  30%  309 aa  RDHE2_HUMAN RecName: Full=Epidermal retinal dehydrogenase 2;       
  196::359     1e-09  29%  430 aa  MAS1_AGRT9 RecName: Full=Agropine synthesis reductase;       
   35::240     1e-09  30%  300 aa  DHI1_CAVPO RecName: Full=Corticosteroid 11-beta-dehydrogenase
   37::271     1e-09  27%  304 aa  DHB13_MOUSE RecName: Full=17-beta hydroxysteroid dehydrogenase 13; 
   60::210     2e-09  27%  250 aa  LINC_PSEPA RecName: Full=2,5-dichloro-2,5-cyclohexadiene-1,4-diol
   26::198     2e-09  28%  241 aa  FABG_RICBR RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    7::204     2e-09  25%  248 aa  FABG_CHLMU RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   82::366     2e-09  29%  400 aa  DHI2_RAT RecName: Full=Corticosteroid 11-beta-dehydrogenase isozyme
   32::191     2e-09  28%  261 aa  YF3H_SCHPO RecName: Full=Uncharacterized oxidoreductase C22A12.17c;
   70::187     2e-09  33%  894 aa  FOX2_NEUCR RecName: Full=Peroxisomal
   97::220     2e-09  24%  324 aa  DS7CA_DANRE RecName: Full=Dehydrogenase/reductase SDR family member
   39::273     2e-09  27%  298 aa  DHB11_MOUSE RecName: Full=Estradiol 17-beta-dehydrogenase 11;      
    1::199     2e-09  33%  277 aa  CBR1_MOUSE RecName: Full=Carbonyl reductase [NADPH] 1;       
   31::214     3e-09  29%  318 aa  RDH1_BOVIN RecName: Full=11-cis retinol dehydrogenase;       
   52::183     3e-09  26%  255 aa  HSD_STREX RecName: Full=3-alpha-(or 20-beta)-hydroxysteroid
   34::229     3e-09  26%  291 aa  DHI1B_XENLA RecName: Full=Hydroxysteroid 11-beta-dehydrogenase
   70::192     3e-09  30%  735 aa  DHB4_MOUSE RecName: Full=Peroxisomal multifunctional enzyme type 2;
   37::270     3e-09  27%  300 aa  DHB13_RAT RecName: Full=17-beta hydroxysteroid dehydrogenase 13;   
   39::273     3e-09  24%  300 aa  DHB11_MACFA RecName: Full=Estradiol 17-beta-dehydrogenase 11;      
    7::204     4e-09  26%  248 aa  FABG_CHLTR RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   39::204     4e-09  28%  300 aa  DHB13_HUMAN RecName: Full=17-beta hydroxysteroid dehydrogenase 13; 
   35::192     4e-09  26%  249 aa  BAIA2_EUBSP RecName: Full=Bile acid 7-dehydroxylase 2;       
    4::161     4e-09  35%  258 aa  ADH2_CERRO RecName: Full=Alcohol dehydrogenase 2;       
    4::161     4e-09  35%  258 aa  ADH2_CERCO RecName: Full=Alcohol dehydrogenase 2;       
   53::212     5e-09  29%  272 aa  DHK1_STRVN RecName: Full=Granaticin polyketide synthase putative
   52::192     5e-09  29%  735 aa  DHB4_RAT RecName: Full=Peroxisomal multifunctional enzyme type 2;  
   13::198     6e-09  32%  256 aa  RHLG_PSEAE RecName: Full=Rhamnolipids biosynthesis
    4::185     6e-09  29%  256 aa  DHSO_RHOSH RecName: Full=Sorbitol dehydrogenase;       
   13::201     6e-09  28%  260 aa  DHRS4_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
   35::232     6e-09  26%  292 aa  DHI1_SHEEP RecName: Full=Corticosteroid 11-beta-dehydrogenase
    2::185     8e-09  27%  249 aa  SDH_AGRT5 RecName: Full=Serine 3-dehydrogenase;       
   58::209     8e-09  28%  277 aa  LIMC_RHOER RecName: Full=(-)-trans-carveol dehydrogenase;       
   10::214     1e-08  28%  245 aa  NODG_RHIS3 RecName: Full=Nodulation protein G;
   52::192     1e-08  30%  736 aa  DHB4_HUMAN RecName: Full=Peroxisomal multifunctional enzyme type 2;
    1::201     1e-08  30%  253 aa  YCP8_SCHPO RecName: Full=Uncharacterized oxidoreductase C663.08c;  
   26::194     1e-08  24%  231 aa  Y0585_STAHJ RecName: Full=Uncharacterized oxidoreductase SH0585;   
   39::272     1e-08  23%  298 aa  DHB11_RAT RecName: Full=Estradiol 17-beta-dehydrogenase 11;        
   35::190     1e-08  26%  249 aa  BAIA1_EUBSP RecName: Full=Bile acid 7-dehydroxylase 1/3;       
   12::164     1e-08  33%  257 aa  ADH1_CERCA RecName: Full=Alcohol dehydrogenase 1;       
   44::225     2e-08  31%  286 aa  YAY8_SCHPO RecName: Full=Uncharacterized oxidoreductase C4H3.08;   
  108::282     2e-08  28%  309 aa  RDHE2_MOUSE RecName: Full=Epidermal retinal dehydrogenase 2;       
   82::366     2e-08  26%  386 aa  DHI2_MOUSE RecName: Full=Corticosteroid 11-beta-dehydrogenase
    8::193     2e-08  28%  261 aa  DHG_BACSU RecName: Full=Glucose 1-dehydrogenase;       
    8::193     2e-08  27%  261 aa  DHG_BACME RecName: Full=Glucose 1-dehydrogenase;       
    8::195     2e-08  28%  258 aa  DHG2_BACSU RecName: Full=Glucose 1-dehydrogenase 2;       
    8::191     2e-08  28%  261 aa  DHG2_BACME RecName: Full=Glucose 1-dehydrogenase 2;       
   42::223     2e-08  30%  285 aa  YHXC_BACSU RecName: Full=Uncharacterized oxidoreductase yhxC;      
   46::227     2e-08  29%  289 aa  YHDF_BACSU RecName: Full=Uncharacterized oxidoreductase yhdF;      
   39::205     2e-08  29%  316 aa  S16C6_BOVIN RecName: Full=Short chain dehydrogenase/reductase
   41::238     2e-08  27%  300 aa  GRDH_ORYSJ RecName: Full=Glucose and ribitol dehydrogenase homolog;
  327::580     2e-08  26%  592 aa  EPHD_MYCTU RecName: Full=Probable oxidoreductase ephD;       
  327::580     2e-08  26%  592 aa  EPHD_MYCBO RecName: Full=Probable oxidoreductase ephD;       
   36::232     2e-08  28%  287 aa  DHI1L_DANRE RecName: Full=Hydroxysteroid 11-beta-dehydrogenase
    4::188     3e-08  28%  253 aa  YOHF_ECOLI RecName: Full=Uncharacterized oxidoreductase yohF;      
    8::193     3e-08  27%  261 aa  DHG1_BACME RecName: Full=Glucose 1-dehydrogenase 1;       
   13::179     3e-08  27%  237 aa  CBR4_BOVIN RecName: Full=Carbonyl reductase family member 4;       
   45::285     4e-08  24%  318 aa  DS7CB_DANRE RecName: Full=Dehydrogenase/reductase SDR family member
   83::190     5e-08  29%  248 aa  Y182_METEA RecName: Full=Uncharacterized oxidoreductase
   15::249     5e-08  26%  325 aa  TSC10_NEUCR RecName: Full=3-ketodihydrosphingosine reductase
    4::193     5e-08  31%  265 aa  PGDH_CAVPO RecName: Full=15-hydroxyprostaglandin dehydrogenase
   10::197     5e-08  31%  251 aa  DCXR_CAEEL RecName: Full=Probable L-xylulose reductase;       
    1::215     5e-08  31%  289 aa  CBR1_PIG RecName: Full=Carbonyl reductase [NADPH] 1;       
    1::165     5e-08  33%  277 aa  CBR1_MACFA RecName: Full=Carbonyl reductase [NADPH] 1;       
   30::194     5e-08  27%  245 aa  BDH2_HUMAN RecName: Full=3-hydroxybutyrate dehydrogenase type 2;   
   96::236     7e-08  29%  341 aa  Y1570_MYCBO RecName: Full=Uncharacterized oxidoreductase Mb1570;   
   96::236     7e-08  29%  341 aa  Y1543_MYCTU RecName: Full=Uncharacterized oxidoreductase
   63::189     7e-08  27%  287 aa  HETN_ANASP RecName: Full=Ketoacyl reductase hetN;       
   52::192     7e-08  28%  255 aa  HDHA_ECOLI RecName: Full=7-alpha-hydroxysteroid dehydrogenase;     
   52::192     7e-08  28%  255 aa  HDHA_ECO57 RecName: Full=7-alpha-hydroxysteroid dehydrogenase;     
    6::182     7e-08  25%  244 aa  FABG_SALTY RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    6::182     7e-08  25%  244 aa  FABG_SALTI RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   61::230     7e-08  26%  312 aa  DHB12_MACFA RecName: Full=Estradiol 17-beta-dehydrogenase 12;      
    1::165     7e-08  32%  277 aa  CBR1_PONAB RecName: Full=Carbonyl reductase [NADPH] 1;       
   35::204     9e-08  30%  316 aa  S16C6_MOUSE RecName: Full=Short chain dehydrogenase/reductase
   68::190     9e-08  28%  441 aa  MFEA_DICDI RecName: Full=Peroxisomal multifunctional enzyme A;     
   80::259     9e-08  28%  317 aa  FABG5_BRANA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   37::222     1e-07  29%  278 aa  FIXR_BRAJA RecName: Full=Protein fixR;
   14::203     1e-07  28%  260 aa  DHRS4_PIG RecName: Full=Dehydrogenase/reductase SDR family member
    8::193     1e-07  28%  261 aa  DHG3_BACME RecName: Full=Glucose 1-dehydrogenase 3;       
   54::230     1e-07  26%  312 aa  DHB12_HUMAN RecName: Full=Estradiol 17-beta-dehydrogenase 12;      
    5::198     2e-07  28%  255 aa  YTKK_BACSU RecName: Full=Putative oxidoreductase ytkK;       
   11::208     2e-07  25%  252 aa  YCIK_ECOLI RecName: Full=Uncharacterized oxidoreductase yciK;      
   14::201     2e-07  27%  260 aa  DHRS4_RAT RecName: Full=Dehydrogenase/reductase SDR family member
    2::183     2e-07  25%  242 aa  YMFI_BACSU RecName: Full=Uncharacterized oxidoreductase ymfI;      
    4::211     2e-07  26%  251 aa  YJDA_BACSU RecName: Full=Uncharacterized oxidoreductase yjdA;      
   77::191     2e-07  25%  253 aa  Y5909_MYXXD RecName: Full=Uncharacterized oxidoreductase MXAN_5909;
   37::211     2e-07  28%  287 aa  DHI1L_CHICK RecName: Full=Hydroxysteroid 11-beta-dehydrogenase
    8::193     2e-07  28%  261 aa  DHGA_BACME RecName: Full=Glucose 1-dehydrogenase A;       
    8::193     2e-07  28%  261 aa  DHG4_BACME RecName: Full=Glucose 1-dehydrogenase 4;       
   61::256     2e-07  24%  312 aa  DHB12_MOUSE RecName: Full=Estradiol 17-beta-dehydrogenase 12;      
   58::183     3e-07  29%  249 aa  HCDS_XANP2 RecName: Full=2-(S)-hydroxypropyl-CoM dehydrogenase;    
   61::230     3e-07  26%  312 aa  DHB12_RAT RecName: Full=Estradiol 17-beta-dehydrogenase 12;        
    9::165     3e-07  32%  277 aa  CBR1_HUMAN RecName: Full=Carbonyl reductase [NADPH] 1;       
   51::194     3e-07  28%  245 aa  BDH2_BOVIN RecName: Full=3-hydroxybutyrate dehydrogenase type 2;   
    4::193     3e-07  31%  269 aa  PGDH_MOUSE RecName: Full=15-hydroxyprostaglandin dehydrogenase
   82::275     3e-07  27%  406 aa  DHI2_RABIT RecName: Full=Corticosteroid 11-beta-dehydrogenase
    4::161     3e-07  34%  258 aa  ADH2_CERCA RecName: Full=Alcohol dehydrogenase 2;       
    1::180     4e-07  30%  258 aa  YLX6_SCHPO RecName: Full=Uncharacterized oxidoreductase C922.06;   
    8::200     4e-07  24%  248 aa  FABG_CHLPN RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    4::161     4e-07  32%  258 aa  ADH_BACOL RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   12::164     6e-07  33%  257 aa  ADH1_CERCO RecName: Full=Alcohol dehydrogenase 1;       
   91::270     8e-07  28%  328 aa  FABG2_BRANA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    3::180     8e-07  31%  252 aa  DLTE_BACSU RecName: Full=Uncharacterized oxidoreductase dltE;      
   40::206     1e-06  29%  262 aa  VER1_ASPPA RecName: Full=Versicolorin reductase;       
   30::226     1e-06  25%  272 aa  THR1_GLOLA RecName: Full=Trihydroxynaphthalene reductase;       
   34::201     1e-06  26%  308 aa  YD114_YEAST RecName: Full=Uncharacterized oxidoreductase YDL114W;  
   30::211     1e-06  27%  283 aa  T4HR_MAGGR RecName: Full=Tetrahydroxynaphthalene reductase;        
    8::195     1e-06  27%  262 aa  DHGB_BACME RecName: Full=Glucose 1-dehydrogenase B;       
   72::187     2e-06  26%  548 aa  Y4VI_RHISN RecName: Full=Uncharacterized short-chain type
   36::226     2e-06  29%  335 aa  TSC10_CRYNE RecName: Full=3-ketodihydrosphingosine reductase TSC10;
   30::209     2e-06  28%  230 aa  DR4L2_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
  144::263     2e-06  31%  372 aa  TSC10_YARLI RecName: Full=3-ketodihydrosphingosine reductase TSC10;
   14::147     2e-06  27%  266 aa  TRNH1_ARATH RecName: Full=Tropinone reductase homolog At1g07440;   
   10::244     2e-06  29%  296 aa  SDR2_ARATH RecName: Full=Short-chain dehydrogenase/reductase 2;    
   78::257     2e-06  28%  315 aa  FABG3_BRANA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   83::262     2e-06  28%  320 aa  FABG1_BRANA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    7::195     3e-06  28%  247 aa  YB45_SCHPO RecName: Full=Uncharacterized oxidoreductase C30D10.05c;
   52::184     3e-06  22%  246 aa  PHBB_CHRVI RecName: Full=Acetoacetyl-CoA reductase;       
   83::193     3e-06  32%  266 aa  PGDH_MACFA RecName: Full=15-hydroxyprostaglandin dehydrogenase
   83::193     3e-06  32%  266 aa  PGDH_HUMAN RecName: Full=15-hydroxyprostaglandin dehydrogenase
    4::191     3e-06  27%  275 aa  FABI_HELPJ RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   32::189     4e-06  25%  261 aa  YQC8_SCHPO RecName: Full=Uncharacterized oxidoreductase C1739.08c; 
    4::191     4e-06  27%  275 aa  FABI_HELPY RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    1::199     4e-06  31%  277 aa  CBR1_RAT RecName: Full=Carbonyl reductase [NADPH] 1;       
   11::225     5e-06  28%  262 aa  MTDH_AGABI RecName: Full=NADP-dependent mannitol dehydrogenase;    
   11::189     5e-06  26%  253 aa  KDUD_DICD3 RecName: Full=2-dehydro-3-deoxy-D-gluconate
   82::273     5e-06  26%  405 aa  DHI2_HUMAN RecName: Full=Corticosteroid 11-beta-dehydrogenase
   32::206     6e-06  29%  315 aa  DHI1L_HUMAN RecName: Full=Hydroxysteroid 11-beta-dehydrogenase
   46::197     1e-05  24%  256 aa  Y019_THEMA RecName: Full=Uncharacterized oxidoreductase TM_0019;   
   64::184     1e-05  30%  266 aa  PGDH_BOVIN RecName: Full=15-hydroxyprostaglandin dehydrogenase
   52::242     1e-05  23%  312 aa  DHB12_ANAPL RecName: Full=Estradiol 17-beta-dehydrogenase 12;      
    1::133     1e-05  35%  277 aa  CBR1_BOVIN RecName: Full=Carbonyl reductase [NADPH] 1;       
   33::292     1e-05  26%  323 aa  S16C6_HUMAN RecName: Full=Short chain dehydrogenase/reductase
   53::255     1e-05  27%  324 aa  MKAR_MALGO RecName: Full=3-ketoacyl-CoA reductase;       
   71::254     1e-05  25%  331 aa  HSDL1_CHICK RecName: Full=Hydroxysteroid dehydrogenase-like protein
   12::193     1e-05  28%  261 aa  FABI_RICPR RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   25::196     1e-05  29%  254 aa  FABG4_BRANA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    4::175     1e-05  27%  248 aa  ENTA_ECOLI RecName: Full=2,3-dihydro-2,3-dihydroxybenzoate
   32::228     1e-05  28%  287 aa  DHI1L_BOVIN RecName: Full=Hydroxysteroid 11-beta-dehydrogenase
    7::119     1e-05  30%  166 aa  CSGA_MYXXA RecName: Full=C-factor;AltName: Full=C signal;
    3::93      2e-05  38%  106 aa  YDFG_DICNO RecName: Full=Probable NADP-dependent dehydrogenase in
  102::224     2e-05  27%  336 aa  RD10B_DANRE RecName: Full=Retinol dehydrogenase 10-B;       
   32::228     2e-05  27%  287 aa  DHI1L_MACFA RecName: Full=Hydroxysteroid 11-beta-dehydrogenase
    2::215     2e-05  22%  259 aa  YWFH_BACSU RecName: Full=Bacilysin biosynthesis oxidoreductase
  112::229     2e-05  25%  339 aa  RD10A_DANRE RecName: Full=Retinol dehydrogenase 10-A;       
   81::187     2e-05  26%  245 aa  NODG_RHIME RecName: Full=Nodulation protein G;AltName:
   37::223     3e-05  26%  357 aa  TSC10_EMENI RecName: Full=3-ketodihydrosphingosine reductase tsc10;
   42::208     3e-05  25%  264 aa  STCU_EMENI RecName: Full=Versicolorin reductase;       
   12::193     3e-05  29%  262 aa  FABI_RICBR RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   57::236     3e-05  22%  319 aa  DH12A_DANRE RecName: Full=Estradiol 17-beta-dehydrogenase 12-A;    
    8::199     4e-05  24%  264 aa  YVAG_BACSU RecName: Full=Uncharacterized oxidoreductase yvaG;      
   84::209     4e-05  23%  292 aa  SPS19_YEAST RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase
   29::232     4e-05  26%  303 aa  PECR_PONAB RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase;  
    2::195     4e-05  24%  242 aa  FABG_ACTAC RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   11::221     4e-05  30%  261 aa  DHB8_HUMAN RecName: Full=Estradiol 17-beta-dehydrogenase 8;        
   60::187     4e-05  26%  270 aa  DHB14_BOVIN RecName: Full=17-beta-hydroxysteroid dehydrogenase 14; 
   11::242     5e-05  26%  278 aa  UXUB_BACSU RecName: Full=Uncharacterized oxidoreductase uxuB;      
  114::229     5e-05  27%  341 aa  RDH10_RAT RecName: Full=Retinol dehydrogenase 10;       
  114::229     5e-05  27%  341 aa  RDH10_MOUSE RecName: Full=Retinol dehydrogenase 10;       
  114::229     5e-05  27%  341 aa  RDH10_HUMAN RecName: Full=Retinol dehydrogenase 10;       
  114::229     5e-05  27%  341 aa  RDH10_BOVIN RecName: Full=Retinol dehydrogenase 10;       
    1::193     5e-05  28%  255 aa  HCD2_DROME RecName: Full=3-hydroxyacyl-CoA dehydrogenase type-2;   
   43::254     7e-05  28%  339 aa  YJCD_SCHPO RecName: Full=Uncharacterized oxidoreductase C736.13;   
   70::185     7e-05  23%  259 aa  SRLD_ECOLI RecName: Full=Sorbitol-6-phosphate 2-dehydrogenase;     
    7::179     9e-05  26%  237 aa  YJGI_ECOLI RecName: Full=Uncharacterized oxidoreductase yjgI;      
  147::234     9e-05  33%  299 aa  YHXD_BACSU RecName: Full=Uncharacterized oxidoreductase yhxD;      
    8::209     9e-05  26%  269 aa  XYLL_PSEPU RecName:
   11::199     9e-05  29%  313 aa  DHRS1_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
   34::219     9e-05  23%  300 aa  DECR2_DANRE RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase;   
  114::229     1e-04  25%  341 aa  RDH10_XENTR RecName: Full=Retinol dehydrogenase 10;       
  114::229     1e-04  25%  341 aa  RD10B_XENLA RecName: Full=Retinol dehydrogenase 10-B;       
   20::194     1e-04  24%  266 aa  MTDH_ALTAL RecName: Full=Probable NADP-dependent mannitol
    7::202     1e-04  29%  314 aa  MNR1_CAPAN RecName: Full=(+)-neomenthol dehydrogenase;       
    4::114     2e-04  37%  246 aa  Y7799_EMENI RecName: Full=Uncharacterized oxidoreductase AN7799;   
    1::145     2e-04  33%  253 aa  Y4MP_RHISN RecName: Full=Uncharacterized short-chain type
  104::181     2e-04  27%  252 aa  Y1430_HAEIN RecName: Full=Probable NADP-dependent dehydrogenase
  114::232     2e-04  24%  341 aa  RD10A_XENLA RecName: Full=Retinol dehydrogenase 10-A;       
   80::207     2e-04  29%  303 aa  PECR_RAT RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase;    
   76::189     2e-04  28%  253 aa  KDUD_ECOLI RecName: Full=2-dehydro-3-deoxy-D-gluconate
   14::201     2e-04  25%  260 aa  DHRS4_PONAB RecName: Full=Dehydrogenase/reductase SDR family member
   41::175     2e-04  25%  317 aa  DHR12_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
   48::256     2e-04  28%  306 aa  DHB3_RAT RecName: Full=Testosterone 17-beta-dehydrogenase 3;       
   29::207     2e-04  27%  303 aa  PECR_HUMAN RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase;  
   47::175     2e-04  28%  418 aa  HSDL2_HUMAN RecName: Full=Hydroxysteroid dehydrogenase-like protein
    6::200     2e-04  24%  267 aa  HDHA_CLOSO RecName: Full=NADP-dependent 7-alpha-hydroxysteroid
   12::193     2e-04  28%  260 aa  FABI_RICFE RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    5::179     2e-04  29%  243 aa  BZRD_BACSU RecName: Full=Benzil reductase;         EC=1.1.1.n7;
   62::180     3e-04  26%  255 aa  SOU1_SCHPO RecName: Full=Sorbose reductase sou1;       
  108::197     3e-04  31%  390 aa  MFNA_META3 RecName: Full=L-tyrosine decarboxylase;       
   18::66      3e-04  41%  341 aa  ILVC_GEOKA RecName: Full=Ketol-acid reductoisomerase;       
   14::201     3e-04  25%  260 aa  DHRS4_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   51::242     3e-04  26%  315 aa  STDH2_CAEEL RecName: Full=Putative steroid dehydrogenase 2;        
    4::201     3e-04  26%  256 aa  PTMA_CAMCO RecName: Full=Post-translational flagellin modification
  108::261     3e-04  26%  319 aa  FABG_ARATH RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   48::242     3e-04  25%  305 aa  DHB3_MOUSE RecName: Full=Testosterone 17-beta-dehydrogenase 3;     
   86::186     3e-04  31%  273 aa  ADHR_DROIM RecName: Full=Alcohol dehydrogenase-related 31 kDa
   95::214     5e-04  25%  271 aa  SDR1_PICAB RecName: Full=Short-chain type dehydrogenase/reductase; 
   19::65      5e-04  38%  340 aa  ILVC_LACLS RecName: Full=Ketol-acid reductoisomerase;       
   19::65      5e-04  38%  340 aa  ILVC_LACLM RecName: Full=Ketol-acid reductoisomerase;       
   29::183     5e-04  22%  241 aa  FABG_RICCN RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    5::163     5e-04  31%  341 aa  CAPD_RICB8 RecName: Full=UDP-glucose 4-epimerase;       
   17::67      6e-04  33%  340 aa  ILVC_STRSV RecName: Full=Ketol-acid reductoisomerase;       
   17::67      6e-04  33%  340 aa  ILVC_STRGC RecName: Full=Ketol-acid reductoisomerase;       
   47::175     6e-04  26%  418 aa  HSDL2_PONAB RecName: Full=Hydroxysteroid dehydrogenase-like protein
   41::175     6e-04  28%  317 aa  DHR12_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
    7::184     6e-04  28%  256 aa  ADH_ZAPTU RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
    2::192     6e-04  27%  254 aa  ADH2_DROWH RecName: Full=Alcohol dehydrogenase 2;       
    6::196     8e-04  23%  254 aa  Y3820_MYCBO RecName: Full=Uncharacterized oxidoreductase Mb3820;   
    6::196     8e-04  23%  254 aa  Y3791_MYCTU RecName: Full=Uncharacterized oxidoreductase
   80::274     8e-04  30%  389 aa  MKAR_YARLI RecName: Full=3-ketoacyl-CoA reductase;       
   51::238     8e-04  27%  316 aa  LE767_CAEBR RecName: Full=Putative steroid dehydrogenase let-767;  
   48::196     8e-04  28%  272 aa  ADHR_DROTE RecName: Full=Alcohol dehydrogenase-related 31 kDa
   48::196     8e-04  29%  272 aa  ADHR_DROMA RecName: Full=Alcohol dehydrogenase-related 31 kDa
    1::274

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVNNSKTILITGCSHGGIGYATAVHLKNLGHRVFASARQQKDVEALSQEGFETYLIDVTNYEYIDNALAD
YBBO_ECOLI      -----KSVLITGCS-SGIGLESALELKRQGFHVLAGCRKPDDVERMNSMGFTGVLIDLDSPESVDRAADE
YBBO_ECOL6      -----KSVLITGCS-SGIGLESALELKRQGFHVLAGCRKPDDVERMNSMGFTGVLIDLDSPESVDRAADE
VDLC_HELPY      ---SQKVAIITGAS-SGIGLECALMLLDQGYKVYALSRHATLCVALNHALCESVDIDVSD----SNALKE
VDLC_HELPJ      --------VITGAS-SGIGLECVLMLLNQGYKVYALSRHATLCVALNHALCECVDIDVSDSNALKEVFLN
YUSZ_BACSU      ---NKKIAIVTGAS-SGFGLLAAVKLAR-SFFVIATSRQPEKAEQLREDSIHITALDVTDEQSIVSFGKA
YQ53_SCHPO      MKSTFSTVLITGSSKG-LGYALVKVGLAQGYNVIACSRAP-DTITIEHSXXXXXXXDVTDVKSVETAFKD
RDH8_HUMAN      -----RTVLISGCS-SGIGLELAVQLAHDPKKRYQVVATMRDLXXXXXXXXXXXXLDVCS----DESVAQ
YAEB_SCHPO      -----KFVLITGCSEGGIGNALALKFHQEGFQVLATARQVERMDNLTKAGLQTLKLDVTDEDSVREVEQE
YQJQ_BACSU      -----KRIWITGAS-GGLGERIAYLCAAEGAHVLLSARREDRLIEIKRKQCEIFPLDVGRLEDIARVRDQ
H17B6_RAT       ---HDKYVFITGCD-SGFGNLLARQLDRRGMRVLAACLTEKGAEELTSDRLETVILDVTNTDSISAATQW
YXJF_BACSU      --------LVTGAA-GGIGFEIAREFAREGASVIVSDLREKAASKLAEEGFDAAAIDVTKEAQVADTV-N
DRS7B_DANRE     -----KVVVITGAS-SGLGKECARVFHAAGARLILCGRDQRRLQEVVEELGNTVTFDLSNTSVVCSAAAE
RDH8_BOVIN      MADAPRTVLISGCS-SGIGLELAVQLAHDPRQRYQVVATMRDLEALGQT-LTVAQLDVCS----DESVAQ
BDH_MOUSE       ---SGKAILITGCD-SGFGFSLAKHLHSKGFLVFAGCLMKKELDSLKSDRLRTIQLNVCNSEEVEKAVET
AYR1_YEAST      -----KIAVVTGAS-GGIGYEVTKELARNGYLVYACARRLEPMAQLANDSIKPYKLDISKPEEIVTFSGF
DRS7B_XENTR     -------VVITGAT-SGLGRECAKVFYAAGTRLVLCGRSEEGLKNLVQELSQMVIFDLSDVEAVNSAANE
BDHA_RHIME      ----TKTAVITG-STSGIGLAIARTLAKAGANIVLNGFGAPDVAGLSSGTVLHHPADMTKPSEIADMMAM
BACC2_BACSU     -----KTVLITGGA-SGIGYAAVQAFLNQQANVVVADIDEAQGEAMIRKENNDRLTDITDEPACQNAIRS
DRS7B_MOUSE     -------VVVTGAT-SGLGRECAKVFHAAGAKLVLCGRNVKALEELSREQGQTHQPFVVTFDLADPAAAE
DRS7B_XENLA     -------VVITGATSGKVFYAAGSHLVLCGRRLKDLVQELNNMRLKSTQLHKPHMVDLSDVEAVNTAAKE
BDH_RAT         ---SGKAVLVTGCD-SGFGFSLAKHLHSKGFLVFAGCLLKRELDSLKSDRLRTIQLNVCNSEEVEKAVET
DHB1_RAT        ---DSTVVLITGCS-SGIGLHLAVRLRSQSFKVYATLRDLKSLEAARAQGLEILELDVRDSESVAAARAC
Y2778_STAA8     -VLTDKVAVVTGAG-SGIGEAIATLLHEEGAKVVLAGRNKEKLQQLSQDSVKVVPTDVTNKEEVDE-LIK
Y2488_STAAC     -VLTDKVAVVTGAG-SGIGEAIATLLHEEGAKVVLAGRNKEKLQQLSQDSVKVVPTDVTNKEEVDE-LIK
Y2422_STAA3     -VLTDKVAVVTGAG-SGIGEAIATLLHEEGAKVVLAGRNKEKLQQLSQDSVKVVPTDVTNKEEVDE-LIK
DHRS9_RAT       -----KYIFITGCD-SGFGNLAARTFDRKGFRVIAACLTESGSEALTSERLHTVLLDVTNPENVKETAQW
DHRS7_ANOGA     ---NGKVVLITGAS-SGLGEALAHSFFLAGCKVVLAARRKDELERVRKDLLELHATVPTHXXXXXXXXXX
Y2403_STAAW     -VLTDKIAVVTGAG-SGIGEAIATLLHEEGAKVVLAGRNKEKLQQLSQDSVKVVPTDVTNKEEVDE-LIK
Y2370_STAAS     -VLTDKIAVVTGAG-SGIGEAIATLLHEEGAKVVLAGRNKEKLQQLSQDSVKVVPTDVTNKEEVDE-LIK
DHRS7_HUMAN     -------VWVTGAS-SGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENLPLDLTDTGSHEAATKA
BDH_BOVIN       ----SKAVLITGCD-SGFGFSLAKHLHSEGFLVFAGCLMKKELDSMKSDRLRTVQLNVCKSEEVDKAAEV
H17B6_MOUSE     -----KYVFITGCD-SGFGNLLARQLDRRGMRVLAACLTEKGAEELTSDRLETVILDVTKTESIVAATQW
DHB1_HUMAN      -------VLITGCS-SGIGLHLAVRLASQSFKVYATLRDLKTQGRLWEAALETLQLDVRDSKSVAAARER
DRS7B_PONAB     -------VVITGAT-SGLGKECAKVFYAAGAKLVLCGRNGGALEELIRETHKPYLVDLTDSGAIVAAAAE
DHB1_PANTR      -------VLITGCS-SGIGLHLAVRLASQSFKVYATLRDLKTQGRLWEAALETLQLDVRDSKSVAAARER
DRS7B_HUMAN     -------VVITGAT-SGLGKECAKVFYAAGAKLVLCGRNGGALEELIRETHKPYLVDLTDSGAIVAAAAE
DR9C7_MOUSE     ---SEKYVFITGCD-SGFGNLLAKQLVDRGMKVLAACLTEEGAQKLLQDTLQTFLLDVTKSENVKEAAQW
Y2478_STAAM     -VLTDKIAVVTGAG-SGIGEAIATLLHEEGAKVVLAGRNKDKLQQLAQDSVKVVPTDVTNKEEVDE-LMK
Y2266_STAAN     -VLTDKIAVVTGAG-SGIGEAIATLLHEEGAKVVLAGRNKDKLQQLAQDSVKVVPTDVTNKEEVDE-LMK
DRS7B_BOVIN     ----------------------------------------------------TVTFDLADPGAIAGAASE
DHRS9_BOVIN     -----KYIFITGCDTG-FGNLAARTFDKKGFHVIAACLTESGSTALKAETSETVLLDVTDPENVKRAAQW
YI78_SCHPO      -------------------------------------REPKNAKVLSRENVLVTQLDVNNFSSIKKSVEK
DHRS9_HUMAN     -----KYIFITGCD-SGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSETVLLDVTDPENVKRTAQW
TRN1_DATST      ------TALVTGGSKG-IGYAIVEELAGLGARVYTCSRNEKELDGLNVEGSVCDLLSRTERDKLMQTVAH
DHRS7_DROME     -----KVVLITGAS-SGLGESLAHVFYRAGCRVILAARRTQELERVKKDLLALDVLDLAELNSIPEFVTR
DHB1_MOUSE      -------VLITGCS-SGIGMHLAVRLRSQSFKVYATLRDLKALEAARTQGLEILELDVRDSKSVAAAQAC
TRN2_HYONI      ------TALVTGGSRG-IGYGIVEELANLGASVYTCSRNQKELECLTQKGFEASVCDLSSRSEREEFMKT
DRS7B_RAT       ----------------------------------------------------------------------
DHRS9_MOUSE     -----KYVFITGCDTG-FGNLAARTFDKKGFRVIAACLTESGSAALTSERLHTVLLDVTDPENVKKTAQW
ACT3_STRCO      ---DSEVALVTGAT-SGIGLEIARRLGKEGLRVFVCARGEEGLRTLREAGVEARTCDVRSVPEIEALVAA
Y2049_STAEQ     -----KVAVVTGAS-SGIGEAIAKKLSQQGASIVLVGRNEQRLNEIAQQPAKVVSADVTVKSNIDDMLKA
Y2036_STAES     -----KVAVVTGAS-SGIGEAIAKKLSQQGASIVLVGRNEQRLNEIAQQPAKVVSADVTVKSNIDDMLKA
Y1627_STAS1     -----KVVVITGAS-SGIGEETVNLLSENGAKLVLGARRLDRLEKIQQKGHDSVSIKKTDVTKPDNALIE
DHR11_HUMAN     --------LVTGAS-GGIGAAVARALVQQGLKVVGCARTVGNIEELAAEGYPGTLIDLSNEEDILSMFSA
YKVO_BACSU      -----KIALVTGGT-SGIGLATAQKFVNEGAYVYITGRRQNELDAVNQIGKNVTGVDISKLEDLDK-LYD
Y452_LISIN      MTIKNKVIIITGAS-SGIGEATAILLAEKGAKLVLAARREKIVQTIKASSGEAIFADVTKRE--DNKLVE
FABG_STAES      ----NKSALVTGASRG-IGRSIALQLAEEGYNVAVNYAGSKDVEEIKAKGVESFAINVAKGDEVKEMIKE
FABG_STAEQ      ----NKSALVTGASRG-IGRSIALQLAEEGYNVAVNYAGSKDVEEIKAKGVESFAINVAKGDEVKEMIKE
BDH_HUMAN       ----SKAVLVTGCD-SGFGFSLAKHLHSKGFLVFAGCLMKKELDSLNSDRLRTVQLNVCXXXXXXXXXXX
Y2567_STAAR     -VLTDKIAVVTGAG-SGIGEAIATLLHEEGAKVVLAGRNKDKLQQLAQDSVKVVPTDVTKKEEVDE-LIK
DHR11_BOVIN     --------LVTGAS-GGIGAAVARALVQQGLKVVGCARTVGNIEELAAEGYPGTLIDLSNEEDILSMFSA
BACC_BACAM      -----KTVLITGGA-SGIGYAAVQAFLNQQANVVVADIDEAQGEAMIRKENNDRLTDITNEPACQNAILS
TRN2_DATST      ------TALVTGGSRG-IGYGIVEELASLGASVYTCSRNQKELDCLTQKGFEASVCDLSSRSERQELMNT
PHBB_RHIME      ----SRVALVTGGSRG-IGAAICVALKAAGYKVAANAGNDERAKAFEQEGIPVYKWDVSSYQACVDGIAR
FABG_BACSU      ---NDKTAIVTGASRG-IGRSIALDLAKSGANVVVNAKANEVVDEIKSMGRKAIAVDVSNPEDVQNMIKE
Y325_THEMA      -----KVVLITGAG-SGIGKKAAVMFAERGAKVISEEKGKETVELIKSMGGEAAFI----FGDVAKDAEQ
H17B6_HUMAN     -----KYVFITGCD-SGFGNLLARQLDARGLRVLAACLTEKGAEQLTSDRLETVTLDVTKMESIAAATQW
UCPA_SALTY      -----KTALITGASQGGIARVFARHGANL-ILLDISDEIEKLADELGGRGHRCTAVDVRDFASVQAAVAR
UCPA_SALTI      -----KTALITGASQGGIARVFARHGANL-ILLDISDEIEKLADELGGRGHRCTAVDVRDFASVQAAVAR
RDH16_HUMAN     -----KYVFITGCD-SGFGKLLARQLDARGLRVLAACLTEKGAEQLTSDRLETVTLDVTKTESVAAAVKE
KDUD_BACSU      -----KTALVTGPGTG-IGQGIAKALAGAGADIIGTSHTSSLSETVEQEGFTSFTLDMSKPEAIKDSAAE
DHRS4_RABIT     -------VAIVTASTDGIGLAIARRLAQDGAHVVISSRKQQNVDALQAEGLSVTVCHVGKAEDRERLVAT
BACC_BACSU      -----KTVLITGGA-SGIGYAAVQAFLGQQANVVVADIDEAQGEAMVRKENNDRLTDITDEAACQHAVES
RDH2_RAT        -----KYVFITGCD-SGFGNLLARQLDRRGMRVLAACLTEKGAEQLTSDRLETVILDVTKTESIVAATQW
PHAB_ACISR      -MSEQKVALVTGAL-GGIGSEICRQLVTAGYKIIATVEEDREKQWLQSEGFQDFVLTDLNNHXXXXXXXX
LVR_LEIAQ       -----RVVLITG-GGSGLGRATAVRLAAEGAKLSLVDVSSEGLEASKAAVLETAVADVSDEAQVE-AYVT
Y432_LISMO      MTIKNKVIIITGAS-SGIGKATALLLAEKGAKLVLAARREKIVQTIKANSGEAIFADVTKRE--DNKLVE
RDH3_RAT        -----KYVFITGCD-SGFGNLLARQLDRRGMRVLAACLTEKGAEQLTSDRLETVILDVTKTESIVAATQW
RDH7_RAT        -----KYVFITGCD-SGFGNLLARQLDRRGMRVLAACLTEKGAEQLTSDRLETVILDVTKTESIVAATQW
PHAB_PARDE      ----AKVALVTGGSRG-IGAAISKALKEAGYTVAANYAGNDDARAFTEEGIKTYKWSVADYDACAAGIKQ
FABG_RICPR      -----KTSLITGAS-SGIGSAIARLLHKLGSKVIISGSNEEKLKSLGNALKDNYTIEVCNLANKEEC-SN
FABG_HAEIN      -----KIALVTGSTRG-IGRAIAEELSSKGAFVIGTATSEKGAEAISADKGKGLVLNVTDKESIETLLEQ
DHRS7_MOUSE     -------VWVTGAS-SGIGEELAFQLSKLGVSLVLSARRAQELERVKRRCLENLPLDLTDTSSHEAATKA
RDH7_MOUSE      -----KYVFITGCD-SGFGNLLARQLDRRGMRVLAACLTEKGAEQLTSDRLETVILDVTKTESIVAATQW
FABG_CUPLA      ----SPVVIVTGASRG-IGKAIALSLGKAGCKVLVNARSSKEAEEVSKEGGQTFGGDVSKEEDVEAMIKT
YM71_YEAST      -----KTVLITGAS-AGIGKATALEYSNGDMKLILAARRXXXXXTIDQEKVHVAQLDITQAEKIKPFIEN
KDSR_HUMAN      -------VVVTGGS-SGIGKCIAIECYKQGAFITLVARNEKEIEMHSINDKQVVLVDVSDYNQVENVIKQ
DHR11_MOUSE     --------LVTGAS-GGIGAAVARALVQQGLKVVGCARTVGNIEELAAEGYPGTLIDLSNEEDILSMFSA
YOXD_BACSU      ----------------------------------------------------------------------
TRNH_DATST      ------TALVTGGTRG-IGYAIVEELANFGAEVYTCSRSQNDLEKWRRKGFKVSVCDVSSISQRQTLMES
DRS7C_XENTR     --------------------------------------------------------DINNMEAMGKEIQD
CPNA_COMTE      ---NDKVVLVTGGAMGGLTHCTTVYLSDLGHQAVAEIRRQG--------GKAHFLLDVTNENHWTGAVDT
CPNA_COMS9      ---NDKVVLVTGGAMGGLTHCTTVYLSDLGHQAVAEIRRQG--------GKAHFLLDVTNENHWTGAVDT
DHI1_HUMAN      -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
Y945_MYCTU      -------ILITGAS-SGLGAGMARSFAAQGRDLALCARRTDRLTELKAELSQRYPLDVNDHERVPKVFAE
KDSR_MOUSE      -------VVVTGGS-SGIGKCIAIECYKQGAFITLVARNEKDIEKHSINDKQVVLVDVSDYNQVENVIKQ
DR9C7_BOVIN     ---SDKYVFITGCD-SGFGNLLARQLVDRGMRVLAACFTKEGAQKLQQDTLQTILLDVTKTESIKAATQW
MAS12_AGRRH     -IHQSPVILISGPSRG-IGKAIAENLIAHGYRMSLGARRVKDLE--SAFGPQSEWLHYARFDAEDNAWVT
FABG_BUCAP      -----KTALVTGANQG-LGKEIAIKLSQKGIQVIGTSTTVDGVKTLKKNGFG-FILDLKDTDSILEKMKE
DHKR_STRCM      --STSRVALVTGAT-SGIGLATARLLAAQGHLVFLGARTESDVKALRNDGLEAQVLDVRDGASV-TAFVQ
GNO_GLUOX       --------LVTGASRG-IGLTLAKGLARYGAEVVLNGRNAESLDS-AQSGFETAVFDVTDQDAVIDGVAA
KDSR_BOVIN      -------VVVTGGS-SGIGKCIAIECYKQGAFITLVARNEKEIEKHSINDKQVVLVDVSDYSQVENVIKQ
FABG_VIBHA      -----KIALVTGASRG-IGRAIAELLVERGATVIGTATSEGGAAAISEENGKGLALNVTDVESIEATLKT
FABG_VIBCH      -----KVALVTGASRG-IGKAIAELLAERGAKVIGTATSESGAQAISDDNGKGMALNVTNPESIEAVLKA
DHB2_MOUSE      ---DQKAVLVTGAD-SGFGHGLAKHLDKLGFTVFAGVLDKEELRKHCSERLSVLQMDVTKPEQIKDAHSK
CBR2_PIG        --------LVTGAGKG-IGRDTVKALHVSGARVVAVTRTNGDLVSLSQEGIEPVCVDLGDWEATERALGG
BUDC_KLEPN      -----KVALVTGAGQG-IGKAIALRLVKDGFAVAIADYNDATAKAVASEINQAVKVDVSDRDQVFAAVEQ
HSD_MYCTU       -------------------------------------------DILDEEGVAAELADAARYVHLDTAAVD
HSD_MYCBO       -------------------------------------------DILDEEGVAAELADAARYVHLDTAAVD
BDH_CHICK       ------------------------HLHTKGFIIYAGCLQKKDLDNMNSDRMRTVQLNVCDSKEVDRAVEH
YGCW_ECOLI      -----KTAIVTG-GNSGLGQAFAMALAKAGANIFIPSFVKDNGETIEKQGVEVDFMQVITAEGAPQKIIA
SDH_RHIRD       ----SGTILITGAT-SGFGQATAQRFVKEGWKVIGTGRRAERLEALSAEAFHGVAFDITDEEATKKALAG
FABG_AQUAE      -----KVSLVTGSTRG-IGRAIAEKLASAGSTVIITGTSGERAKAVAEEIANKYGVNLLSEESINKAFEE
KDSR_DICDI      ---------------------------------------------------EIYSCDITNKIKVKETIAQ
DR9C7_HUMAN     ---SEKYVFITGCD-SGFGNLLAKQLVDRGMQVLAACFTEEGSQKLQRDTLQTTLLDVTKSESIKAAAQW
BDH2_MOUSE      ---DGKVIVLTAAAQG-IGRASALAFAREGAKVIATDINESKLQELSYRGIQTRVLDVTKKRQIDQFASE
Y4EK_RHISN      -MNRYEVALVTGAS-SGIGKAIALELASAGLRVLALGRDRAALDELSTAGIVPVVFDLSDVSEVYGKIA-
FABG_PSEAE      -----KVALVTGASRG-IGQAIALELGRLGAVVIGTATSEKIAETLKANGVEGLVLDVSSDESVAATLEH
BUTA_STAEQ      ----SKTAIITG-SAGGLGKGIAERLANDGFNIVLQXXXXXXXXXXXXXGYQAFKSDVSKKKEQEELVQF
DHI1_SAISC      -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
DHI1_MESAU      -----KKVIVTGASKG-IGREMAYHLSEMGAHVVLTARSEEGLQKVASRCLE---LGAASAHYIAGTMED
FABG_SHIFL      -----KIALVTGASRG-IGRAIAETLAARGAKVIGTATSENGAQAISDANGKGLMLNVTDPASIESVLEK
FABG_MYCAV      ----SRSVLVTG-GNRGIGLAIAQRLAAEAHKVAVTHRGSGAPDGLF--GVEC---DVTDNDAVDRAFTE
FABG_ECOLI      -----KIALVTGASRG-IGRAIAETLAARGAKVIGTATSENGAQAISDANGKGLMLNVTDPASIESVLEK
Y0419_STAS1     -----KVAVVTGAS-SGIGASIAETLANQGVKVVLTGRDEKRIQDNKQAVVETSIVDXXXXXXXXXXXXX
FABG_STAAW      ----TKSALVTGASRG-IGRSIALQLAEEGYNVAVNYXXXXXXXXXXXXXXXXXXXDVADADEVKAMIKE
FABG_STAAS      ----TKSALVTGASRG-IGRSIALQLAEEGYNVAVNYXXXXXXXXXXXXXXXXXXXDVADADEVKAMIKE
FABG_STAAR      ----TKSALVTGASRG-IGRSIALQLAEEGYNVAVNYXXXXXXXXXXXXXXXXXXXDVADADEVKAMIKE
FABG_STAAN      ----TKSALVTGASRG-IGRSIALQLAEEGYNVAVNYXXXXXXXXXXXXXXXXXXXDVADADEVKAMIKE
FABG_STAAM      ----TKSALVTGASRG-IGRSIALQLAEEGYNVAVNYXXXXXXXXXXXXXXXXXXXDVADADEVKAMIKE
FABG_STAAC      ----TKSALVTGASRG-IGRSIALQLAEEGYNVAVNYXXXXXXXXXXXXXXXXXXXDVADADEVKAMIKE
DHR11_CHICK     -----RVALVTGASVG-IGAAVARALVQHGMKVVGCARSVDKIEKLAAEGYPGTLIDLSNEEEILSMFSA
DHB2_HUMAN      ---DQKAVLVTG-GDCGLGHALCKYLDELGFTVFAGVLNEEELRRTCSPRLSVLQMDITKPVQIKDAVAA
ACR1_ACIBI      -----KVALITGAS-SGIGLTIAKRIAAAGAHVLLVARTQETLEAIEQQGGQASIFDLTDMNAIDQLSQQ
ACR1_ACIAD      -----KVALITGAS-SGIGLTIAKRIAAAGAHVLLVARTQETLEAIEQQGGQASIFDLTDMNAIDQLSQQ
YXNA_BACSU      -----QVIVITGAS-SGIGLVTARMXXXXXXXXXXXXRNEEALKELTDEGHDAIWVDVGKEEDV-NRIAE
YVRD_BACSU      -----KLVLITG-STSGIGKAAAKSFLQEGAAVIVNGRKQETVDRTIEEGYGTVHGAAADLSKTDEAAAF
RDH1_HUMAN      -------VFITGCD-SGFGRLLALQLDQRGFRVLASCLTPEDLQRVASSRLHTTLLDITDPQSVQQAAKW
NODG_AZOBR      ---SQKIALVTGAM-GGLGTAICQALAKDGCIVAANCLPNFEPAALGQQGFKFYVADVSDFESCKAMVAK
HCDR_XANP2      ----SRVAIVTGASSGN-GLAIATRFLARGDRVAALDLSAETLEETARTHWHAYAADVADEGDVNAAIAA
DHI1_RABIT      -----KKVIVTGASKG-IGKEIAFHLAKMGAHVVVTARSK---ETLQEVVAHCLKLGAASAHYIAGTMED
DHB11_PONAB     -------VLITGAGHG-IGRLTAYEFAKLKSKLVLWDINKHGLEETAAKKVHTFVVDCSNREDIYSAAKK
BUDC_KLETE      -----KVALVTGAGQG-IGKAIALRLVKDGFAVYNDATATAVAAEINQAGGRAVAIDVSRRDQVFAAVEQ
Y1385_MYCBO     --------------------------------------------------------DVTQADDVDILIRT
Y1350_MYCTU     --------------------------------------------------------DVTQADDVDILIRT
DHI1A_XENLA     -----KRVLITGSSTG-IGEQIAYEFARMGAHIMVTARRLQRLQEVANECLKLVASDMGNLTSAQYVAQE
DHB2_RAT        ---DQKAVLVTGAD-SGFGHALAKHLDKLGFTVFAGVLDKEELRKNCSERLSVLQMDVTKPEQIKDVHSE
DER_CHICK       --------LVTGAGKG-IGRAVAVALCKAGARVTALSRTAADLESLVREGIEPLCLDLADWDATEAAVG-
GS39_BACSU      -----KVALITG-GDSGIGRAVSVAYAKEGADIAIVYKDEEDAEEVEQEGVKCLLIDVGEEEFCNEAVEK
FABL_BACSU      -MEQNKCALVTGSSRG-VGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVKANVGQPAK
BUTA_STAES      ----------------------------------------------------------------------
DHRS4_BOVIN     ---DNKVALVTA-STDGIGFAIARRLAQDGAHVVVSSRKQQNVDTLKGEGLSVTVCHVGKAEDRERLVAT
DHI1_MOUSE      -----KKVIVTGASKG-IGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLE---LGAASAHYIAGTMED
DHB11_HUMAN     -------VLITGAGHG-IGRLTAYEFAKLKSKLVLWDINKHGLEETAAKKVHTFVVDCSNREDIYSSAKK
YXBG_BACSU      -------------------------------------QMEETVDAIRKNGAESFHLDVSDENSV-KAFAD
YDFG_SHIFL      -------VLVTGAT-AGFGECITRRFIQQGHKVIATGRRQERLQELTDEGDNLYILDVRNRAAIEEMLAS
UCPA_ECOLI      -----KTALITGALQGGIARTFARHGANL-ILLDISPEIEKLADELCGRGHRCTAVDVRDPASVAAAIKR
UCPA_ECO57      -----KTALITGALQGGIARTFARHGANL-ILLDISPEIEKLADELCGRGHRCTAVDVRDPASVAAAIKR
FOX2_YEAST      -----RVVVITGAG-GGLGYALAVVVNDLGGTLGGSGHNSKAADLVVDEIKKAGGIAVANYDSVNENGEK
DRS7C_BOVIN     ------------------------------------------------------LLDLSDISCVQDVAKE
RIDH_KLEAE      ---SGKVAAITGAA-SGIGLECARTLLGAGAKVVLIDREGEKLNKLVAELGENAFVDLMQADQVDNLLQG
PHBB_RALEH      ---------------GGIGTAICQRLAKDGFRVVASPRREKWLEQQKALGFDFIASEVADWDSTKTAFDK
DHI1_RAT        -----KKVIVTGASKG-IGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLE---LGAASAHYIAGTMED
CBR4_DANRE      ----SRLAVVFGGSRG-IGRAASKLLAQRGHRIVLLSRNKEAAQSTAQENHLGLSCDVSKEEEVQKAF-E
YDFG_ECOL6      -------VLVTGAT-AGFGECITRRFIQQGHKVIATGRRQERLQELKDEGDNLYILDVRNRAAIEEMLAS
PHBB_ZOORA      -------------------------LKAAGYKVAASYAGNDDAAKKAETGIAVYKWDVSSYEACVEGIAK
FABG_MYCTU      ----SRSVLVTG-GNRGIGLAIAQRLAADGHKVAVTHRGSGAPKGLF--GVEC---DVTDSDAVDRAFTA
FABG_MYCBO      ----SRSVLVTG-GNRGIGLAIAQRLAADGHKVAVTHRGSGAPKGLF--GVEC---DVTDSDAVDRAFTA
BUTA_STAAW      -MTNNKVALVTGGAQG-IGFKIAERLVEDGFKVAVVDFNEEGAKALSSDGTKAIAIDVSNRDDVFNAVRQ
BUTA_STAAS      -MTNNKVALVTGGAQG-IGFKIAERLVEDGFKVAVVDFNEEGAKALSSDGTKAIAIDVSNRDDVFNAVRQ
BUTA_STAAR      -MTNNKVALVTGGAQG-IGFKIAERLVEDGFKVAVVDFNEEGAKALSSDGTKAIAIDVSNRDDVFNAVRQ
BUTA_STAAN      -MTNNKVALVTGGAQG-IGFKIAERLVEDGFKVAVVDFNEEGAKALSSDGTKAIAIDVSNRDDVFNAVRQ
BUTA_STAAM      -MTNNKVALVTGGAQG-IGFKIAERLVEDGFKVAVVDFNEEGAKALSSDGTKAIAIDVSNRDDVFNAVRQ
BUTA_STAAC      -MTNNKVALVTGGAQG-IGFKIAERLVEDGFKVAVVDFNEEGAKALSSDGTKAIAIDVSNRDDVFNAVRQ
YI13_SCHPO      ---DGKTILITGAS-SGIGKSTAFEXXXXXXRRFSTVEEAKELESKYEVSVLPLKLDVSDLKSIPGVI-E
Y484_MYCTU      -----RVAVVTGAS-SGIGEATARTLAAQGFHVVAVARRADRITALANQIGGTXXXXXXXXXXXXXXXXR
MAS11_AGRRH     -IHQSPVILVSG-SNRGVGKAIAEDLIAHGYRLSLGARKVKDLEVAQDEWLHYARFDAEDHGTMAAWVTA
FABG_BUCAI      -----------------------------------------------------FVLNLKNIDSITEKIQE
DHI1L_XENTR     -------VLVTGASTG-IGEEIAYHYARAGAKLVLTARREHALQEVKSRCLEVFLVDMASHNAREQVVAE
GRDH_DAUCA      -----KVALVTG-GDSGIGRSVCYHFALEGATVFVKGHEDKDAKAKSSDAKDPIAI-AADLGFDDNCVVD
GRDH1_ARATH     -----KVALITG-GDSGIGRAVGYCFASEGATVYVKGQEEKDAQETLQMLKEVKTSDSTDLGFDENCVVD
FOX2_CANTR      -----KVVIITGAG-GGLGKYYSLEFAKLGAKVVVNDLGG----ALNGQGGNSKAADVVVDEIVKNAVAD
FABG_MYCS2      ----SRSVLVTG-GNRGIGLAIARRLAADGHKVAVTHRGSGAPDDLF--GVQC---DVTDSAAVDRAFKE
FABG1_SYNY3     --------------------------------------------------------NVANADEVDQLIKT
YDFG_ECO57      -------VLVTGAT-AGFGECITRRFIQQGHKVIATGRRQERLQELKDEGDNLYILDVRNRAAIEEMLAS
GRDH2_ARATH     ---HGKVALVTG-GDSGIGKAVCHCYALEGASVYVKGREDKDAEETTREAKEPIMIDLGFEENCKRVVEE
FABG_THEMA      -----KVCLITGAA-SGIGKATTLLFAQEGATVIAGDISKENLDSLVKEAVDPYVLNVTDRDQIXXXXXX
DRS7C_MOUSE     ------------------------------------------------------LLDLSDISCVQDVAKE
DRS7C_HUMAN     ------------------------------------------------------LLDLSDISCVPDVAKE
CBR2_MOUSE      --------LVTGAGKG-IGRDTVKALHASGAKVVAVTRTNSDLVSLAKEGIEPVCVDLGDWDATEKALGG
YDFG_SALTY      -------VLVTGAT-AGFGECIARRFVENGHKVIATGRRHERLQALKDELGENVLLDVRNRAAIEEMMAS
YDFG_SALTI      -------VLVTGAT-AGFGECIARRFVENGHKVIATGRRHERLQALKDELGENVLLDVRNRAAIEEMMAS
YDFG_ECOLI      -------VLVTGAT-AGFGECITRRFIQQGHKVIATGRRQERLQELKDEGDNLYILDVRNRAAIEEMLAS
IDNO_ECOLI      -----KNILITGSAQG-IGFLLATGLGKYGAQIITAERAELAVEKLHQEGIQAVAFNVTHKHEIDAAVEH
IDNO_ECOL6      -----KNILITGSAQG-IGFLLATGLGKYGAQIITAERAELAVEKLHQEGIQAVAFNVTHKHEIDAAVEH
FABG_RICTY      -------------------------LHKLGSKVIISGSNEKKLKLLGNTLKDNYIIEVCNLEECNNLISK
FABG_BUCBP      MKTTKKIAVITGANRG-LGKGIAEELSNTNNTVIGTSTSQKGCKIINKYLKNNGILDITNPNEITKTM-D
BDHA_RALEH      ----------------------------------------------------------------------
RDHE2_HUMAN     -------------------------------------------------------------------VAD
MAS1_AGRT9      -VIQSPVVMVSGVTRG-IGKAIAEDLIRHGYRVSLGARNIQDLVAAF--GDENEALHYARFDALDHSMKD
DHI1_CAVPO      -----KKVIVTGASKG-IGREIAYHLAKMGAHVVVTARSK---EALQKVVARCLELGAASAHYIAGSMED
DHB13_MOUSE     -----QTVLITGAGHG-IGRLTAYEFAKQKSRLVLWDINKRGVEETADKCVHVFVVDCSNRAEIYNSV-D
LINC_PSEPA      --------------------------------------------------------DIAQEEDVKALVAQ
FABG_RICBR      -------------------------LHKLGSHVIISGSNEEKLKALGNDLKDNYTIKVTNTEECSNLVAQ
FABG_CHLMU      ----NKAAIVTGGSRG-IGFGIAVQIWGINEEAGKSAAQDLSDKTGSKVSFA--LVDVSKNDMVSAQVQK
DHI2_RAT        ----TRAVLITGCDTG-FGKETAKKLDAMGFTVLATVLDLNGPGALELRALKLLQMDLTKPEDISRVLEI
YF3H_SCHPO      ----------------GIGHAICSVFAEAGANAFITTPGEKAAKEIAQNGVKTYTCDVTIPKEVEHAFAE
FOX2_NEUCR      ---------------------------------------------------------VANYDSVENGIIE
DS7CA_DANRE     ------------------------------------------------------LLDFSDMENISDVVSE
DHB11_MOUSE     -------VLITGAGHG-IGRLTAYEFAKLNTKLVLWDINKNGIEETAAKQAHPFVVDCSQREEIYSAAKK
CBR1_MOUSE      MSSSRPVALVTGANKG-IGFAITRDLKFSGDVVLAARRGQTAVQKLQAEGLSPHQLDIDNPQSI-RALRD
RDH1_BOVIN      -------IFITGCD-SGFGRLLALRLDQRGFRVLASCLTPEDLQRVASSRLHTTLLDVTDPQSIRQAVKW
HSD_STREX       --------------------------------------------------------DAARYQHLDVTIEE
DHI1B_XENLA     -----KRVLITGSSTG-LGEQIAYEFARMGAHIMITARRLQQLQEVASQCMKLVASDMGNLESAQSVAQE
DHB4_MOUSE      ---------------------------------------------------------VANYDSVEEKLVK
DHB13_RAT       -----QTVLITGAGHG-IGRLTAYEFAKQKSRLVLWDISKHGVEETAAKCVHVFVVDCSNRAEIYKSV-D
DHB11_MACFA     -------VLITGAGHG-IGRLTAYEFAKLKSKLVLWDINKHGLEETAAKKVYTFVVDCSNREDIYSSAKK
FABG_CHLTR      ----NKTAIVTGGSRG-IGFSIAVQIWGINGEAGQAAAQTLSEQTGRQVSFA--LVDVSKNDMVSAQVQN
DHB13_HUMAN     -------VLITGAGHG-IGRQTTYEFAKRQSILVLWDINKRGVEETAAETAHAYVVDCSNREEIYRSLNQ
BAIA2_EUBSP     --------------------------------IFGETQEEVDTELYPEEEVLGFAPDLTSRDAVMAAVGQ
ADH2_CERRO      ---SGKNVIFVG-GLGFIGYEACKQLKNMASFVFDVLDKPEDIKALQALNPKTKVFDITSKQSIKSALAD
ADH2_CERCO      ---SGKNVIFVG-GLGFIGYEACKQLKNMASFVFDVLDKPEDIKALQALNPKTKVFDITSKQSIKSALAD
DHK1_STRVN      -------------------------------------RLAQTVKELRGEGFDVTVCDVADPAQIRAYVAA
DHB4_RAT        -----------------------------------SSAADKVVEEIRRRGGKA----VANYDSVEEKLVK
RHLG_PSEAE      --------LVTGGSRG-IGQMIAQGLLEAGARVFICAR---DAEALSAYGDCQAIPADLSSEAGARRLAQ
DHSO_RHOSH      ---DGKTALITGSARG-IGRAFAEAYVREGARVAIALEAARXXXXXXXXXXXXXXLDVTDQASIDRCVAE
DHRS4_MOUSE     ---SNKVALVTA-STDGIGFAIARRLAEDGAHVVVSSRKQQNVDTLQGEGLSVIVCHVGKAEDREKLITT
DHI1_SHEEP      -----KRVIVTGASKG-IGREMAYHLARMGAHVVVTARSEESLKKVVSRCLELGAASMENMTFAEQFVAK
SDH_AGRT5       ----SGTILITGAT-SGFGQATARRFVKEGWKVIGTGXXXXXXXXXXXQAFHGIAFDITDEDATEKALA-
LIMC_RHOER      ---------------------TAKDVENLGRKAIVIHADVRDLESLTAE--------------VDRAVST
NODG_RHIS3      --------LVTGAS-GGIGEAIARVLHAQGAIVGLHGTRVEKLETLAAELGDRVKLFPANLSNRDEALGQ
DHB4_HUMAN      -----------------------------------SLAADKVVEEIRRRGGKA----VANYDSVEEG--E
YCP8_SCHPO      MSTTNKIYFIAG-GNRGIGLSLVKELSNRGTVVFASARKPGAATKLSHSNVHIIKLDVSSLESANEAAQE
Y0585_STAHJ     -------------------------LEKQGVKVVLAGRSHDKLNTLAKDMNEDNITDVTNQVEVDALVAK
DHB11_RAT       -------VLITGAGHG-IGRLTAYEFAKLNTKLVLWDINKNGIEETAAKQVHPFVVDCSQREEIYSAVRK
BAIA1_EUBSP     --------------------------------IFGETQEEVDTELYPEEEVLGFAPDLTSRDAVMAAVGT
ADH1_CERCA      ---------------GGLGFIAYEACKYLMNNVFDVLDKPEAIKALQEINPKTKVFDITNKESIKQSLAD
YAY8_SCHPO      -----KTLLTGGDS--GIGKAAAVMFAREGSDLVISCEERDDAEVIEREGRNCWIWE-GKLDKSDNCLVD
RDHE2_MOUSE     -------------------------------------------------------------------VAD
DHI2_MOUSE      ----TRAVLITGCDTG-FGKETAKKLDAMGFTVLATVLDLNSPGALELRDLKLLQMDLTKAEDISRVLEI
DHG_BACSU       -----KVVAITGAA-SGLGKAMAIRFGKEQAKVYSNKQDPNEVEEVIKAGGEAVVVDVTKEEDVKNIVQT
DHG_BACME       -----KVVVITGSSTG-LGKSMAIRFATEKAKVVVNYRSKEDLEEIKKVGGEAIAVDVTVESDVINLVQS
DHG2_BACSU      -----KTAIVTGSSKG-IGKAIAERFGKEKMNVVVNYHSDETLEIIKQNGGKAVSVDVSKEEGIQ-ALLD
DHG2_BACME      -----KVVVVTGGSKG-LGRAMAVRFGQEQSKVVVNYRSNXXXXXXXXXGGQAIIVDVTKEEDVVN-LVE
YHXC_BACSU      -----KTAIITG-GDSGIGRAVSVLFAKEGANVIVYLNEHQDAEETKQEGVKCLLIDVGDEAFCNDVVGQ
YHDF_BACSU      -----KVAIITG-GDSGIGRAAAIAFAKEGADIILYLDEHSDAEEIEKENVRCLLIDVGDENHCEQAVQQ
S16C6_BOVIN     -------VLITGAA-SGLGRLLAIKFASLGALVLWDINEEGNMETCRIIKEEAYTCDCSNRQDVYR-VAD
GRDH_ORYSJ      -----KVAIVTG-GDSGIGRAVCLCFALEGATVYVKGQEEKDAEETARTGAKDPMAIPADLGYDDNCVDE
EPHD_MYCTU      -------VSVTGAG-SGIGRETALAFAREGAEIVISDIDEATVKDTAAEGIAPYVLDVSDAEAVE-AFAE
EPHD_MYCBO      -------VSVTGAG-SGIGRETALAFAREGAEIVISDIDEATVKDTAAEGIAPYVLDVSDAEAVE-AFAE
DHI1L_DANRE     -------VLVTGASTG-IGEQLAYHYARLGAQIVITARRGNVLEQVAQKAF--YIADMANPSDADLVVKY
YOHF_ECOLI      -------VAIITASDSGIGKECALLLAQQGFDIGITWHSDEEAREVVSHGVRAEIVQLDLGNLPEGALAE
DHG1_BACME      -----KVVVITGSSTG-LGKAMAIRFATEKAKVVVNYRSKEELEEIKKVGGEAIAVDVTVESDVINLVQS
CBR4_BOVIN      ----------------GIGRAVARLMAQRGYRLAIVARNXXXXXXXXXXXXXXXXXDVAKEHDVQNTFEE
DS7CB_DANRE     ----NKVVLITD-SLSTVGNECAKLFHAGGARLILCGSNWEKLEALAEQTFPPKLVDFSDMESVPEVISE
Y182_METEA      ----------------------------------------------------------------------
TSC10_NEUCR     -----RTVLLTGASEG-MGRSAAIQLSQKGANVILVSRNVGRLEEASTQRFTYISADVSEHDYAAAVLAE
PGDH_CAVPO      ---NGKVALVTGAAQG-IGRAFAEGLLHKGAKVALNLEAGVKCKAALDEEFETLFIDVADQEQLRDTFTK
DCXR_CAEEL      -----KRILVTGASQG-IGKEICLSLAKAGAQVIAFARNEANLLSLVKE--------TTSLRY---TIIP
CBR1_PIG        MSSNTRVALVTGANKG-IGFAIVRDLQFAGDVVLTAARGQAAVKQLQAEGLSPHQLDIIDLQSI-RALCD
CBR1_MACFA      MKSGIRVALVTG-SNKGIGLAIVRDLCRLGEVVLTAARGQAAVQQLQAEGLSPHQLDIDDLQSI-RTLRD
BDH2_HUMAN      -----------------------------GAKVIATDINESKLQELEKPGIQTRVLDVTKKKQIDQFANE
Y1570_MYCBO     -----------------------------------------DIRAIRGNGAHVYPCDLSDMDAIAVMADQ
Y1543_MYCTU     -----------------------------------------DIRAIRGNGAHVYPCDLSDMDAIAVMADQ
HETN_ANASP      --------------------------------------------------------DVRNTSQL-SALVQ
HDHA_ECOLI      ------------------------------------------VDEIQQLGGQAFACDITSEQEL-SALAD
HDHA_ECO57      ------------------------------------------VDEIQQLGGQAFACDITSEQEL-SALAD
FABG_SALTY      -----KIALVTGASRG-IGRAIAETLVARGAKVIGTATSENGAKNISDANGKGLMLNVTDPASIESVLEN
FABG_SALTI      -----KIALVTGASRG-IGRAIAETLVARGAKVIGTATSENGAKNISDANGKGLMLNVTDPASIESVLEN
DHB12_MACFA     ----------------GIGKSYAEELAKRGMKVVLISRSQDKLDQVSSEIKEKFKVE-TRTIAVDFTLED
CBR1_PONAB      MSSGMHVALVTG-GNKGIGLAIVRDLCRLGDVVLTAARGQAAVQQLQAEGLSPHQLDIDDLQSI-RALRD
S16C6_MOUSE     ---SGEIVLITGAG-SGLGRLLAIHFASHGATVLWDINQEGNMETVKQKG------DVKVFAYKCDCVAD
MFEA_DICDI      ---------------------------------------------------------VANYDSVEDGIVQ
FABG5_BRANA     ----------TGASRG-IGKAIALSLGKAGCKVLVNARSAKEAEEVSKQIEETFGGDVSKEADVDSMMKT
FIXR_BRAJA      -----KVMLLTGASRG-IGHATAKLFSEAGWRIISCARQPFDGERCPWENDDHFQVDLGDHRMLPRAITE
DHRS4_PIG       ----NKVALVTA-STDGIGLAIARRLAQDGAHVVVSSRKQENVDTLQGEGLSVTVCHVGKAEDRERLVAM
DHG3_BACME      -----KVVVITGGSTG-LGRAMAVRFGQEEAKVVINYYNNEE-EALDEAGGQAIIVDVTKEEDVVNLVQT
DHB12_HUMAN     --------VVTG-STDGIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEIKEKFKVE-TRTIAVDFASED
YTKK_BACSU      --------LITAGSKG-LGRKVTETLLAKGYSVTVNYRQDEEAVSRLKEACPDCLDDVTKKEDLLRIAEA
YCIK_ECOLI      ---NDRIILVTGASDG-IGREAAMTYARYGATVILLGRNEEKLRQVASHINEEFILDLLTCTSENQQLAQ
DHRS4_RAT       ----NKVALVTA-STDGIGLAIARRLAEDGAHVVISSRKQQNVDTLQGEGLSTGVVCHVGKAEDREKLVN
YMFI_BACSU      ----NKTALITGAS-GGIGKSISETLAARGYNLLAAAELAEKLSQMFGVNAEILQADLSAQDGADKLTSS
YJDA_BACSU      --SQEKIALITGASQGDIGTAICRKLASQGIHIFFTHWNSDTIEEFQQEILEAMKIDLSDAHAAFTIHEK
Y5909_MYXXD     ----------------------------------------------------------------------
DHI1L_CHICK     -------VLLTGAS-AGIGEQMAYHYATFGAEIVLTARR----EAVLQEVMKKCLTDMSSPSEPDRVVQF
DHGA_BACME      -----KVVVITGGSTG-LGRAMAVRFGQEEAKVVINYYNNEE-EALDEAGGQAIIVDVTKEEDVVNLVQT
DHG4_BACME      -----KVVVITGGSTG-LGRAMAVRFGQEEAKVVINYYNNEE-EALDEAGGQAIIVDVTKEEDVVNLVQT
DHB12_MOUSE     ----------------GIGKAYAEELAKRGMKIVLISRSQDKLNQVSNNIKEKFNVE-TRTIAVDFSLDD
HCDS_XANP2      --------------------------------------------------------DVTDEAAITAAMAG
DHB12_RAT       ----------------GIGKSYAEELAKRGMKIVLISRSQDKLKEVSNNIKEKFNVE-TRTIAVDFSLDD
CBR1_HUMAN      --------LVTG-GNKGIGLAIVRDLCRLGDVVLTATRGQAAVQQLQAEGLSPHQLDIDDLQSI-RALRD
BDH2_BOVIN      -------------------------------------------------GIHTRVLDVTKKKQIDQFAND
PGDH_MOUSE      ---NGKVALVTGAAQG-IGKAFAEALLLHGAKVALNLEAGVKCKAALDEQFETLFVDVADQKQLRDTFRK
DHI2_RABIT      ----TRAVLITGCD-SGFGKETAKKLDAMGFTVLATVLEMNELRACCSPRLKLLQMDLTKPADISRALEF
ADH2_CERCA      ---SGKNVIFVG-GLGFIGYEACKQLKNMASFVFDVLDKPENIKALQALNPKTKVFDITSKQSIKSALAD
YLX6_SCHPO      MTVEGRVVLITGAA-GGIGKVLCKMFTELGDRVAGI-----DIVDPSQDAALALQADVSKADQIETAIEK
FABG_CHLPN      -----KKVIVTGGSRGGLGIVKLFLENGADVEIWGEERGQAVIESLTGLGGEVSFVDVSHNGGVKDCVQK
ADH_BACOL       ---SGKNVVFVG-GLGFIGYEACKQIKNVASDVLENAENIKALQAINPKTKVYYTFDITNKASIKSAFAD
ADH1_CERCO      ---------------GGLGFIGYEACKTLITRVFDILDKPEAVKALEEINPKTKVFDITSKDNIKQSLAD
FABG2_BRANA     ----------TGASRG-IGKAIALSLGKAGCKVLVNARSAKEAEQVSKQ-IEAYGGQAITFDVSKEADVD
DLTE_BACSU      MTNN--TVLITGGS-AGIGLELAKRLLELGNEVIICGRSEARLAEAKQQNIHTKQCDVADRSQRE-ALYE
VER1_ASPPA      ---------------------------------YAHSREEKVVEQIKANGTDAIAIDVGDPEATAKLMAE
THR1_GLOLA      -----KVALVTGAGRG-IGREMAMELGRRGAKVIVNYANSAEVQAIKKSGSDAASINVSDVDQIVKMFGE
YD114_YEAST     ILSKNATALITGGS-SGLGFELAKELSRRINKVIVADIQSFPTFAVEYNNIFYYQCDITSLDEIKN-LKK
T4HR_MAGGR      -----KVALVTGAGRG-IGREMAMELGRRGCKVYANSTESAEVAAIKKNGSDAACVNVGVVEDIVRMFEE
DHGB_BACME      -----KVVVITGSSTG-LGKSMAIRFATEKAKVVVNYRSKEDEEEIKKVGGEAIAVDVTVESDVINLVQS
Y4VI_RHISN      ------------------------------------------------------------------ALRA
TSC10_CRYNE     -----KHCYITGGS-SGLGKALAERLVKQGAHVTIVGRDSKKAEGVVEELIQCIAADLTSPIASTNAIAA
DR4L2_HUMAN     ----NKVALVTA-STDGIGFAIARRLAQDRAHVVVSSRKQQNVEGLSVTGTVCHVGKAEDRE----RLVA
TSC10_YARLI     ----------------------------------------------------------------------
TRNH1_ARATH     ----AKTVLVTGGTKG-IGHAIVEEFAGFGAVIHTCARNEYELECLSKKGFQVTVCDASLRPEREKLMQT
SDR2_ARATH      --------IVTG-GNRGIGFEICRQLANKGIRVILTSRDEKQVETLKKESIVFHQLDVSDPVSV-TSLAE
FABG3_BRANA     ----------TGASRG-IGKAIALSLGKAGCKVLVNARSAKEAEEVSKQ-IEAYGGQAITFGGDVSKEAD
FABG1_BRANA     ----------TGASRG-IGKAIALSLGKAGCKVLVNARSAKEAEEVSKQ-IEAYGGQAITFGGDVSKEAD
YB45_SCHPO      -----KVILLTGSSKG-IGLATAEALQKKAKVIAVSRSLTPELETLLIQNPDSFVHVKGDVTEVGKASIE
PHBB_CHRVI      -------------------------------------------------GFDVFTADVSSFDDSARMVRE
PGDH_MACFA      ----------------------------------------------------------------------
PGDH_HUMAN      ----------------------------------------------------------------------
FABI_HELPJ      -LKGKKGLIVGVANNKSIAYGIAQSCFNQGATLYLNESLEKRVRPIAQELNSPYVLDVSKEEHF-KSLYN
YQC8_SCHPO      ----------------GIGFSIATAFAQAGGNVYLTTDPTEKAKKLAEETVHTLKIDISRSDTVEAGVEE
FABI_HELPY      -LKGKKGLIVGVANNKSIAYGIAQSCFNQGATLYLNESLEKRVRPIAQELNSPYVLDVSKEEHF-KSLYN
CBR1_RAT        MSSDRPVALVTGANKG-IGFAIVRDLKFLGDVVLTARDESRGHEAVKQEGLSPHQLDIDNPQSI-RALRD
MTDH_AGABI      ----NKTIIVTG-GNRGIGLAFTRXXXXXXXXXXXIYRSAKDVEVTEKVGKEAYQCDVSNTDIVTKTIQQ
KDUD_DICD3      -----KVALITGCDTG-LGQGMAVGLAEAGCDIVGVVEPKETIEKVTAVGFLSLTADMSDISLVEKAVAE
DHI2_HUMAN      ----TRAVLITGCD-SGFGKETAKKLDSMGFTVLATVLELNSPGAIESPRLRLLQMDLTKPGDISRVLEF
DHI1L_HUMAN     -------VLLTG-ANAGVGEELAYHYARLGSHLVLTAHTQKVVGNCRKLGAPKVFYDMASPEAPESVVQF
Y019_THEMA      -------------------------------------------EMLRERGLDVTFVDVADENSVKNMVRK
PGDH_BOVIN      --------------------------------------------------------DVADQEQLRDTFRK
DHB12_ANAPL     --------VVTGATDG-IGKAYAKELAKRGMKVALISRSKEKLDQVAGEITEQYGVETKVIVADFGERED
CBR1_BOVIN      MSSSNCVALVTGANKG-IGFVIVRDLRFSGDVVLTAARGRAAVQQLQAEGLSPHQLDIDDRQSI-RALRD
S16C6_HUMAN     --NVAGEIVLTTGAGSGLGRQLAIYFARFGALVLWDVNQEGNMETCKEKGGKKYTCDCSNRQEVYR-VAD
MKAR_MALGO      --------LVTGATDG-IGREFAMQLAARGFNIVAVSRTAEKLAILSKEIESTMPGIKTCYYAMDNAEYE
HSDL1_CHICK     --------VVTG-STDGIGKAYAEELAKRGVNIILISRSKEKLEAVSRSISETYKVETEAYQAIKEGLKD
FABI_RICPR      --------LITGIANNSISWAIAQLAKKHGAELYQSEVLEKRVKPLAEEIGCNFILDVTNQKSISNLFND
FABG4_BRANA     ----------------GIGKAIALSLGKAGCKVLVNARSAKEAEEVSKQIEETFGGDVSKEADVDAMMKT
ENTA_ECOLI      ---SGKNVWVTGAGKG-IGYATALAFVEAGAKVFDQAFTQE------QYPFATEXXXXXXXXXXXXXCQR
DHI1L_BOVIN     -------VLLTGVS-AGIGEELAYHYARLGSHLVLTAH----TEALLQQVVKVFYIDMASPEVPERVVQF
CSGA_MYXXA      ----------------------------------------------------------------------
YDFG_DICNO      -------VLITGAS-SGFGWEAAKLCVAKGHRVIGCARRTERLQALQKEAFFPLPFDIADADAL-NAAFE
RD10B_DANRE     ---------------------------------------------LLQPKVYTYMCDVSKRESV-YLTAE
DHI1L_MACFA     -------VLLTGAS-AGVGEELAYHYARLGSHLVLTAHTQKVVGNCRKLGAPKVFYDMASPEAPESVVQF
YWFH_BACSU      ---SKRTAFVMGASQG-IGKAIALKLADQHFSLVINSRNLDNIESVKEDILEASVIVLAGDMSDQHTRAG
RD10A_DANRE     ----------------------------------------------------TYVLDVGKRESVYST-AE
NODG_RHIME      ----------------------------------------------------------------------
TSC10_EMENI     -----QTVVITGGSEG-MGKAVACQLAQKGANIVIVARTLQKLEEVNKQRFHYISADLTKPEECERIMTE
STCU_EMENI      ---------------------------------YANSREEKVVDEIKSNGSDAISIDVGDPDAVTK-LMD
FABI_RICBR      --------IITGIANNSISWAIAQLARKHGAELYQSEILEKRVKPLAEEVGCNFVLDVTNPESITNLFAE
DH12A_DANRE     -----KWAVVTGATDG-IGKSYAEELARRGFSMMLISRSQEKLDDVAKSLESTYKVE-TKTIAVDFSQID
YVAG_BACSU      -----KTALVTG-STSGIGKAIASSLAEEGAAVIINGRREEKVNQTIDE-LKTQHAEAVLYP----AAFD
SPS19_YEAST     -------------------------------------------------------VDVRNFEQVENAVKK
PECR_PONAB      ----------------GIGKAIVKELLELGSNVVIASRKQANLPPTKQARVIPIQCNIRNEEEVNNLVKS
FABG_ACTAC      ----SETILITGSSRG-IGKAIALRLAQAGFDIVVHCRSRXXXXXLGQNARVLQFDVSCRSEAADKLTAD
DHB8_HUMAN      ----SALALVTGAG-SGIGRAVSVRLAGEGATVAACAAAQETVRLLSKEGHAAFQADVSEARAARCLLEQ
DHB14_BOVIN     ------------------------------------------------------LCDVTREEDVRTLVSE
UXUB_BACSU      -----KTAVITGGS-GVLCSAMARELARHGMKVAILNRTAEKGQAVVKEXXXXXXXDVLDRMSLERAKED
RDH10_RAT       ----------------------------------------------------TYTCDVGKRENV-YLTAE
RDH10_MOUSE     ----------------------------------------------------TYTCDVGKRENV-YLTAE
RDH10_HUMAN     ----------------------------------------------------TYTCDVGKRENV-YLTAE
RDH10_BOVIN     ----------------------------------------------------TYTCDVGKRENV-YLTAE
HCD2_DROME      MIKNAVSLVTGGAS--GLGRATAERLAKQGASVIADLPSSKGNEVAKELGDKVVFVDVTSEKDVSAALQT
YJCD_SCHPO      -----KVALVTGSS-GGIGYVTALELARKGAKVYLAGRNEEKYQKVMKQKIRFLRLDLLDFESVYQAAES
SRLD_ECOLI      ------------------------------------------------------------------ALSR
YJGI_ECOLI      -----KTVLILGGSRG-IGAAIVRRFVTDGANVFTYAGSKDAAKRLAQEGATAVFTDSADRD----AVID
YHXD_BACSU      ----------------------------------------------------------------------
XYLL_PSEPU      -----KVAVITGAAQG-IGRRVAERMAAEGGRLLLVDRSEL-IHELADEEVLTLTADLEQFAECQRVMAA
DHRS1_MOUSE     --------VVTGASRG-IGRGIALQLCKAGATVYITGRHLDTLRATAQEAQSPVVCDSSQESEVKSLFEQ
DECR2_DANRE     ---SDQVAFITG-GGSGIGFRIAEVLMRHGCDTVIASRNLEKISQAAKKLTSTIAMDVRQPETILAAVDE
RDH10_XENTR     ----------------------------------------------------TYTCDVGKRESVYST-AE
RD10B_XENLA     ----------------------------------------------------TYTCDVGKRESVYST-AE
MTDH_ALTAL      -----KVVIVTGASGPGIGTEAARGCAEYGSRAEGAEKNAKEMSEKYGVKVKAYKCQVNEYAQCEKLVQD
MNR1_CAPAN      ---STRYAVVTG-GNKGIGYETCRQLASKGVVVVLTSRDEKKIERLKEESNFTHQLDIMDPASI-SSLVN
Y7799_EMENI     -------IFITGSSDG-IGQAAAKVLSEQGHSVVLHAR-NADRAASAQEGAEAVLVGDLSSIAETKALAE
Y4MP_RHISN      MLLKGKTAVISGASKRGIGRATAELFASHGARVAAAAGDLPPVEHGAHIGLRC---DVADRASCTSASDE
Y1430_HAEIN     ----------------------------------------------------------------------
RD10A_XENLA     ----------------------------------------------------TYTCDVGKRESVYST-AE
PECR_RAT        --------------------------------------------------------NIRKEEEVNNLVKS
KDUD_ECOLI      ---------------------------------------------------------------LDRAVAE
DHRS4_PONAB     ----NKVALVTA-STDGIGFAIARRLAQDGAHVVVSSRKQQNVDTLQGEGLSVTVCHVGKAEDRERLVAT
DHR12_BOVIN     -----RAFMVTG-GNSGIGKATAMEIAKRGGTVHLVCRDHSKAEIIRESGNQNIFLHIVDLSLPKSVWKF
DHB3_RAT        --------VITGAGDG-IGKAYSFELARHGLNVVLISRTLEKLQVISEEIERTTRVKVVQADFTREDIYD
PECR_HUMAN      ----------------GIGKAIVKELLELGSNVVIASRKQANLPPTKQARVIPIQCNIRNEEEVNNLVKS
HSDL2_HUMAN     ------------------------HPKLLG-TIYTAA---EEIEAVGGKALPC-IVDVRDEQQISAAVEK
HDHA_CLOSO      ----NKVALVTSATRG-IGLASAIKLAQNGAIVYMGVRRQEICDKYKEEGFDAYNIDIYK------EMID
FABI_RICFE      --------LITGIANNSISWAIAQLAKKHGAELYQSEVLEKRVKPLAEEIGCNFVLDVTNPKSISNLFDD
BZRD_BACSU      --------IITGASKG-LGQAIALQALEKGHEVHALSRTKTDV---SHKKLTQHQIDLINLEEAEQQFET
SOU1_SCHPO      ---------------------------------------------------KAYSCPIENRSAVIETTNQ
MFNA_META3      -------------------HKTTVIMPETAHFSFEKAREMMDLNLITPPLTKYYTMDL---KYINDFIED
ILVC_GEOKA      -----KTVAIIG--YGSQGHAHAQNLRDSGVRVIVGLRKGKSWEQAEQDGFEVYSV--------------
DHRS4_HUMAN     ----NKVALVTA-STDGIGFAIARRLAQDGAHVVVSSRKQQNVDTLQGEGLSVTVCHVGKAEDRERLVAT
STDH2_CAEEL     --------VVTGATDG-IGKSYSFELARRGFNVYIVSRTQSKLEQTKKDRFATYDFSVTDYEKLLSKLNE
PTMA_CAMCO      ----NKIIFVAGAC-GRIGKALCKKLQNKGIAILADINEKTELENEFKKELLSLRLDITSKESLNCAIDQ
FABG_ARATH      ------------------------------------ARSAKEAEEVAKQIEETFGGDVSKATDVDAMMKT
DHB3_MOUSE      --------VITGAGDG-IGKAYSFELARHGLNVVLISRTLEKLQTIAEEGVKIVQADFTREDIYDHIKEH
ADHR_DROIM      ----------------------------------------------------------------------
SDR1_PICAB      -------------------------------------------------------------------LFD
ILVC_LACLS      -----KKIAVIG--YGSQGHAHAQNLRDSGHDVIIGVRQGKSFDRAKEDGFETF----------------
ILVC_LACLM      -----KKIAVIG--YGSQGHAHAQNLRDSGHDVIIGVRQGKSFDKAKEDGFETF----------------
FABG_RICCN      ----------------------------LGSHVIISGSNEEKLQSLGKVVKDNYTIEVCNLA--DKEECR
CAPD_RICB8      -----KTLLITGGT-GSFGNAVLSRIKDIKERIFSDEKKQEDMRALNNPKIKFYIGDVRNYNSIDDAMKD
ILVC_STRSV      ---DGKKIAVIG--YGSQGHAHAQNLRDTGHDVIIGVRPGKSFDKAKEDGFDTYTV--------------
ILVC_STRGC      ---DGKKIAVIG--YGSQGHAHAQNLRDTGHDVIIGVRPGKSFDKAKEDGFDTYTV--------------
HSDL2_PONAB     ------------------------HPKLLG-TIYTAA---EEIEAVGGKALPC-IVDVRDEQQINAAVEK
DHR12_HUMAN     -----RVFLVTG-GNSGIGKATALEIAKRGGTVHLVCRDQAPAEIIRESGNQNHIVDLSDWKFVENF---
ADH_ZAPTU       ---NKNVIFVAGL--GGIGLDTSREIVKAGPKNLVILDRVENPAAIAELQAINPKVTVTFYPYDVTVLKT
ADH2_DROWH      VIANKNIIFVAGL--GGIGFDTSREIVKSGPKNLVILDRIENPAAIAELKALNPKVTVTFYPYTTKLLKT
Y3820_MYCBO     -VGNPQTVLLLGGT-SEIGLAICEYLHNSAARIVLACRREDXXXXMKQAGARS--VELIDFDALDTDSHP
Y3791_MYCTU     -VGNPQTVLLLGGT-SEIGLAICEYLHNSAARIVLACRREDXXXXMKQAGARS--VELIDFDALDTDSHP
MKAR_YARLI      --------VVTGASDG-IGKEYARQLGLRGFNVFLISRTESKLRELAQEIAEKLAIDVSNYKDIETVL--
LE767_CAEBR     --------VITGATDG-IGKAYAFELARRGFNVFIVSRTQSKLDETKKEILEKYEVRTAAYDFTNAALLE
ADHR_DROTE      --------------------------------------QLQSIKPSTQIFFWTYDVTMAREEYFDEVMVQ
ADHR_DROMA      --------------------------------------QLQSIKPSTQIFFWTYDVTMAREEYFDEVMVQ


                         .         .         *         .         .         .         .:140
query           ILNKTGGSLDVIFNNAGYGQAGALEDIDTKFLKQQFETNVFGLHNLTYKALKIMRKQGYGKIIQHSSVLG
YBBO_ECOLI      VIALTDNCLYGIFNNAGFGMYGPLSTISRAQMEQQFSANFFGAHQLTMRLLPAMLPHGEGRIVMTSSVMG
YBBO_ECOL6      VIALTDNCLYGIFNNAGFGMYGPLSTISRAQMEQQFSANFFGAHQLTMRLLPAMLPHGEGRIVMTSSVMG
VDLC_HELPY      VFSNISAKCDVLINSAGYGVFGSVEDTPIEEVKKQFSVNFFALCEVVQFCLPLLKNKPHSKIFNLSSIAG
VDLC_HELPJ      ISAKED-HCDVLINSAGYGVFGSVEDTPIEEVKKQFSVNFFALCEVVQLCLPLLKNKPYSKIFNLSSIAG
YUSZ_BACSU      V--SAYAPIDLLVNNAGTAYGGFIEDVPMEHFRQQFETNVFGVIHVTKTVLPYIRKHGGAKIINVSSISG
YQ53_SCHPO      AKRRFG-NVDIVINNAGYGLVGEFESYNIEEMHRQMNVNFWGVAYITKEALNLMRESGKGRILQISSVAG
RDH8_HUMAN      CLSCIQGEVDVLVNNAGMGLVGPLEGLSLAAMQNVFDTNFFGAVRLVKAVLPGMKRRRQGHIVVISSVMG
YAEB_SCHPO      VRKFTNGSLHYLINNAGAPCSAPAIDLDIEDVSKVMDVNFYGVIRMN-KAFQHQLIRAKGTIVNVNSLVS
YQJQ_BACSU      I-----GSIDVLINNAGFGIFETVLDSTLDDMKAMFDVNVFGLIACTKAVLPQMLEQKKGHIINIASQAG
H17B6_RAT       VKEHVGDKLWGLVNNAGVFQAFAIEWCRPEDCMSIFQVNLIGLAQVTLSMLFLVKK-ARGRIVNVSSVLG
YXJF_BACSU      VIQKQYGRLDILVNNAGIQHVAPIEEFPTDTFEQLIKVMLTAPFIAMKHVFPIMKKQQFGRIINIASVNG
DRS7B_DANRE     IL-KRHGHVDVLINIAGVSYRGNILDTHVSVQREVMETNYFGPVALTQAILPSMVDRGSGHIVVISSVQG
RDH8_BOVIN      CLNCIGGEXXXXXXXXXXXXXXXXEGLSLAAMQNVFDTNFFGAVRLVKAVLPSMKRRRQGHIVVVSSVMG
BDH_MOUSE       ILKDPEKGMWGLVNNAGISTFGEVEFTSMETYKEVAEVNLWGTVRTTKSFLPLLRR-AKGRVVNISSMLG
AYR1_YEAST      LANLPDGKLDLLYNNAGQSCTFPALDATDAAVEQCFKVNVFGHINMCRELSEFLIK-AKGTIVFTGSLAG
DRS7B_XENTR     ILHLTG-RVDILINNAGISYRGTILDTKVSVDRMVMDTNYFGPVALTKALIPSMIKNRRGHIVVISSVQG
BDHA_RHIME      VADRFGGA-DILVNNAGVQFVEKIEDFPVEQWDRIIAVNLSSSFHTIRGAIPPMKKKGWGRIINIASAHG
BACC2_BACSU     AVDKFGG-LDVLINNAGIEIVAPIHEMELSNWNKVLNVNLTGMFLMSKHALKYMLKSGKGNIINTCSVGG
DRS7B_MOUSE     IL-QCFGYVDVLINNAGISYRGTISDTIVDVDRKVMEINYFGPVALTKALLPSMVERKQGHIVAISSIQG
DRS7B_XENLA     ILH-LAGRVDILINNAGISYRGTILDTKVSVDRMVMDTNYFGPVALTKALLPSMIKNRRGHVVVISSVQG
BDH_RAT         VLKDPEKGMWGLVNNAGISTFGEVEFTSMETYKEVAEVNLWGTVRTTKSFLPLLRR-AKGRVVNISSMLG
DHB1_RAT        V---TEGRVDVLVCNAGRGLFGPLEAHELNAVGAVLDVNVLGTIRMLQAFLPDMKRRHSGRVLVTASVGG
Y2778_STAA8     IAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMLEQSSGHLINIASISG
Y2488_STAAC     IAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMLEQSSGHLINIASISG
Y2422_STAA3     IAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMLEQSSGHLINIASISG
DHRS9_RAT       VKSHVGEKLWGLINNAGVGVLAPTDWLTVDDYREPIEVNLFGLINVTLNMLPLVKK-ARGRVINVSSIGG
DHRS7_ANOGA     XXXXXGGAIDILVNNGGISVRGALSDVDIRIML----VNYFGSVALTKACLPSMMARKEGRIVSISSVQG
Y2403_STAAW     IAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTVQAALPTMLEQSSGHLINIASISG
Y2370_STAAS     IAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTVQAALPTMLEQSSGHLINIASISG
DHRS7_HUMAN     VLQEFG-RIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSILG
BDH_BOVIN       ILEDPEKGLWGLVNNAGISTFGDVEFTSMETYKEVAEVNLWGTVRVTKAFLPLIRR-AKGRVVNISSMMG
H17B6_MOUSE     VKERVGDGLWGLVNNAGVLQPFAIEWYRPEDYMPIFQVNLIGLTQVTISMLFLVKK-ARGRIVNVSSALG
DHB1_HUMAN      V---TEGRVDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGG
DRS7B_PONAB     IL-QCFGYVDILVNNAGISYRGTIMDTTVDVDKRVMETNYFGPVALTKALLPSMIKRRQGHIVAISSIQG
DHB1_PANTR      V---TEGRVDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRVLQAFLPDMKRRGSGRVLVTGSVGG
DRS7B_HUMAN     IL-QCFGYVDILVNNAGISYRGTIMDTTVDVDKRVMETNYFGPVALTKALLPSMIKRRQGHIVAISSIQG
DR9C7_MOUSE     VRDQVGEQLWALVNNAGVGPSGPNEWLTIKDFVKVININLVGLIDVTLNMLPMIKK-ARGRVVNMSSSGG
Y2478_STAAM     IAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMLEQSSGHLINIASISG
Y2266_STAAN     IAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMLEQSSGHLINIASISG
DRS7B_BOVIN     IL-QCFGHVDVLINNAGISYRGAIVDTSPDVDKRVMETNYFGPVALTKALLPAMIRRRQGHVVAISSIQG
DHRS9_BOVIN     VKNQVGEKLWGLINNAGILGVLAPNDLTVEDYREPVEVNLFGLISVTLNMLPLVKK-ARGRIINVSSIGG
YI78_SCHPO      AISHFG-RIDVLLNNAGYSVYSPLESTTEEQIHNIFNTNVFGALEVIKAITPIFRSQHNGMIINVSSIGG
DHRS9_HUMAN     VKNQVGEKLWGLINNAGVGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKK-AQGRVINVSSVGG
TRN1_DATST      VFD---GKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGNVIFLSSIAG
DHRS7_DROME     VL-AVYNQVDILINNGGISVASTAVDVDLKVMV----VNYFGSVALTKALLPSMVKRGSGHICFISSVQG
DHB1_MOUSE      V---TEGRVDVLVCNAGRGLFGPLEAHELNAVGAVLDVNVLGTIRMLQAFLPDMKRRHSGRVLVTASVGG
TRN2_HYONI      VSNHFHGKLNILVNNAGIVIYKEAKDYTMEDYSHIMSINFEAAYHLSVLAHPFLKASERGNVVFISSISG
DRS7B_RAT       ------GYVDILINNAGISYRGAISDTIVDVDRKVMEINYFGPVALTKALLPSMVERKRGHIVAISSIQG
DHRS9_MOUSE     VKSHVGEKLWGLINNAGVGVLAPTDWLTVDDYREPIEVNLFGLINVTLNMLPLVKK-ARGRVINVSSIGG
ACT3_STRCO      VVERYG-PVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGG
Y2049_STAEQ     VIDHFG-HIDIVVNSAGQSLSSKITDYNVEQWDTMIDVNIKGTLHVLQATLPYLLKQSSGHIINLASVSG
Y2036_STAES     VIDHFG-HIDIVVNSAGQSLSSKITDYNVEQWDTMIDVNIKGTLHVLQATLPYLLKQSSGHIINLASVSG
Y1627_STAS1     TAYNDFGRIDVLINNAGLMPQSFLEKNKQDEWNQMIDVNIKGVLYGIGAVLPYMRKQKSGHIINLASVAG
DHR11_HUMAN     IRSQHSG-VDICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNVGHIININSMSG
YKVO_BACSU      IIKQEKGKLDILFANAGIGNFLPLGEITEEQVDRTFDINVKGTIFTVQKALSLFPDK-VGSIIVTGSTAG
Y452_LISIN      LAIERYGKVDAIFLNAGIMPNSPLSALKEDEWEQMIDINIKGVLNGIAAVLPSFIAQKSGHIIATSSVAG
FABG_STAES      VVSQFG-SVDVLVNNAGITKDNLLMRMKEQEWDDVIDTNLKGVFNCIQKVTPQMLRQRSGAIINLTSIVG
FABG_STAEQ      VVSQFG-SVDVLVNNAGITKDNLLMRMKEQEWDDVIDTNLKGVFNCIQKVTPQMLRQRSGAIINLTSIVG
BDH_HUMAN       XLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMTKSFLPLIRR-AKGRVVNISSMLG
Y2567_STAAR     MAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAKAALPTMLEQSSGHLINIASISG
DHR11_BOVIN     VRSQHSG-VDICINNAGLARPDTLLSGSTSGWKEMFNVNVLALSICTREACQSMRERKVGHIININSMCG
BACC_BACAM      AVDKFGG-LDVLINNAGIEIVAPIHEMELSDWNKVLNVNLTGMFLMSKHALKYMLKSGKGNIINTCSVGG
TRN2_DATST      VANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSVSG
PHBB_RHIME      V-EADLGPVDILVNNAGITRDAMFHKMTPEQWGEVIGTNLTGVFNMTHPLWSGMRDRGFGRIVNISSING
FABG_BACSU      TLS-VFSTIDILVNNAGITRDNLIMRMKEDEWDDVININLKGVFNCTKAVTRQMMKQRSGRIINVSSIVG
Y325_THEMA      IVKKTVGRLDILVNNAGIVPYGNIEETSEEDFDKTMAVNVKGPFLLSKYAVEQMKKQGGGVIVNVSSEAG
H17B6_HUMAN     VKEHVGDGLWGLVNNAGILTPITLEWLNTEDSMNMLKVNLIGVIQVTLSMLPLVRR-ARGRIVNVSSILG
UCPA_SALTY      A-KETEGRIDILVNNAGVCRLGNFLDMSEEDRDFHIDINIKGVWNVTKAVLPEMIKRKDGRIVMMSSVTG
UCPA_SALTI      A-KETEGRIDILVNNAGVCRLGNFLDMSEEDRDFHIDINIKGVWNVTKAVLPEMIKRKDGRIVMMSSVTG
RDH16_HUMAN     CVRDKG--LWGLVNNAGISLPTAPNELLTK---QDFVTNLLGVIDVTLSLLPLVRR-ARGRVVNVSSVMG
KDUD_BACSU      LFENR--QIDILVNNAGIIHREKAEDFPEENWQHVLNVNLNSLFILTQLAGRHMLKRGHGKIINIASLLS
DHRS4_RABIT     ALNLHGG-IDILVSNAAVNPFGKLMDVTEEVWDKILDINVKAMALMTKAVVPEMEKRGGGSVVIVASIAA
BACC_BACSU      AVHTFGG-LDVLINNAGIEIVAPIHEMELSDWNKVLQVNLTGMFLMSKHALKHMLAAGKGNIINTCSVGG
RDH2_RAT        VKERVGNTLWGLVNNAGIGHLGPNEWMNKQNIASVLDVNLLGMIEVTLSTVPLVRK-ARGRVVNVASIAG
PHAB_ACISR      XXXXXXGRVDVLVNNAGITRDATFKKMSYEQWSQVIDTNLKTLFTVTQPVFNKMLEQKSGRIVNISSVNG
LVR_LEIAQ       ATTERFGRIDGFFNNAGIGKQNPTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQGSGMVVNTASVGG
Y432_LISMO      LAIERYGKVDAIFLNAGIMPNSPLSALKEDEWEQMIDINIKGVLNGIAAVLPSFIAQKSGHIIATSSVAG
RDH3_RAT        VKERVGNGLWGLVNNAGISPVGPNEWMRKKDFASVLDVNLLGVIEVTLNMLPLVRK-ARGRVVNIASTMG
RDH7_RAT        VKERVGNGLWGLVNNAGISPMGPNEWMRKKDFASVLDVNLLGVIEVTLNMLPLVRK-ARGRVVNIASTMG
PHAB_PARDE      VEEELG-PIAVLVNNAGITRDAMFHKMTPQQWKEVIDTNLTGLFNMTHPVWSGMRDRKYGRIVNISSING
FABG_RICPR      LISKTS-NLDILVCNAGITSDTLAIRMKDQDFDKVIDINLKANFILNREAIKKMIQKRYGRIINISSIVG
FABG_HAEIN      IKNDFG-DIDILVNNAGITRDNLLMRMKDEEWFDIMQTNLTSVYHLSKAMLRSMMKKRFGRIINIGSVVG
DHRS7_MOUSE     VLQEFG-KIDILVNNGGRSQRSLVLETNLDVFKELINLNYIGTVSLTKCVLPHMIERKQGKIVTVNSIAG
RDH7_MOUSE      VKERVGNGLWGLVNNAGICVFAINEWLKKEDFANILDVNLLGMIEVTLSMLPLVRK-ARGRVVNISSSMG
FABG_CUPLA      AVD-AWGTVDILVNNAGITRDGLLMRMKKSQWQEVIDLNLTGVFLCTQXXXXXXXXXXXGRIINIASVVG
YM71_YEAST      -LPQEFKDIDILVNNAGKALGSRVGQIATEDIQDVFDTNVTALINITQAVLPIFQAKNSGDIVNLGSIAG
KDSR_HUMAN      AQEKLG-PVDMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAG
DHR11_MOUSE     VRSQHSG-VDICINNAGMARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNIGHIININSMCG
YOXD_BACSU      ------GDIDILINNAGISKFGGFLDLSADEWENIIQVNLMGVYHVTRAVLPEMIERKAGDIINISSTAG
TRNH_DATST      VTSSFNGKLNILINNAGT----TIPKEATNFTAEDYSTNFEASYNLCQLAHPLLKASGNASIVFNSSAAG
DRS7C_XENTR     CY----GCVDVLINNASMKMKGPLQSVSLELDKKIMDANYFGPITLVKAILPHMISRRTGQIVLVNTIQG
CPNA_COMTE      ILAESD-RLDALVNNAGILTLKPVQDTSNEEWDRIFEINVRSVFLGTRAVIEPMRKAHKGCIVNVSSIYG
CPNA_COMS9      ILAESD-RLDALVNNAGILTLKPVQDTSNEEWDRIFEINVRSVFLGTRAVIEPMRKAHKGCIVNVSSIYG
DHI1_HUMAN      MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
Y945_MYCTU      LSDEIGG-IDRVIVNAGIGKGARLGSGKLWANKATIETNLVAALVQIETALDMFNQRGSGHLVLISSVLG
KDSR_MOUSE      AQEKLG-PVDMLVNCAGTSMSGKFEELEVSSFEKLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAG
DR9C7_BOVIN     VRDQVGEQLWALVNNAGVGPSGPNEWLTKEDFVKVINVNLVGLIEVTLHMLPMVKK-ARGRVVNMSSSGG
MAS12_AGRRH     AAVEKFGRIDGLINNAGCGEPVNLEDIDYKQFHRQWHINCVAPLRMTELCLPYLCETGSGRVVNINSMSG
FABG_BUCAP      ICQKKY-SIDILINNAGITSDNLLVYMSNKEWENVIKINLTSVFYMSKSVIRSMIKKRYGRIVTIGSVIG
DHKR_STRCM      AAVDRYGRIDVLVNNAGRSGGGVTADLTDELWDDVIDTNLNSVFRMTRAVLXXXXXXXXXXIINVASTAG
GNO_GLUOX       I-ERDMGPIDILINNAGIQRRAPLEEFSRKDWDDLMSTNVNAVFFVGQAVARHMIPRGRGKIVNICSVQS
KDSR_BOVIN      AQEKLG-PVDMLVNCAGMSLSGKFEDLEVSTFERLMSINYLGSVYPSRAVIATMKERRMGRVVFVSSQAG
FABG_VIBHA      I-NDECGAIDILVNNAGITRDNLLMRMKDDEWNDIINTNLTPIYRMSKAVLRGMMKKRAGRIINVGSVVG
FABG_VIBCH      ITDEFGG-VDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVG
DHB2_MOUSE      VTEKIQDKLWAVVNNAGVFHLPIDELIPMSIYRKCMAVNFFGTVEVTKAFLPLLRKSK-GRLVNVSSMGG
CBR2_PIG        V-----GPVDLLVNNAAVALMQPFLDTTKEVFDRSFNVNLRSVFQVSQIVARSMIERGVGSIVNVSSMVS
BUDC_KLEPN      A-RKTLGGFDVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGHGKIINACSQAG
HSD_MYCTU       TAVTAFGGLHVLVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGRGSIINISSIEG
HSD_MYCBO       TAVTAFGGLHVLVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGRGSIINISSIEG
BDH_CHICK       VLEDPEKGLWGLVNNAGISTFGEVEFTSMDTYMEVAEVNLWGTVRTTKAFLPLIRR-SKGRVVNISSMMG
YGCW_ECOLI      ACCERFGTVDILVNNAGICKLNKVLDFGRADWDPMIDVNLTAAFELSYEAAKIMIPQKSGKIINICSLFS
SDH_RHIRD       -LPDGFRDIDILVNNAGLALGTAAPQVPLKDWQTMVDTNITGLLNVTHHLLPTLIER-KGIVINLSSVAA
FABG_AQUAE      IYNLVDG-IDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVG
KDSR_DICDI      IVSKNGGKIDCLINCAGFAIPGYFIEQDEEIFEKTMQLDYFGSLYATKEVVPLMIENGGGHIVFVSSTCG
DR9C7_HUMAN     VRDKVGEQLWALVNNAGVGLPSGPNEWLTKFVKV-INVNLVGLIEVTLHMLPMV-KRARGRVVNMSSSGG
BDH2_MOUSE      IER-----IDVLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMFLMIKAFLPKMLAQKSGNIINMSSVAS
Y4EK_RHISN      -----GEKIDVLVNNAGLLTASALVDLSEDDIDAMIDINIRSVFKLTRHVLKQMIERRRGHIFFTGSSGG
FABG_PSEAE      IQQHLGQPL-IVVNNAGITRDNLLVRMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVG
BUTA_STAEQ      AVTEFG-QLDVMVNNAGVDAVTPILEIGEEELSKLFNINVFGLFGIQAAANQFIKQKSKGKIINACSIAG
DHI1_SAISC      MTGKLMGGLDMLILNHITNTSLNFFHDDIHHVRKSMEVNFLSYVVLTVAAMPML-KQSNGSIVIVSSVAG
DHI1_MESAU      MTGKLMGGLDMILNHITYTSMNFFRD-EIHALRKAMEVNFISYVVMSVAALPML-KQSNGSIVVVSSIAG
FABG_SHIFL      IRAEFG-EVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVG
FABG_MYCAV      V-EEHQGPVEVLVSNAGISKDAFLIRMTEERFTEVINANLTGAFRVTQRAARSMQKKRFGRIIYIGSVSG
FABG_ECOLI      IRAEFG-EVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVG
Y0419_STAS1     XXXXFG-QIDILVNSAGLMLSSAITEGDVEAWEAMIDVNIKGTLYTINAVLPSMLNQSSGHIINIASISG
FABG_STAAW      VVSQFG-SLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVG
FABG_STAAS      VVSQFG-SLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVG
FABG_STAAR      VVSQFG-SLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVG
FABG_STAAN      VVSQFG-SLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVG
FABG_STAAM      VVSQFG-SLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVG
FABG_STAAC      VVSQFG-SLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVG
DHR11_CHICK     IKTLHQG-VDVCINNAGLARPEPLLSGKTEGWRTMIDVNVMAVSICTREAYQSMKERNIGHIININSMNG
DHB2_HUMAN      MLQDRG--LWAVINNAGLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRK-SKGRLVNVSSMGG
ACR1_ACIBI      IMASVD-HVDFLINNAGRSIRRAVHESFDRFFERTMQLNYFGAVRLVLNLLPHMIKRKNGQIINISSIGV
ACR1_ACIAD      IMASVD-HVDFLINNAGRSIRRAVHESFDRFFERTMQLNYFGAVRLVLNLLPHMIKRKNGQIINISSIGV
YXNA_BACSU      TAISTFGRFDTWVNNAAVSTFGHAMDVTVEDMKRMFDTNFWGPVYGTRAAVKHYTGRGVGALINVGSLFG
YVRD_BACSU      IVNEIG-DIDILVNNLGFFEVKDFADVTDEEWNQYFEVNVMSAVRTSRHFLPKMLAKNSGRILNIASEAG
RDH1_HUMAN      VMHVKEAGLFGLVNNAGVGIIGPTPWLTRDDFQRVLNVNTMGPIGVTLALLPLLQ-QARGRVINITSVLG
NODG_AZOBR      I-EADLGPVDILVNNAGITRDKFFAKMDKAQWDAVIATNLSSLFNVTQQVSPKMAERGWGRIINISSVNG
HCDR_XANP2      TMEQFG-AIDVLVNNAGISEAGVLHTTPVEQFDKVMAVNVRGIFLGCRAVLPHMLLQGAGVIVNIASVAS
DHI1_RABIT      MTGKLMGGLDMLILNHITNASLMFFNNDIHHVRKEMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
DHB11_PONAB     VKAEIG-DVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMMKNNHGHIVTVASAAG
BUDC_KLETE      ARKALGG-FNVIVNNAGIAPSTPIESITEEIVDRVYNINVKGVIWGMQAAVEAFKKEGHGKIVNACSQAG
Y1385_MYCBO     AVERFGG-LDVMVNNAGITRDATMRTMTEEQFDQVIAVHLKGTWNGTRLAAAIMRERKRGAIVNMSSVSG
Y1350_MYCTU     AVERFGG-LDVMVNNAGITRDATMRTMTEEQFDQVIAVHLKGTWNGTRLAAAIMRERKRGAIVNMSSVSG
DHI1A_XENLA     AVNKLGGLDYLVLNHIGGSASFGFFKGEMDPVVGSIYINFLSYVQLTSAALKALQ-ESQGSIVVMSSMSG
DHB2_RAT        VAEKQDKGLWAVVNNAGFPIDGEL--IPMTVYRKCMAVNFFGAVEVTKVFLPLLRK-SKGRLVNVSSMGA
DER_CHICK       ----AAGPFELLVNNAAVAMLQPFLQVTREAVERSFDVNFRAVLHVSQIVARQMIAQGLGAIVNVSSQAS
GS39_BACSU      TVKELGG-LDILVNNAGEQHPKSIKDITSEQLHRTFKTNFYSQFYLTKKAIDYLKPG--SAIINTTSINP
FABL_BACSU      IIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGGHIVSISSLGS
BUTA_STAES      ------GQLDVMVNNAGVDAVTPILEIGEEELSKLFNINVFGLFGIQAAANQFIKQKSKGKIINACSIAG
DHRS4_BOVIN     AVKLHGG-VDILISNAAVSPFGSLMDVPEEVWDKILDVNVKATALLTKAVVPEMAKRXXXXXXXXXXXAA
DHI1_MOUSE      MTGKLMGGLDMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALPML-KQSNGSIAVISSLAG
DHB11_HUMAN     VKAEIG-DVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAG
YXBG_BACSU      QIKDACGTIDILFNNAGVDQGGKVHEYPVDLFDRIIAVDLRGTFLCSKYLIPLMLENG-GSIINTSSMSG
YDFG_SHIFL      -LPAEWSNIDILVNNAGLAHKASVEDWET-----MIDTNNKGLVYMTRAVLPGMVERNHGHIINIGSTAG
UCPA_ECOLI      AKEKEG-RIDILVNNAGVCRLGSFLDMSDDDRDFHIDINIKGVWNVTKAVLPEMIARKDGRIVMMSSVTG
UCPA_ECO57      AKEKEG-RIDILVNNAGVCRLGSFLDMSDDDRDFHIDINIKGVWNVTKAVLPEMIARKDGRIVMMSSVTG
FOX2_YEAST      IIEKEFGRVDVLINNAGILRDVSFAKMTEREFASVVDVHLTGGYKLSRAAWPYMRSQKFGRIINTASPAG
DRS7C_BOVIN     VLD-CYGCVDILINNASVKVKGPAHKISLELDKKIMDANYFGPIILTKALLPDMISRRTGQIVLVNNIQG
RIDH_KLEAE      ILQLTG-RLDIFHANAGAYIGGPVAEGDPDVWDRVLHLNINAAFRCVRSVLPHLIAQKSGDIIFTAVIAG
PHBB_RALEH      VKSEVG-EVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGWGRIVNISSVNG
DHI1_RAT        MAGKLLGGLDMLILNHITQTTMSLFHDDIHSVRRSMEVNFLSYVVLSTAALPML-KQSNGSIAIISSMAG
CBR4_DANRE      TINKTCGTVGFLVNAAGINRDALLLRSKSEDMLSVLHTNLLGSMLTCKAAVRNMLSHG-GAIVNIGSVVG
YDFG_ECOL6      -LPAEWSNIDILVNNAGLAHKASIEDWET-----MIDTNNKGLVYMTRAVLPGMVERNHGHIINIGSTAG
PHBB_ZOORA      V-EADLGPIDVLVNNAGITKDAMFHKMTPDQWNAVINTNLTGLFNMTHPVWSGMRDRSFGRIVNISSING
FABG_MYCTU      V-EEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSVSG
FABG_MYCBO      V-EEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSVSG
BUTA_STAAW      TAAQFG-DFHVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKFNHGKIINATSQAG
BUTA_STAAS      TAAQFG-DFHVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKFNHGKIINATSQAG
BUTA_STAAR      TAAQFG-DFHVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKFNHGKIINATSQAG
BUTA_STAAN      TAAQFG-DFHVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKFNHGKIINATSQAG
BUTA_STAAM      TAAQFG-DFHVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKFNHGKIINATSQAG
BUTA_STAAC      TAAQFG-DFHVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKFNHGKIINATSQAG
YI13_SCHPO      SLPKEFADIDVLINNAGLAGTDKVIDLNIDDAVTMITTNVLGMMAMTRAVLPIFYSKNKGDILNVGSIAG
Y484_MYCTU      ALSR----VDVLVNNAG-GAKGLVADADLEHWRWMWDTNVLGTLRVTRALLPKLIDSGDGLIVTVTSIAA
MAS11_AGRRH     AVEKFG-RIDGLVNNAGYGEPVNLDKVDYQRFHLQWYINCVAPLRMTELCLPHLYETGSGRIVNINSMSG
FABG_BUCAI      IYKKKH-SIDILINNAGIKEDNLLVNMKSTEWDDVIKTNLSSVFHLVKSVIRSMIKKRQGRIITIGSVIA
DHI1L_XENTR     ALSALGGLDYLVLNHIGWTPF-KMWDGDVNHTRWLMEVNFLSYIHLATAALPYLT-QSKGSIIVLSSLTA
GRDH_DAUCA      QVVNAFGSIDVLVNNAAEQKASTVEDIDEERLERVFRTNIFAYFFMARHALKHMREG--STIINTTSINA
GRDH1_ARATH     EVVNAFGRIDVLINNAAEQESSTIEEIDEPRLERVFRTNIFSYFFLTRHALKHM-KEG-SSIINTTSVNA
FOX2_CANTR      YNNKNFGTVHVIINNAGILRDASMKKMTEKDYKLVIDVHLNGAFAVTKAAWPYFQKQKYGRIVNTSSPAG
FABG_MYCS2      V-EEHQGPVEVLVANAGISKDAFLMRMTEERFEEVINTNLTGAFRCAQRASRTMQRKRFGRIIFIGSVSG
FABG1_SYNY3     TLDKFS-RIDVLVNNAGITRDTLLLRMKLEDWQAVIDLNLTGVFLCTKAVSKLMLKQKSGRIINITSVAG
YDFG_ECO57      -LPAEWCNIDILVNNAGLAHKASIEDWET-----MIDTNNKGLVYMTRAVLPGMVERNHGHIINIGSTAG
GRDH2_ARATH     VVNSFG-RIDVLVNCAAEQHEVSIEDIDEARLERVFRTNIFSQFFLVKYALKHM-KEG-SSIINTTSVVA
FABG_THEMA      XXQKYG-RIDVLVNNAGITRDALLVRMKEEDWDAVINVNLKGVFNVTQMVVPYMIKQRXXXXXXXXXXXX
DRS7C_MOUSE     VLD-CYGCVDILINNASVKVKGPAHKISLELDKKIMDANYFGPITLTKVLLPNMISRRTGQIVLVNNIQA
DRS7C_HUMAN     VLD-CYGCVDILINNASVKVKGPAHKISLELDKKIMDANYFGPITLTKALLPNMISRRTGQIVLVNNIQG
CBR2_MOUSE      I-----GPVDLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGVGSIVNVSSMVA
YDFG_SALTY      -LPAQWRDIDVLVNNAGLAHKASVEDWET-----MIDTNNKGLIYMTRAVLPGMVERNRGHIINIGSTAG
YDFG_SALTI      -LPAQWRDIDVLVNNAGLAHKASVEDWET-----MIDTNNKGLIYMTRAVLPGMVERNRGHIINIGSTAG
YDFG_ECOLI      -LPAEWCNIDILVNNAGLAHKASVEDWET-----MIDTNNKGLVYMTRAVLPGMVERNHGHIINIGSTAG
IDNO_ECOLI      I-EKDIGPIDVLVNNAGIQRRHPFTEFPEQEWNDVIAVNQTAVFLVSQAVTRHMVERKAGKVINICSMQS
IDNO_ECOL6      I-EKDIGPIDVLVNNAGIQRRHPFTEFPEQEWNDVIAVNQTAVFLVSQAVTRHMVERKAGKVINICSMQS
FABG_RICTY      ISN-----LDILVCNAGITSDTLAIRMKDQDFDKVIDINLKANFILNREAIKKMIQKRYGRIINISSIVG
FABG_BUCBP      FVYKNFGRVDILINNAGIIRDKLLINMKTQDWNSVLNVNLNSIFYMSKSVIRNMIKNKQGKIITIGSVIA
BDHA_RALEH      ------GGADILVNNAGIQHVAAIEDFPPERWDAIIAINLTSAFHTTRLALPGMKQKDWGRIINVASTHG
RDHE2_HUMAN     QVKKEVGDVSILINNAGIVTGKKFLDCPDELMEKSFDVN-FKAHLWTYKALPAMIANDHGHLVCISSSAG
MAS1_AGRT9      WVDTTIAKIDGLVNNAGCGDHVDLEEINVELLQKQWDINCVAPLIMTKLCMPYLIESGSGRIVNLNSMSG
DHI1_CAVPO      MTNLMGGLDMLILNHVLYNRLTFFHEIDN--VRKSMEVNFHSFVVLSVAAMPMLM-QSQGSIAVVSSVAG
DHB13_MOUSE     QVKREVGDVEIVVNNAGAIYPADLLSAKDEEITKTFEVNILGHFWIIKALLPSMLRRNSGHIVTVASVCG
LINC_PSEPA      TLAAFGG-LDGSFNNAAIPQAGLLAEVSLERFRQSMDINVTGTFLMKYQILAMIERGTKGSIVNTASAAG
FABG_RICBR      I-----EKLDILVCNAGITKDTLAIRMKNEDFDQVIDINLKANFILNREAIKKMMTNRYGRIINITSIVG
FABG_CHLMU      FLAEYG-TIDVVVNNAGITRDSLLMRMSEEEWSSVIDTNLGSIYNVCSAVIRPMIKARSGAIVNISSIVG
DHI2_RAT        TKAHTASTLWGLVNNAGLNMVVAVELSPVVTFRECMEVNFFGALELTKGLLPLLR-HSRGRIVTVGSPAG
YF3H_SCHPO      I-QKVFDTIDIVVPNNGICTGKSAIDMTYEEFANEINVNLLGVFNVAHNAGPIFQKQGHGSLVATASMSG
FOX2_NEUCR      TAIKEFGRIDILINNAGI-----LRDISFKNMKDEFKVHVKGSYKTARAAWPYFRKQKFGRVINTASAAG
DS7CA_DANRE     IC-ECYGCVDVLICNSSMKVKAPVQNLSLEMDKTIMDVNYFGPITLAKGVLPLMITRRTGQFVLVNSIQG
DHB11_MOUSE     VKEEVG-DVSILVNNAGVVYTADLFATQDPQIEKTFEVNVLAHFWTTKAFLPVMMKNNHGHIVTVASAAG
CBR1_MOUSE      FLLKEYGGLDVLVNNAGI--AFKVND-DTPFHIQTMKTNFFGTRDVCKELLPLIKPQ--GRVVNVSSMVS
RDH1_BOVIN      VETHVGAGLFGLVNNAGVGIIGPTPWQTREDFQRVLNVNTLGPIGVTXXXXXXXX-QARGRVINITSVLG
HSD_STREX       YAREEFGSVDGLVNNAGISTGMFLETESVERFRKVVDINLTGVFIGMKTVIPAMKDAGGGSIVNISSAAG
DHI1B_XENLA     AVVKLGGLDYLVLNHIXXXXXXXXXXXDMDPVVGSTTVNFLSYVQLTSSALSALQ-ESQGSIVVISSMSG
DHB4_MOUSE      TALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIHRVHLRGSFQVTRAAWDHMKKQNYGRILMTSSASG
DHB13_RAT       QVKKEVGDIEIVVNNAGAIYPADLLSTKDEEITKTFEVNILGHFWIIKALLPSMLRRNSGHIVTVASVCG
DHB11_MACFA     VKAEIG-DVSILVNNAGVVYTSDLFATQDAQIEKTFEVNILAHFWTTKAFLPAMMKNNHGHVVTVASAAG
FABG_CHLTR      FLAEYN-TIDVIVNNAGITRDALLMRMSEEEWSSVINTNLGSIYNVCSAVIRPMIKARSGAIINISSIVG
DHB13_HUMAN     V-KKEVGDVTIVVNNAGTVYPADLLSTKDEEITKTFEVNILGHFWITKALLPSMMERNHGHIVTVASVCG
BAIA2_EUBSP     VAQKYG-RLDVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAKKGVIINTASVTG
ADH2_CERRO      VVSKVK-YIDALINGAGI-----LTDLNVELT---MNINLIGLINTTLEGLPLMNKQGRGGVIVNASVLG
ADH2_CERCO      VVSKVK-YIDALINGAGI-----LTDLNVELT---MNINLIGLINTTLEALPLMNKQGRGGVIVNASVLG
DHK1_STRVN      AVQRYG-TVDILVNNAGRSGGGATAEIADELWLDVITTNLTSVFLMTKEVLNAMLAKKRGRIINIASTGG
DHB4_RAT        TALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHMKKQNYGRIIMTASASG
RHLG_PSEAE      ALGELSARLDILVNNAGTSWGAALESYPVSGWEKVMQLNVTSVFSCIQQLLPLLRRENPARVINIGSVAG
DHSO_RHOSH      LLDRWG-SIDILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGGRGKIINMASQAG
DHRS4_MOUSE     ALKRHRG-IDILVSNAAVNPFGNLMDVTEEVWDKVLSINVTATAMMIKAVVPEMEKRXXXXXXXXXXXAG
DHI1_SHEEP      AGELVGGLDMLILNHINYTPLRVFSN-DIHLLRRSLEVNLLSYVVLSTAALPML-KQTXXXXXXXXXXAG
SDH_AGRT5       ALPDGFRDIDILVNNAGLALGTAAPQVALKDWQTMVDTNITGLLNITHHLLPTLIKQ-KGIVVNLSSVAA
LIMC_RHOER      L-----GRLDIVSANAGIASVPFLSDIPDNTWRQMIDINLTGVHTAKVAVPHILAGERGGSIVLTSSAAG
NODG_RHIS3      KAEADLEGVDILVNNAGITKDGLFVRMSDADWDTVLEVNLTAVFRLTRELTHPMMRRRHGRIINITSVVG
DHB4_HUMAN      KVVKTAGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASG
YCP8_SCHPO      V-TKVVDAVDVLWNSAVFHSFGPVVNTPDDVWNSHYKTNVLGIH--VYQAFYPLIKKGRSKIIVFTSSLG
Y0585_STAHJ     VID-VFGHVDIFVNCAGVMRSSKITDYQVESWDSMVDTNIKGLLYSLNAILPKFEAQGSGHVVNLASISA
DHB11_RAT       VKEEVG-DVSILVNNAGVVYTADLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMMKNNHGHVVTVASAAG
BAIA1_EUBSP     VAQKYG-RLDVMINNAGITMNSVFSRVSEEDFKNIMDINVNGVFNGAWSAYQCMKDAKQGVIINTASVTG
ADH1_CERCA      VISKVQ-HIDALINGAGI-----LTDPNVELT---MNINLIGLINTTLEALPLMDKNKHGRIVNIASVLG
YAY8_SCHPO      FALKKLGWIDVLVNNIAYQQAQSIEDIDDEQWDLTFKTNIFSFFWVTKAAISHMKSG--SSIVNCSSINA
RDHE2_MOUSE     QVKKEVGDVSILINNAGIVTGRNFLDCPDDLMEKSFDVN-FKAHLWMYKALPAMIANNHGHLVCISSSAG
DHI2_MOUSE      TKAHTASTLWGLVNNAGLNIVVAVELSPVATFRKCMEVNFFGALELTKGLLPLLR-HSRGRIVTVGSPAG
DHG_BACSU       AI-KEFGTLDIMINNAGLENPVPSHEMPLKDWDKVIGTNLTGAFLGSREAIKYFVENDIGNVINMSSVHE
DHG_BACME       AI-KEFGKLDVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKFVENDIKGTVINMSSVHE
DHG2_BACSU      TALEHFGTLDVMVNNSGFNGVEAMHEMSLEDWQRVIDVNVTGTFLGAKAALNHMMKNNIGNVLNISSVHQ
DHG2_BACME      TAVKEFGSLDVMINNAGVENPVPSHELSLENWNQVIDTNLTGAFLGSREAIKFVENDIKGNVINMSSVHE
YHXC_BACSU      A-SQVFPSIDILVNNAAEQHVQSIEKITSHQLIRTFQTNIFSMFYLTKAVLPHLKKG--SSIINTASITA
YHDF_BACSU      TVDHFG-KLDILVNNAAEQHPDSILNISTEQLEKTFRTNIFSMFHMTKKALPHL--QEGCAIINTTSITA
S16C6_BOVIN     QVKKEVGNVTILINNAGVVTGREFLKTPDHMVERSFLVNVMS-HFWTYKALPAMLEANHGHLVCISSFAG
GRDH_ORYSJ      VAGAYGGAIDILVNNAAEQERPSITDITEDDLERVFRTNIFSYFFMSKHAVKRMRDXXXXXXXXXCSIIN
EPHD_MYCTU      RVSAEHGVPDIVVNNAGIGQAGRFLDTPAQFDRXXXXXXXXXXXXCRAFGQRLVERGTGGHIVNVSSMAA
EPHD_MYCBO      RVSAEHGVPDIVVNNAGIGQAGRFLDTPAQFDRXXXXXXXXXXXXCRAFGQRLVERGTGGHIVNVSSMAA
DHI1L_DANRE     AIEQLGGLDYLVLNHIGPSPY-QMWDGDVQHTRWLLEVNFLSYLQMAQKALPTLEKSK-GSIVVVSSLLG
YOHF_ECOLI      KLIQRLGRIDVLVNNAGAMTKAPFLDMAFDEWRKIFTVDVDGAFLCSQIAARQMVKQGQGRIINITSVHE
DHG1_BACME      SI-KEFGKLDVMINNAGMENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKFVENDIKGTVINMSSVHE
CBR4_BOVIN      I-EKNLGRVNFLVNAAGINRDNLLVRTNTEDMLSQLHTNLLGSMLTCRAALKTMIKQQRGSIVNVGSVVG
DS7CB_DANRE     IL-ECFCCLDVLVFNSSMKLKAPVHSLSLQMDRLLMDVNYFGPITLVKGFLPSLISRRSGHILLVNSIQG
Y182_METEA      ------GRLDVLVNNSGVYEFAAIEEVTEEHYRRIFDVNVLGVLLATQAASKHLGEG--GSIINISSVVT
TSC10_NEUCR     AIAWNGGSPDIVWCVAGMSTPLLTDDGSMAAARRNMDVNYFGSAEMSRAILRLAPENSTGPLVFTASMLA
PGDH_CAVPO      VVDYFG-RLDILVNNAGVN--------NEKNWEKTLQINLVSVISGTYLGLDYMSKQHGGEIINMSSLAG
DCXR_CAEEL      IVGDVSANEEVLFNNAGIATNHAIGQITQQSIDRTFAVNVRGILIAQLVARNFVDRQIKGSIVNISSQAA
CBR1_PIG        FLRKEYGGLDVLVNNA----AIAFQDNPTPFHIQTMKTNFMGTRNVCTELLPLIKPQ--GRVVNVSSTEG
CBR1_MACFA      FLLKEYGGLDVLVNNAGI--AFKVADPTPFHIQAEMKTNFFGTRDVCTELLPLIKPQ--GRVVNISSMMS
BDH2_HUMAN      VER-----LDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVAS
Y1570_MYCBO     VLGDLGG-VDILINNAGRSIRRSLELSYDRIHDYQMQLNYLGAVQLILKFIPGMRERHFGHIVNVSSVGV
Y1543_MYCTU     VLGDLGG-VDILINNAGRSIRRSLELSYDRIHDYQMQLNYLGAVQLILKFIPGMRERHFGHIVNVSSVGV
HETN_ANASP      QAQDIVGPIDVLINNAGIEINGTFANYSLAEIQSIFNTNXXXXXXXXXXXXPSMMERGSGRIVNIASLAG
HDHA_ECOLI      FAISKLGKVDILVNNAGGGGPKPF-DMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAA
HDHA_ECO57      FAISKLGKVDILVNNAGGGGPKPF-DMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAA
FABG_SALTY      IRAEFG-EVDILVNNAGITRDNLLMRMKDDEWNDIIETNLSSVFRLSKAVMRAMMKKRCGRIITIGSVVG
FABG_SALTI      IRAEFG-EVDILVNNAGITRDNLLMRMKDDEWNDIIETNLSSVFRLSKAVMRAMMKKRCGRIITIGSVVG
DHB12_MACFA     IYDKAGLEIGILVNNVGMSYEYPVPDLDN-VIKKMININILSVCKMTQLVLPGMVERSKGAILNISSGSG
CBR1_PONAB      FLRKEYGGLDVLVNNAGI--AFKVADPTPFHIQAEMKTNFFGTRDVCTELLPLIKPQ--GRVVNVSSIMS
S16C6_MOUSE     QVKEEVGDVTILINNAGVVTGKSFLNTPDHLVEKSFLVNAIS-HFWTCKALPAMVKANHGHLVCISSIAG
MFEA_DICDI      TAMDSFGGVDILINNAGILRDGKMTDGDWDLV---YRVHAKGAYKLSRAAWNHMREKNFGRIIMTSSAAG
FABG5_BRANA     AVDKWG-TIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATXXXXXXXXXXXXXXASVVG
FIXR_BRAJA      VKKRLAGALHALVNNAGVSPKTPTGDRMTS-LTTSTDTRVFHLNILLAQGLFDELRAASGSIVNVTSIAG
DHRS4_PIG       AVNLHGG-VDILVSNAAVNPFGNIIDATEEVWDKILHVNVKATVLMTKAVVPEMEKRXXXXXXXXXXXXA
DHG3_BACME      AI-KEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIGNVINMSSVHE
DHB12_HUMAN     IYDKAGLEIGILVNNVGMSYEYPVPDLDN-VIKKMININILSVCKMTQLVLPGMVERSKGAILNISSGSG
YTKK_BACSU      ALNRFG-RIDFLINNAGIFERKKLADYTDDEWYGMLEGNLSAVFHLFKAVIPIMRKQQFGRIITYQGAAH
YCIK_ECOLI      RIAVNYPRLDGVLHNAGLGDVCPMSEQNPQVWQDVMQVNVNATFMLTQALLPLLLKSDAGSLVFTSSSVG
DHRS4_RAT       MALKLHQGIDILVSNAAVNPFGNLMDVTEEVWNKVLSINVTASAMMIKAVVPAMEKRXXXXXXXXXXXXX
YMFI_BACSU      IVQP----IDAIVLNSGRSHFGLITDVDNATVQEMVQLHVASPYMLTRNLLPGMIRNKSGAIVAVSSIWG
YJDA_BACSU      ISDKLGYP-SILINNAAHSASDNYVSLDAKSLDEHYAVNMRSNFLLCVEFARRFKKSNLGRIINMTSGQD
Y5909_MYXXD     -LDAEAGGLDLVVANAGVGGTTNAKRLPWERVRGIIDTNVTGAAATLSAVLPQMVERKRGHLVGVSSLAG
DHI1L_CHICK     AVQNLGGLDYLVLNHIGVSPF-QMWGGDVEHTRWLMQVNFFSYVALATAALPTLEKN-HGSVVVVSSLTG
DHGA_BACME      AI-KEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIGNVINMSSVHE
DHG4_BACME      AI-KEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIGNVINMSSVHE
DHB12_MOUSE     IYDKSGLEIGVLVNNVGMSYEYPIPDLDNT-IKKLININVLSVCKVTRLVLPGMVERSKGVILNISSASG
HCDS_XANP2      A-QRALGPLTGLVNNAGIAGFGSVHATEVETWSRIMAVNVTGTFLASKAALFGMLERGRGAIVNFGSVAG
DHB12_RAT       IYDKSGLEIGVLVNNVGMSYEYPIPDLDNT-IKKLININVLSICKVTRLVLPGMVERSKGVILNISSASG
CBR1_HUMAN      FLRKEYGGLDVLVNNAGI--AFKVADPTPFHIQAEMKTNFFGTRDVCTELLPLIKPQ--GRVVNVSSIMS
BDH2_BOVIN      IER-----LDVLFNVAGFVHHGTILDCEETDWDFSMNLNVRSMYLMIKAFLPKMMAQKSGNIINMSSVAS
PGDH_MOUSE      VVDHFG-RLDILVNNAGVN--------NEKNWEQTLQINLVSVISGTYLGLDYMSKQNGGEIINMSSLAG
DHI2_RABIT      TAHTTSTGLWGLVNNAGHNDVVAVELSPVATFRNCMEVNFFGALELT-KGLLPLLHHSRGRIVTLGSPAG
ADH2_CERCA      VVAKVK-YIDALINGAGI-----LTDPNVELT---MNINLIGLINTTLEGLPLMNKQGRGGVIVNASVLG
YLX6_SCHPO      VI-QTLGPIDVLINNAGLADDTPFEQLSHESWDHDVSLVLRGNYLTQRYVIPHMAKQGKGSIVNIGSVNG
FABG_CHLPN      FLDKHN-KIDILVNNAGITRDNLLMRMSEDDWQSVISTNLTSLYYTCSSVIRHMIKARSGSIINVASIVA
ADH_BACOL       VIAKVQ-YIDVLVNGAGI-----LTDPNVELT---MNINLIGLINTTLEAIPLMDKNKKGRIVNIASVLG
ADH1_CERCO      VIAKVQ-YIDVLVNGAGI-----LNDPNVEWT---MNINLIGLINTTLEAIPLMDKNKKGRIVNIASVLG
FABG2_BRANA     AMMKTAGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATXXXXXXXXXXXXXXASVVG
DLTE_BACSU      WALKEYPNLNVLVNNAGIQK-----EIDFKFVDDEIELNFQAPVHLSALFTPHLMKQPEAAIVQVTSGLA
VER1_ASPPA      TVRHFG-YLDIVSSNAGIVSFGHLKDVTPEEFDRVFRVNTRGQFFVAREAYRHMREG--GRIILTSSNTA
THR1_GLOLA      A-KQIWGRLDIVCSNSGVVSFGHVKDVTPEEFDRVFAINTRGQFFVAREAYKHL--EVGGRLILMGSITG
YD114_YEAST     AIERDHGXXXXXXXXAGVAHIKKLEHMTNKEVEQLIDINLIGAYRIISTFAEDMIDNREGFIINIASVLG
T4HR_MAGGR      AV-KIFGKLDIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHL--EIGGRLILMGSITG
DHGB_BACME      AI-KEFGKLDVMINNAGMENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKFVENDIKGTVINMSSVEW
Y4VI_RHISN      LLEKRFSRIEVLVNNAGIGPTAATADTALEDFQRALAINLVGAYSVACETAKLMKPGA--AIVNVASLAG
TSC10_CRYNE     CKPHADQAPDYVYLCAGFSRPKLFVETTKQELKDGLDGVYWVSAYTAHEACQMMSKQRRGKIIFVASFLS
DR4L2_HUMAN     MAVKLHGGIDILVSNAAVNPFGSLMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRXXXXXXXXXXXAA
TSC10_YARLI     ---------DVIFSCAGAAETGFILDFKASQLARAFSTNLFFVHGTTRMAKEPISPKNPRYVAIFSSVLA
TRNH1_ARATH     VSSMFGGKLDILINNLGAIRSKPTLDYTAEDFSFHISTNLESAYHLSQLAHPLLKASGCGNII-------
SDR2_ARATH      FVKTHFGKLDILINNAGVG--GVITDVDAELAEECIKINYYGPKRMCEAFIPLLQLSDSPRIINVSSFMG
FABG3_BRANA     VMMKTAGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATXXXXXXXXXXXXXXASVVG
FABG1_BRANA     VMMKTAGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATXXXXXXXXXXXXXXASVVG
YB45_SCHPO      TAIKKFGKLDSVILNAGVLEPIAIADADINEWRKLFDINFFSVVETVKYAIPHLRKT-KGTIVIVSSGAA
PHBB_CHRVI      ITEQVG-PIDILVNCAGITRDKTFKKMEQAHWEAVINVNLNSVFNVTRQVWDGMLERGFGRIINISSVNG
PGDH_MACFA      ------GRLDILVNNAGVN--------NEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEIINMSSLAG
PGDH_HUMAN      ------GRLDILVNNAGVN--------NEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEIINMSSLAG
FABI_HELPJ      NIKQDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTSVYSLIELTNTLKPLLNN---GASVLTLSYLG
YQC8_SCHPO      I-QKIFKEIHVVVANAGMPFRRSVLDSPPHEFEKVMNINTNSVYRVAYYMGKIFKKQGFGNLIATASMSA
FABI_HELPY      SVKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTSVYSLIELTNTLKPLLNN---GASVLTLSYLG
CBR1_RAT        FLLQEYGGLNVLVNNAGI----AFKVVDPTPFHIQAETNFFGTQDVCKELLPIIKPQ--GRXXXXXXXXX
MTDH_AGABI      I-DADLGAISGLIANAGVSVVKPATELTHEDFKFVYDVNVFGVFNTCRAVAKLLQKQQKGSIVVTXXXXX
KDUD_DICD3      F-----GKVDILVNNAGIIRREDAIEFSEKNWDDVMNLNIKSVFFMSQTVARQFIKQGHGKIINIASMLS
DHI2_HUMAN      TAHTTSTGLWGLVNNAGHNEVVADAELSVATFRSCMEVNFFGALELT-KXXXXXXXXXXXXIVTVGSPAG
DHI1L_HUMAN     ALDKLGGLDYLVLNHIGGAPAGARSPQATRWLMQ---VNFVSYVQLTSRALPSLT-DSKGXXXXXXXXXG
Y019_THEMA      TVEIYGG-VDVLVNNAAVMSVKSIFERPLEEWERVIRVNLTGPYICSRYCAEEMIKRGGGVIINIASTRA
PGDH_BOVIN      VVDHFG-KLDILVNNAGVN--------NEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGENINMSSLAG
DHB12_ANAPL     IYDRIRAGLEVLVNNVGISYSYPEYFIDVKTIDKMININIMSVCKMTRLVLPGMLERSKGVILNISSAAG
CBR1_BOVIN      FLRKEYGGLDVLVNNAGI----AFKTADTTPFHIQAETNFFGTRDVCTELLPLIKPQG------------
S16C6_HUMAN     QVRKEFGDVTILVNNADLVTGKPFLDIPDHMVEKSFLVNAI-THFWTCKALPAVIKANHGHLVCISSIAG
MKAR_MALGO      GLEQLIRHLDVLVNNVGLSHTMPVNEMDGRELASICQVNIVATMQVTRVVAPHLVRRGRGLILNLGSFSG
HSDL1_CHICK     ------REIGILVNNVGYTYPDYFTNLSEDMLWDMINVNIASANMMVHIVLPGMVEKRKGAIVNVSSASC
FABI_RICPR      IKEKWN-SFDFLLHGMAFANKNELKG---RYVETSLENFHNSLHISCYSLLELSRS---AETLMHNGG-S
FABG4_BRANA     AVDKWG-TIDVVVNNAG-------DTLLIRMKKSQWDLNLTGVFLCSQAATXXXXXXXXXXXXXXASVVG
ENTA_ECOLI      LLAET-ERLDALVNAAGILRMGATDQLSKEDWQQTFAVNVGGAFNLFQQTMNQFRRQRGGAIVTVASDAA
DHI1L_BOVIN     ALDKLGGLDYLVLNHLGAAPAGTRSSQSTRWLMQM---NFLSYVQLTSSALPSLT-DSKGXXXXXXXXXG
CSGA_MYXXA      --NVCTGPVDVLINNAGVGLWCALGDVDYADMARTFTINALGPLRVTSAMLPGLRQGALRRVAHVTSRMG
YDFG_DICNO      RLPEDWRAIDVLVNNAGLGQAPAHE---------------------------------------------
RD10B_DANRE     KVRSEVGDIDLLINNAGVVSGRHLLDCPDELIERTMMVNCHAHFWTTKAFLPKMLELNHGHIVTVASSLG
DHI1L_MACFA     ALDKLGGLDYLVLNHIGGVPAGARTPQATRWLMQ---VNFLSYVQLTSRALPSLT-DSKGXXXXXXXXXG
YWFH_BACSU      IFQKIEGRLDVLINNIPGGAPDTFDNCNIEDMTATFTQKTVAYIDAIKRASSLMKQNEFGRIINIVGNLW
RD10A_DANRE     KVRREVGEVDLLINNAGVVSGHHLLECPDELIERTMVVNCHAHFWTTKAFLPKMLEMNHGHIVTVASSLG
NODG_RHIME      --------VDILVNNAGITKDGLFLHMADPDWDIVLEVNLTAMFRLTREITQQMIRRRNGRIINVTSVAG
TSC10_EMENI     VTEWNDGMPDIVWCCAGYCTPGYFVETSVQTLKDQMDTVYWTAANTAHAILRHQRPLPRRHLIFTCSTLA
STCU_EMENI      QAVEHFGYLDIVSSNAGIVSFGHVKDVTPDEFDRVFRVNTRGQFFVAREAYRHLR-EGGRIILTSSNTAS
FABI_RICBR      VKEKWG-TFDFLLHGMAFSDRNELKGIDTSLFNNSLHISCYSLVELAREAEKLMNDGGYGKVIPNYNVMG
DH12A_DANRE     VYPKAGLEIGILVNNVGISYSYPIPDLE-NFITTMINVNITSVCQMTRLVLPRMEARAKGVILNISSASG
YVAG_BACSU      LGTEEGCNVDILVNNLGIFEPAEYFDIPDDEWFRFFEVNIMSGVRLTRRYLHNMIEKKEGRVIFIASEAA
SPS19_YEAST     TVEKF-GKIDFVIAGAAGNFVCDFANLSPNAFKSVVDIDLLGSFNTAKACLKELKK-SKGSILFVSATFH
PECR_PONAB      TLD-IFGKINFLVNNGGGQFLSLAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNVSIKTG
FABG_ACTAC      V--EAHGAYYGVVLNAGLTRDNAFPALTDEDWDRVLRTNLDGFYNVLHPIMMPMRRRKAGRIVCITSVSG
DHB8_HUMAN      VQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVG
DHB14_BOVIN     TIRRFG-RLDCIVNNAGYHPPPQWEETSAQGFRQXXXXXXXXXXXXXKLALPHLRK-SRGNVINISSLVG
UXUB_BACSU      ILGQFG-AVDLLINGAGGNHPDAITDVETRGFLTVFSTNFTGAFLASQVFGKELLKADSPAIINLSSMSA
RDH10_RAT       RVRKEVGEVSVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSLG
RDH10_MOUSE     RVRKEVGEVSVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSLG
RDH10_HUMAN     RVRKEVGEVSVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSLG
RDH10_BOVIN     RVRKEVGEVSVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSLG
HCD2_DROME      AKDKFG-RLDLTVNCAGTATAVKTFNFNKNVFQRVININTVGTFNVIRLSAGLMNQDGQGVIVNTASVAA
YJCD_SCHPO      FIAKE-EKLHILVNNAGI--MNPPFELTKDGYELQIQTNYLSHYLFTELLLPTLRRPGDVRIVHVASIAY
SRLD_ECOLI      GVDEIFGRVDLLVYSAGIAKAAFISDFQLGDFDRSLQVNLVGYFLCAREFSRLMXXXXXXXXXXXNSKSG
YJGI_ECOLI      VVRKSG-ALDILVVNAGIGVFGEALELNADDIDRLFKINIHAPYHASVEAARQMPEG--GRILIIGSVNG
YHXD_BACSU      -----------------------IEDLPTEQIYKTFEVNVFSLYWVVKAALPYLPEG--ASIITTTSVEG
XYLL_PSEPU      ALERFG-RLDILINNVGGTWAKPFEHYQEREIEAEVRRSLFPTLWCCHAALAPMIEQGSGAIVNVSSV--
DHRS1_MOUSE     VDREQKGRLDVLVNNAYAGPASIWDDINNVGLRGHYLCSVYG--------ARLMVPAGKGLIVIVSSPGG
DECR2_DANRE     TL-KTFGRVDILINNAAGNFLCPATSLSFNAFKTVMEIDTMGTFNTSKVIYDKWFKDHGGSIVNISATLG
RDH10_XENTR     RVRREVGDVYLLLNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPKMMEMNHGHIVSVASSLG
RD10B_XENLA     RVRREVGDVYLLLNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPKMMEMNHGHIVSVASSLG
MTDH_ALTAL      VI-KDFGKVDVFIANAGKTADNGILDATVEQWNEVIQTDLTGTFNCARAVGLHFRERKTGSLVITSSMSG
MNR1_CAPAN      LIKTKFGRLDILINNAGIGDVQVLKEILERYIKECIETNYYGAKRMTEAFIPLLQLSNSPRIVNVASSMG
Y7799_EMENI     EANKL-PPFDTVIHNAGIGYATASQEITADKISAVFAVNTLAPYILT-----------------------
Y4MP_RHISN      VLSAFGVA-NILINNAGITQPVKTLDISDADWQRIVAVNMTGVLNLSQVFIPNMRQNGGGSIACMSSV--
Y1430_HAEIN     ---------------------------------QMIDTNIKGLVTITRLVLPNMVARNYGQIINLSSIAG
RD10A_XENLA     RVRREVGDVYLLLNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPKMMELNHGHIVSVASSLG
PECR_RAT        TLAKYG-KINFLVNNAGGQFMAPAEDITAKGWQAVIETNLTGTFYMCKAVYNSWMKDHGGSIVNIIVLLG
KDUD_ECOLI      F-----GHIDILVNNAGLIRREDALEFSEKDWDDVMNLNIKSVFFMSQAAAKHFIAQGNGKIINIASMLS
DHRS4_PONAB     AV-KLHGGIDILVSNAAVNPFGSLMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRXXXXXXXXXXXAA
DHR12_BOVIN     VENKQEHTLNVLINNAGC--MVNKRELTEDGLEKNFATNTLGVYVLTTALIPVLEKEHDPRVITVSS---
DHB3_RAT        HIEEQGLEIGVLVNNVGM----LPNLLPSHFLSTSGESNITSVVKMTQLVLKHMESRRRGLILNISSGVG
PECR_HUMAN      TLD-TFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNVPTKAG
HSDL2_HUMAN     AIKKFGG-IDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASKACIPYLKKSKVAHILNISPPLN
HDHA_CLOSO      TIIKNEGKIDILVNNFGTGRPEKDLDLDEDTFFELFNYNVGSVYRLSKLIIPHMIENKXXXXXXXXXXXX
FABI_RICFE      IKEKWG-SFDFLLHGMAFADKNELKG-------RYVDTSLENFHNSLHISCYXXXXXXXXXXXXMHDGGS
BZRD_BACSU      LLSSIDSSGITLINNAGMGEASLDE------LQRHYQLNLTAPVLLSQLFTKRFASYS-GKKTVVNITSG
SOU1_SCHPO      AVEELGGRLDVMIANAGIAIPHSLEDKNEDIWTKVVGINLNGAYYTAQAAGHHFKKQGKGSLIFTASMSG
MFNA_META3      RNNKNDISVDGIVGIAGCTELGAIDNI--KELSKIAEQNNIFLH--------------------------
ILVC_GEOKA      ----------------------------------------------------------------------
DHRS4_HUMAN     AV-KLHGGIDILVSNAAVNPFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRXXXXXXXXXXXAA
STDH2_CAEEL     V------SVGILINNVGHKINGGIDSIANVII-----INTLPATLLSAGILPQMVSRKAGIIVNIGSFAG
PTMA_CAMCO      AFEKYS-KIDGFVNSSDWGKI-AYYEASYEQICESLNLHLGGFILASQEFVKFFKKQSYGNIINLSSIMG
FABG_ARATH      ALDKWG-TIDVVVNNAGITRDTLLIRMKQSQWDEVIALNLTGVFLCTQAAVXXXXXXXXXXXXXXSSVVG
DHB3_MOUSE      LEGLENG---ILVNNVGMXXXXXXXXXXXXXGESQIHCNITSVVKMTQLVLKHMESRRKGLILNISSGAA
ADHR_DROIM      --------IDVLINGATL--------CDEQNIDDTINTNLTGMMNTCATVLPYMDKQQLGKIVNVTSVVG
SDR1_PICAB      TAEHAFGPLHIVVNNAGVTDSKTLAQTSDEEWDRIFQVNCKGAFLCSREAAKXXXXXXXXXXXXXXXXLV
ILVC_LACLS      ----------------------------------------------------------------------
ILVC_LACLM      ----------------------------------------------------------------------
FABG_RICCN      NLISKASKLDILVCNAGITSDTLAIRMKDEDFDKVIDINLKANFILNREAIKKMIQNRYGRXXXXXXXXX
CAPD_RICB8      V--------DYVFHAAALKQVPTCE----FYPMEAINTNILGAEN-------VLRAATINKVAKVIVLST
ILVC_STRSV      ----------------------------------------------------------------------
ILVC_STRGC      ----------------------------------------------------------------------
HSDL2_PONAB     AIKQFGG-IDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASKACIPYLKKSKVAHILNISPPLN
DHR12_HUMAN     ---KQEHKLHVLINNAGC--MVNKRELTEDGLEKNFAANTLGVYILTTGLIPVLEKEHDPRVITVSS---
ADH_ZAPTU       IFDKLK-TIDLLINGAGI--------LDDHQIERTIAVNFTGLVNTTTAILQFWRKGGPGGVIANCSVTG
ADH2_DROWH      IFDKLK-TVDILINGAGI--------LDDYQIERTIAVNFTGTVNTTTAIMSFWRKGGPGGIIANCSVTG
Y3820_MYCBO     KMIESGGDVDVAI--VAFGLLGDAEELNQRKAVQIAEINYTAAVSVGVLLAEKMRAQGFGQIIAMSSAAG
Y3791_MYCTU     KMIESGGDVDVAI--VAFGLLGDAEELNQRKAVQIAEINYTAAVSVGVLLAEKMRAQGFGQIIAMSSAAG
MKAR_YARLI      ---ETIPSVSILINNVGLSHS-----IPTPFLETPPAENIIAINNLSVKEARATKKFQKGLILTMGSFGG
LE767_CAEBR     TLNKV--EIGVLVNNVGYEYPDVLHKVDIERLAXXXXXXXXXXXXXSAGILPQMVARKAGVIVNVGSSAS
ADHR_DROTE      M-----DYIDVLINGATL--------CDENNIDATINTNLTGMMNTVATVLPYMDRQSGGLIVNVTSVIG
ADHR_DROMA      M-----DYIDVLINGATL--------CDENNIDATINTNLTGMMNTVATVLPYMRKMGGGLIVNVTSVIG


                         +         .         .         .         .         *         .:210
query           LVAMKYRGAYNASKYAIEGLTDTMRLELRDSNIFITSLNTGPITSKFRENSIKTITNVNYDSSVHKQQYE
YBBO_ECOLI      LISTPGRGAYAASKYALEAWSDALRMELRHSGIKVSLIEPGPIRTRFTDN-------------VNQTQSD
YBBO_ECOL6      LISTPGRGAYAASKYALEAWSDALRMELRHSGIKVSLIEPGPIRTRFTDN-------------VNQTQSD
VDLC_HELPY      RVSMLFLGHYSASKHALEAYSDALRLELKPFNVQVCLIEPGPVKSNW-EKTAFSVENFESEDSLYALE--
VDLC_HELPJ      RVSMLFLGHYSASKHALEAYSDALRLELKPFNVQVCLIEPGPVKSNWEKTAFENALEVNAAKSFYSGVYQ
YUSZ_BACSU      LTGFPALSPYVSSKHALEGFSESLRIELLPFGIETALIEPGSYKTSIWSTSLSNFMSVPADDSAYHQYYK
YQ53_SCHPO      YYPSPCLSMYNASKFAVEGLSQTIMRELDPNNIAITIVQPGGMQTEWASSNMQ-----------------
RDH8_HUMAN      LQGVIFNDVYAASKFALEGFFESLAIQLLQFNIFISLVEPGPVVTEFEGKLLAQVSMAEF----------
YAEB_SCHPO      YVPXXXXXXXXXXXXXXXXXXNTLRIELAPFGVQVTSIMTGGVQTKIQSKPLGTMTEAAIPENSIYYPYR
YQJQ_BACSU      KIATPKSSLYSATKHAVLGYSNALRMELSGTGIYVTTVNPGPIQTDF-----------------------
H17B6_RAT       RVAL-FGGFYSCSKYGVEAFSDVLRREIRDFGVKVSIIEPGSFKTRMTD---------------------
YXJF_BACSU      LVGFAGKSAYNSAKHGVIGLTKVGALEGAPHGITVNALCPGYVDTQLVRNQLSDLSNVPYDS--------
DRS7B_DANRE     KISIPYRSAYAASKHAMQAYYDCLRAEVDSLGLHVSVLSPGYVRTNMSINAV------------------
RDH8_BOVIN      LQGVVFNEVYAASKFAMEGFFESLAVQLLQFNIFISLVEPGPVVTEFEGKLLEQVSTAEFGTDPDTLSYF
BDH_MOUSE       RMANPARSPYCITKFGVEAFSDCLRYEMHPLGVKVSVVEPGAATSLYSPERIQAIAKKMWDDEVVRKDYE
AYR1_YEAST      VVSFPFGSIYSASKAAIHQYARGLHLEMKPFNVRVINAITGGVATDIADKRPLPETSINFPEGREAFNSR
DRS7B_XENTR     KISIPFRSAYSASKHATQAFFDCLRAEMSPYEIDVTVVNPGYIKTNLSLNAV------------------
BDHA_RHIME      LVASPFKSAYVAAKHGIMGLTKTVALEVAESGVTVNSICPGYVLTPLVEKQI------------------
BACC2_BACSU     VVAWPDIPAYNASKGGVLQLTRSMAVDYAKHNIRVNCVCPGIIDTPLNEKS-------------------
DRS7B_MOUSE     KISIPFRSAYSASKHATQAFFDCLRAEMEEANIKVTVISPGYIHTNLSVNAV------------------
DRS7B_XENLA     KISIPFRSAYSASKHATQAFFDCLRAEMSPYDIDVTVVNPGYIKTNLSLNAV------------------
BDH_RAT         RMANPARSPYCITKFGVEAFSDCLRYEMHPLGVKVSVVEPGAATSLYSPERIQAIAKKMWDEEVVRKDYE
DHB1_RAT        LMGLPFHEVYCASKFALEGLCESLAILLPLFGVHVSLIECGAVHTAFHE---------------------
Y2778_STAA8     FEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMV---------------------------
Y2488_STAAC     FEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMV---------------------------
Y2422_STAA3     FEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMV---------------------------
DHRS9_RAT       RLAFG-GGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPG-----------------------------
DHRS7_ANOGA     KFAIPHRSAYSASKHAMQAFCDSLRAEVAKDNIKVTLISPGYINTALSLNAL-TGTGASY----------
Y2403_STAAW     FEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMV---------------------------
Y2370_STAAS     FEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMV---------------------------
DHRS7_HUMAN     IISVPLSIGYCASKHALRGFFNGLRTELATPGIIVSNICPGPVQSNIVENSLKTIGN-NGDQS-HK----
BDH_BOVIN       RMANVARSPYCITKFGVEAFSDCLRYEMHPLGVKVSVVEPGAATSLYGTERIQAIANKMWEEEVVRQDYE
H17B6_MOUSE     RVAL-FGGFYSCSKYGVEAFSDVLRHEVQDFGVKVSIIEPGSFKTEMTD---------------------
DHB1_HUMAN      LMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTHRFY
DRS7B_PONAB     KISIPFRSAYAASKHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAV------------------
DHB1_PANTR      LMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTHRFY
DRS7B_HUMAN     KMSIPFRSAYAASKHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAI------------------
DR9C7_MOUSE     RVAI-FGGGYCVSKFGVEAFSDSIRRELHFFGVKVSIIEPGNYTSILGQEALESRMKKLWDDSYGEEYFQ
Y2478_STAAM     FEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMV---------------------------
Y2266_STAAN     FEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMV---------------------------
DRS7B_BOVIN     KISLPFRSAYAASKHATQAFFDCLRAEVEQHDIEVTVISPGYIHTNLSLNAV------------------
DHRS9_BOVIN     RLAFG-GGGYSPSKYAVEGFNDSLRRDMKAFGVHVACIEPGLFKTNLEKTAEKKLAIWKHLSPDIKQQYE
YI78_SCHPO      KMTFPLGCLYYGTKYAIEGISEALTWEMQSIGVKVKIIEPGFTATEFRVEEGAGKHYAEYD-NLKQKLYE
DHRS9_HUMAN     RLAI-VGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPG-----------------------------
TRN1_DATST      FSALPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVILTPLVETAIK-----------------
DHRS7_DROME     KFAIPQRAAYSASKHAMQAFADSLRAEVANKNINVSCVSPGYIRTQLSLNAL-TGSGSSYETTAKGMSPD
DHB1_MOUSE      LMGLPFHEVYCASKFALEGLCESLAILLPLFGVHVSLIECGAVHTAFYEKLV------------------
TRN2_HYONI      ASALPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSMVEMTIQ-----------------
DRS7B_RAT       KISIPFRSAYAASKHATQAFFDCLRAEMKDSDIEVTVISPGYIHTNLSVNAV------------------
DHRS9_MOUSE     RLAFG-GGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTELADTTEKKLAIWKHLSPDIKQQYE
ACT3_STRCO      KQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGPMAASVREH--------------------
Y2049_STAEQ     FEPTKTNAVYGATKAAIHAITQSLEKELARTGVKVTSISPGMVDTPMTEGT-------------------
Y2036_STAES     FEPTKTNAVYGATKAAIHAITQSLEKELARTGVKVTSISPGMVDTPMTEGT-------------------
Y1627_STAS1     HVVFPGSAVYCGTKYAVRAITEGLRQEIVGSNIRTTILSPGAVSTELTDH--------------------
DHR11_HUMAN     VLPLSVTHFYSATKYAVTALTEGLRQELREAQTHITCISPGVVETQF-----------------------
YKVO_BACSU      SIGNPAFSVYGASKAALRALVRNWILDLKGTEIRVNVVSPGGI---------------------------
Y452_LISIN      LKAYPGGAVYGATKWAVRDLMEVLRMEIRTATIYPAAINTELLETITDKETEQGMTNLYKQYGVTPDRIA
FABG_STAES      AMGNPGQANYVATKAGVIGLTKTAARELASRGITVNAVAPGFIVS-------------------------
FABG_STAEQ      AMGNPGQANYVATKAGVIGLTKTAARELASRGITVNAVAPGFIVS-------------------------
BDH_HUMAN       RMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGAATSLYSPESIQAIAKKMWEEEVVRKDYE
Y2567_STAAR     FEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMV---------------------------
DHR11_BOVIN     VPPPAETHFYSATKYAVTALTEGLRQELRESHIRATCISPGVVETQF-----------------------
BACC_BACAM      VVAWPDIPAYNASK--------------------------------------------------------
TRN2_DATST      ALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIQ-----------------
PHBB_RHIME      QKGQMGQVNYSAAKAGDLGLTKALAQEGAAKGITVNAICPGYI---------------------------
FABG_BACSU      VSGNPGQANYVAAKAGVIGLTKSSAKELASRNITVNAIAPGFISTDMTDKLAKDV---------------
Y325_THEMA      LIGIPRRCVYSVSKAALLGLTRSLAVDYVDYGIRVNAVCPGTTQSEGLMARVKASPN-------------
H17B6_HUMAN     RVAF-FVGGYCVSKYGVEAFSDILRREIQHFGVKISIVEPG----YFRTG----MTNMTQSLERMKQSWK
UCPA_SALTY      MVADPGETAYALSKAAIVGLTKSLAVEYAQSGIRVNAICPGYVRTPMAE-SIARQSNPDDPESVLTEMAK
UCPA_SALTI      MVADPGETAYALSKAAIVGLTKSLAVEYAQSGIRVNAICPGYVRTPMAE-SIARQSNPDDPESVLTEMAK
RDH16_HUMAN     RVSL-FGGGYCISKYGVEAFSDSLRRELSYFGVKVAMIEPGAVTSK--ERFLKSFLEIDRSSPEVKEAYE
KDUD_BACSU      FQGGILVPAYTASKHAVAGLTKSFANEWAASGIYISTANTKPIRDDEKRN--------------------
DHRS4_RABIT     FNPFSGLGPYNVSKTALVGLTKNLALELAAQNIRVNCLAPGLIKTSF-----------------------
BACC_BACSU      LVAWPDIPAYNASKGGVLQLTKSMAVDYAKHQIRVNCVCPGIIDTPLNEKS-------------------
RDH2_RAT        RLSF-CGGGYCISKYGVEAFSDSLRRELSEPGFFRTDVTNGTLSSNFQSSEVREVYGENYLAS-----YL
PHAB_ACISR      LKGQFGQANYSASKAGIIGFTKALAQEGARSNICVNVVAPGPMVTAMREDVIKSI---------------
LVR_LEIAQ       IRGIGNQSGYAAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVENSMKQLDPEN-----------
Y432_LISMO      LKAYPGGAVYGATKWAVRDLMEVLRMEIRTVTIYPAAINTETITDKETEQGMTSL---------------
RDH3_RAT        RMSL-VGGGYCISKYGVEAFSDSLRRELTYFGVKVAIIEPG----GFKTN----VTNMERLSDNLKKLWD
RDH7_RAT        RMSL-LGGGYCISKYGVEAFSDSLRRELTYFGVKVAIIEPG----GFKTN----VTNMERLSDNLKKLWD
PHAB_PARDE      QKGQAGQANYSAAKAGDLGFTKALAQEGARAGITVNAICPGYI---------------------------
FABG_RICPR      IAGNPGQANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKS-------------------------
FABG_HAEIN      STGNPGQTNYCAAKAGVVGFSKSLAKEVAARGITVNVVAPGFIATDMTE---------------------
DHRS7_MOUSE     IASVSLSSGYCASKHALRGFFNALHSELQYPGITFCNVYPGPVQSAFTEEVTKSMRN-NIDQS-------
RDH7_MOUSE      RVSL-CGGGYCISKYGVEAFSDSLRREISYFGVKVAIIEPGGFVSNYERLSHSIEKLWDQTSSEVKEVYD
FABG_CUPLA      LVGNAGQANYSAAKAGVIGFTKTVAREYASRNINVNAVAPGFISS-------------------------
YM71_YEAST      RDAYPTGSIYCASKFAVGAFTDSLRKELINTKIRVILIAPGLVETEF-----------------------
KDSR_HUMAN      QLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVYIT----------------------------------
DHR11_MOUSE     VPPQSVIHFYSATKYAVTALTEGLRQELLEAQTHITCISPGLVETQF-----------------------
YOXD_BACSU      QRGAAVTSAYSASKFAVLGLTESLMQEVRKHNIRVSALTPSTVAS---DMSIENLTDGNPEKVMQPEDLA
TRNH_DATST      VIAVPLSSIYAASKGAINQVTKSLACEWAKDSIRVNAV--------------------------------
DRS7C_XENTR     KIGVPFRAAYAASKHAIQGFFDCLRAEVEEFDVSVSTVSPTFIRSYHVQPQ-----PGNWEASIWKFFFR
CPNA_COMTE      LVGAPGAAAYEASKGAVRLFTKACAVDLAPFNIRVNSVHPGVIAT-------------------------
CPNA_COMS9      LVGAPGAAAYEASKGAVRLFTKACAVDLAPFNIRVNSVHPGVIAT-------------------------
DHI1_HUMAN      KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
Y945_MYCTU      VKGVPVKAAYAASKAGVRSLGESLRAEYAQRPIRVTVLEPGYIESEMTAKSASTMLMVDNATGV------
KDSR_MOUSE      QLGLFGFTAYSSSKFAIRGLAEALQMEVKPYNVYVT----------------------------------
DR9C7_BOVIN     RVAV-IGGGYCISKFGVEAFSDSIRRELHYFGVKVSIIEPG-----------------------------
MAS12_AGRRH     QRVLNPFVGYNMTKHALGGLTKT-----------------------------------------------
FABG_BUCAP      YLGNRGQINYSASKSGLIGFHKSLALEVAQKGITVNIVSPGFIKTNLTKN--------------------
DHKR_STRCM      KQGVVLGAPYSASKHGVVGFTKALGNELAPTGITVNAVCPGYVETPMAQR-VRQGYAAAYDTT-----EE
GNO_GLUOX       ELARPGIAPYTATKGAVKNLTKGMATDWGRHGLQINGLAPGYFATEMTERLV------------------
KDSR_BOVIN      QLGLFGYTAYSSSKFALRGLAEALQMEVKPYNVYVT----------------------------------
FABG_VIBHA      TMGNAGQTNYAAAKAGVIGFTKSMAREVASRGVTVNTVAPG-----------------------------
FABG_VIBCH      TMXXXXXXXXXXXXXXVIGFTKSMAREVASRGVTVNTVAPG-----------------------------
DHB2_MOUSE      TVPLQMTSAYAATKAALTMFSTIIRQELDKWGVKVVTIKPGGFKTNITDKMEKEILD-HFSKDIQENYGQ
CBR2_PIG        HVTYPGLAAYSSTKGAMTMLTKSMAMELGPHKIRVNSVN-------------------------------
BUDC_KLEPN      HVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPG-----------------------------
HSD_MYCTU       LAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPGPMTDWVPEDIFQT----------------
HSD_MYCBO       LAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPGPMTDWVPEDIFQT----------------
BDH_CHICK       RMGSPARSPYCITKFGVEAFSDCLRYEMQPQGVMVSIVEPGAVTNLYSPERIKAIADKMWDEIVRKDYGR
YGCW_ECOLI      YLGGQWSPAYSATKHALAGFTKAYCDELGQYNIQVNGIAPG-----------------------------
SDH_RHIRD       HYPYLGGNVYGGTKAFLRQFSLGLRSDLHGKGVRVTSIEPGMCETEF-----------------------
FABG_AQUAE      FTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPG-----------------------------
KDSR_DICDI      LVGVPGYSTYCPSKFALRGLAETLRSELKPYKI-------------------------------------
DR9C7_HUMAN     RVAV-IGGGYCVSKFGVEAFSDSIRRELYYFGVKVCIIEPGNYRTAIKENLESRMRKLQETRDSYGEDYF
BDH2_MOUSE      SIGVENRCVYSATKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARDN-------------
Y4EK_RHISN      LAPHPNSSVYGATKAAVSLFSSALRCDLIGLPIRVTELFPGRVETNLYRTAL------------------
FABG_PSEAE      AMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPG-----------------------------
BUTA_STAEQ      HESYEVLGTYSATKHSVRSFTQTAAKELADKGITVNAYCPG-----------------------------
DHI1_SAISC      KVAYPMISAYSASKFALYGFFSSIRKEMSEVNVSITLCVLGLIDT---DTAMKAVSGIIKMQAARKEE--
DHI1_MESAU      KMAHPLVASYSASKFALDGFFSSLRREVTNVNVSITLCVLGLINT---ETAMKATSGV------------
FABG_SHIFL      TMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPG-----------------------------
FABG_MYCAV      MWGIGNQANYAAAKAGLIGMARSISRELSKAGVTANVVAPGYIDTE------------------------
FABG_ECOLI      TMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPG-----------------------------
Y0419_STAS1     FEVTKKSTLYSASKAAVHSITQGLEKELAKTGVRVTSISPGMV---------------------------
FABG_STAAW      AVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVS-------------------------
FABG_STAAS      AVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVS-------------------------
FABG_STAAR      AVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVS-------------------------
FABG_STAAN      AVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVS-------------------------
FABG_STAAM      AVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVS-------------------------
FABG_STAAC      AVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVS-------------------------
DHR11_CHICK     VVPQSVVHFYSATKYAVTALTEGLRQELREAKTHITCISPGLVETGF-----------------------
DHB2_HUMAN      GAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKW-EKLEKDILDHQEDYD
ACR1_ACIBI      LANATRFSAYVASKAALDAFSRCLSAEVLKHKISITSI--------------------------------
ACR1_ACIAD      LANATRFSAYVASKAALDAFSRCLSAEVLKHKISITSI--------------------------------
YXNA_BACSU      DRGTVIQSTYASAKFALHGWTESIRMELEQAPVSVTLIHPGRIDTPYNEHA-------------------
YVRD_BACSU      VKPLPTMIPYSMTKTALISLSRGMAEMTKGTNVTVNSVLPGP----------------------------
RDH1_HUMAN      RLAAN-GGGYCVSKFGLEAFSDSLRRDVAHFGIRVSIVEPGPVTN--LESLEKTLTQAHY-GGAFLTKYL
NODG_AZOBR      VKGQAGQTNYSAAKAGVIGFTKALAAELATKGVTVNAIAPGYI---------------------------
HCDR_XANP2      LVAFPGRSAYTTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMI---------------------------
DHI1_RABIT      KIAHPLIAPYSASKFALDGFFSAIRKELTNVNVSIT----------------------------------
DHB11_PONAB     HVSVPFLLAYCSSKFAAVGFHKTLTDELAALQI------TGVKTTCLCPNFVNTGFIKNPSTSLG-----
BUDC_KLETE      HVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGFCPG-----------------------------
Y1385_MYCBO     KVGMVGQTNYSAAKAGIVGMTKAAAKELAHLGIRVNAIAPGLIRSAMTE---------------------
Y1350_MYCTU     KVGMVGQTNYSAAKAGIVGMTKAAAKELAHLGIRVNAIAPGLIRSAMTE---------------------
DHI1A_XENLA     RIGAPFTTSYCASKFALEGFYSSLRRELQNSNMSVTVAVLGYIDT---ENAVKKVGN-------------
DHB2_RAT        MIPFQMVAAYASTKAAISMFSAVIRQELAKWGVKVVTIHPGKMEKEILDHFSKEIQENYGQEYVHTQKLA
DER_CHICK       QRALRDHAVYCSTKSALDMLSKVMAMELGPHKIRVNTVN-------------------------------
GS39_BACSU      YVGNPTLIDYTATKGAINAFTRTMAQALVKDGIRVNAVAPGPI---------------------------
FABL_BACSU      IRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAI---------------------------
BUTA_STAES      HESYEVLGTYSATKHSVRSFTQTAAKELADKGITVNAYCPG-----------------------------
DHRS4_BOVIN     YSPFPSLGPYNVSKTALLGLTKNLALELAESNVRVNCLAPGLIRTSF-----------------------
DHI1_MOUSE      KMTQPMIAPYSASKFALDGFFSTIRTELTKVNVSITLCVLGLIDTETAMKEISGIIN-------------
DHB11_HUMAN     HVSVPFLLAYCSSKFAAVGFHKTLTDELAALQI------TGVKTTCLCPNFVNTGFIKNPSTSLG-----
YXBG_BACSU      RAADLDRSGYNAAKGGITNLTKAMAIDYARNGIRVNSISPGTI---------------------------
YDFG_SHIFL      SWPYAGGNVYGATKAFVRQFSLNLRTDLHGTTVRVTDIEPG-----------------------------
UCPA_ECOLI      MVADPGETAYALTKAAIVGLTKSLAVEYAQSGIRVNAICPGYVRTPMAE-SIARQSNPEDPESVLTEMAK
UCPA_ECO57      MVADPGETAYALTKAAIVGLTKSLAVEYAQSGIRVNAICPGYVRTPMAE-SIARQSNPEDPESVLTEMAK
FOX2_YEAST      LFGNFGQANYSAAKMGLVGLAETLAKEGAKYNINVNSI--------------------------------
DRS7C_BOVIN     KLGIPFRTAYAASKHAALGFFDCLRAEVEEYDVVVSTVSPTFIRSYHVDPG-----QGNWEASIWKFFFR
RIDH_KLEAE      VVPVIWEPVYTASKFAVQAFVHTTRRQVAQYGVRVGAVLPGPVVT-------------------------
PHBB_RALEH      QKGQFGQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIAT-------------------------
DHI1_RAT        KMTQPLIASYSASKFALDGFFSTIRKEMTKVNVSITLCVLGFIDT---ETALKETSGIILSQAAPKEE--
CBR4_DANRE      VKGNAGQCVYSASKAGLEGFTRSLAKEVASRNIRVNLVAPGLI---------------------------
YDFG_ECOL6      SWPYAGGNVYGATKAFVRQFSLNLRTDLHGTAVRVTDIEPG-----------------------------
PHBB_ZOORA      QKGQMGQANYSAAKAGDLGFTKALAQEGAAKGITVNAICPGYI---------------------------
FABG_MYCTU      SWGIGNQANYAASKAGVIGMARSIARELSKANV-------------------------------------
FABG_MYCBO      SWGIGNQANYAASKAGVIGMARSIARELSKANV-------------------------------------
BUTA_STAAW      VEGNPGLSLYCSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMES--------------------
BUTA_STAAS      VEGNPGLSLYCSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMES--------------------
BUTA_STAAR      VEGNPGLSLYCSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMES--------------------
BUTA_STAAN      VEGNPGLSLYCSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMES--------------------
BUTA_STAAM      VEGNPGLSLYCSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMES--------------------
BUTA_STAAC      VEGNPGLSLYCSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMES--------------------
YI13_SCHPO      RESYVGGSVYCSTKSALAQFTSALRKETIDTRIRIMEVDPGLVETEF-----------------------
Y484_MYCTU      IEVYDGGAGYTAAKHAQGALHRTLRGELLGKPVRLTEIAPGAVETEF-----------------------
MAS11_AGRRH     QRVLNPLVGYNMTKHALGGLTKT-----------------------------------------------
FABG_BUCAI      YTGNKGQVNYSASKSGLIGFHKSLALEVASKGITVNIVSPGLIKTNFTE-KLNSIQYQKYLSNIPMKRF-
DHI1L_XENTR     KTPIPYTTSYAASKFALEGFFSSLRHELTMQNVSITLCILGLIDTQSAMEKIKKITMSAYPAS-------
GRDH_DAUCA      YKGNAKLLDYTATKGAIVAFTRGLSLQLISKGIRVNGVAPGPIPSSFDEEEVK-----------------
GRDH1_ARATH     YKGNASLLDYTATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIPASFNEEKIK-----------------
FOX2_CANTR      LYGNFGQANYASAKSALLGFAETLAKEGAKYNI-------------------------------------
FABG_MYCS2      MWGIGNQANYAAAKAGLIGMARSISRELAKAGVTANVVAPGYIDTE------------------------
FABG1_SYNY3     MMGNPGQANYSAAKAGVIGFTKTVAKELASRGVTVNAVAPGFIATDMTEN--------------------
YDFG_ECO57      SWPYAGGNVYGATKAFVRQFSLNLRTDLHGTAVRVTDIEPG-----------------------------
GRDH2_ARATH     YAGNSSLLEYTATKGAIVSFTRGLALQLAPKGIRVNGVAPGPIPASFSEEAIK-----------------
FABG_THEMA      XXXXPGQTNYAASKAGVIGMTKTWAKELAGRNIRVNAVAPGPMTEKLPEKARET----------------
DRS7C_MOUSE     KFGIPFRTAYAASKHAVMGFFDCLRAEVEEYDVVVSTVS-------------------------------
DRS7C_HUMAN     KFGIPFRTTYAASKHAALGFFDCLRAEVEEYDVVISTVSPTFIRSVYPEQG-------NWEASIWKFFFR
CBR2_MOUSE      HVTFPNLITYSSTKGAMTMLTKAMAMELGPHKIRVNSVN-------------------------------
YDFG_SALTY      SWPYAGGNVYGATKAFVRQFSLNLRTDLHGTAVRVTDIEPG-----------------------------
YDFG_SALTI      SWPYAGGNVYGATKAFVRQFSLNLRTDLHGTAVRVTDIEPG-----------------------------
YDFG_ECOLI      SWPYAGGNVYGATKAFVRQFSLNLRTDLHGTAVRVTDIEPG-----------------------------
IDNO_ECOLI      ELGRDTITPYAASKGAVKMLTRGMCVELARHNIQVNGIAPG-----------------------------
IDNO_ECOL6      ELGRDTITPYAASKGAVKMLTRGMCVELARHNIQVNGIAPG-----------------------------
FABG_RICTY      IAGNPGQANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKS-------------------------
FABG_BUCBP      HIGNCGQTNYSAAKLGLVGFHKSLALELAPKGITVNMIAPGLIKTGMTNN--------------------
BDHA_RALEH      LVASAQKSAYVAAKHGIVGFTKVTALETAQTGVTANAICPGWVLTPLVQKQVE-----------------
RDHE2_HUMAN     LSGVNGLADYCASKFAAFGFAESVFVE----------------TFVQKQKGIK--TTIVCPFFIKTGMFE
MAS1_AGRT9      QRVANSLVGYNMTKHGLAGLTKT-----------------------------------------------
DHI1_CAVPO      KITYPLIAPYSASKFALDGFFSTLRSEVNKVNVSITLCILGLIDT---ETAIKATSGIYLGPASPKEE--
DHB13_MOUSE     HGVIPYLIPYCSSKFAAVGFHRALTAELKTSCLCPVFVNTG-----FTKNPSTRLWPVLEPEEVARSLIN
LINC_PSEPA      VVGVPMHGEYVGAKHAVVGLTRVAAADYGKHGIRVNALVPGAVRTPMLQRAMDNDAGLEYLNSIH-----
FABG_RICBR      VSGNPGQANYCASKAGLIGMTKSLAYEVATRGITVNAVAPGDMTDKLNDEQKEAIT--------------
FABG_CHLMU      LRGSPGQTNYAAAKAGIIGFSKALSKEVGSKNIRVNCIAPGFIDTDMTKGLSDNLKN-------------
DHI2_RAT        DMPYPCLAAYGTSKAAIALLMDTFSCELLPWGIKVSIIQPGCFKT-------EAVTNVN----LWEKRKQ
YF3H_SCHPO      VVVPQQQCAYNTSKAGVIQLIKSLAVEWR-----------------------------------------
FOX2_NEUCR      LFGNFGQANYSAAKLGMVGFTETLAKEGLKYNI-------------------------------------
DS7CA_DANRE     KLALPFRTCYAASKHAVQAFFDCLRAEVEEFGISVSTIS-------------------------------
DHB11_MOUSE     HTVVPFLLAYCSSKFAAVGLTDELRTGVRTSCLCPNFINTG-----FIKNPSTNLGPTLEPEEVVEHLMH
CBR1_MOUSE      LRALKNCRLELQQKFRSETITEEELVGL--MNKFVEDTKKGVHAEEGWPNSAYGVTKI------------
RDH1_BOVIN      RLAAN-GGGYCVSKFGLEAFSDSLRRDVAPFGVRVSIVEPGPVTN-------------------------
HSD_STREX       LMGLALTSSYGASKWGVRGLSKLAAVELGTDRIRVNSVHPG-----------------------------
DHI1B_XENLA     RIGAPFTTSYCASKFALEGFYSSLRRELQNSKMSVTVAVLGYIDT---ENAVKKVGN-------------
DHB4_MOUSE      IYGNFGQANYSAAKLGILGLCNTLAIEGRKNNIHCNTI--------------------------------
DHB13_RAT       HRVIPYLIPYCSSKFAAVGFHRALTAELKTSCLCPVFVNTG-----FTKNPSTRLWPVLEPDEVARSLID
DHB11_MACFA     HISVPFLLAYCSSKFSAVGLTDEL-AALQITGVKTTCLCPNFVNTGFIKNPSTSLGPALEPEEVVNRLMN
FABG_CHLTR      LRGSPGQTNYAAAKAGIIGFSKALSKEVGSKNIRVNCIAPGFIDTDMTKSLNDNLKN-------------
DHB13_HUMAN     HEGIPYLIPYCSSKFAAVGFHRGLTSELQ-----------------------------------------
BAIA2_EUBSP     IFGSLSGVGYPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNT-------------------------
ADH2_CERRO      LEPCPPAAAYCASKFGVMGFS-------------------------------------------------
ADH2_CERCO      LEPCPPAAVYCASKFGVMGFS-------------------------------------------------
DHK1_STRVN      KQGVVHAVPYSASKHGVVGLTKALGLELARTGITVNAVCPGPMAERVREH--------------------
DHB4_RAT        IYGNFGQANYSAAKLGLLGLANTLVIEGRKNNIHCNTI--------------------------------
RHLG_PSEAE      ISAMGEQAAYGPSKAALHQLSRMLAKELVGEHINVNVIAPGRFPSR------------------------
DHSO_RHOSH      RRGEALVGVYCATKAAVISLTQSAGLNLIRHGINVNAIAPGVV---------------------------
DHRS4_MOUSE     FTRFPSLGPYNVSKTALLGLTKNFAAELAPKNIRVNCLAPGLIKTRF-----------------------
DHI1_SHEEP      KIACPLAAAYSASKFALDGFFSSLRTEYEATNVSITLCILGLIDTDTAMKAVAGIYN-------------
SDH_AGRT5       HYPYLGGNVYGGTKAFLRQFSLGLRSDLHGKGVRVTSIEPGMCETEF-----------------------
LIMC_RHOER      LKGYAQISHYSAAKHGVVGLMRSLALELAPHRVRVNSLHPTQVNTPMIQN--------------------
NODG_RHIS3      VTGNPGQTNYCASKAGMIGFSKSLAQEIATRNIFIESAMTDKLNDKQKEAIMAAIPTRRMGTSV------
DHB4_HUMAN      IYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTI--------------------------------
YCP8_SCHPO      AFFPSSQSAYGQSKAALNYTMKEISFELQDEGFIVISIHPGAV----RTDSAQEIVN-------------
Y0585_STAHJ     NEVSKESALYSATKSAVLMIFNGLEKELAKTGIKTTSILPGMVDTPMTERS-------------------
DHB11_RAT       HTVVPFLLAYCSSKFAAVGFHRALTDEL--AALGCTGVRTSCLCPNFINTGFIKNPSTNLGPTLEPEEVV
BAIA1_EUBSP     IYGSLSGIGYPTSKAGVIGLTHGLGREIIRKNIRVVGVAPGVV---------------------------
ADH1_CERCA      LEPCPPAAVYCASKFGVVGFSRSL----------------------------------------------
YAY8_SCHPO      YVGRPDLLDYTSTKGAITAFTRGLSNQYAQHGIRVNAVAPGPI---------------------------
RDHE2_MOUSE     LIGVNGLSDYCASKFAALGFAESMFIE----------------TLAKKQWGIK--TTIVCPFFIKTGMFE
DHI2_MOUSE      DMPYPCLAAYGTSKAAIALLMDTFGCELLPWGIKVSIIKPGAVTNVNLWEKRKQLLLANIPRELLQAYGE
DHG_BACSU       VIPWPLFVHYAASKGGIKLMTETLALEYAPKGIRVNNIGPGAINT-------------------------
DHG_BACME       KIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINT-------------------------
DHG2_BACSU      QIPRPVNVQYSTSKGGIKMMTETLALNYADKGIRVNAIAPGTIATE------------------------
DHG2_BACME      MIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAI---------------------------
YHXC_BACSU      YKGNKTLIDYSATKGAIVTFTRSLSQSLVQQGIRVNAVAPGPI---------------------------
YHDF_BACSU      YEGDTALIDYSSTKGAIVSFTRSMAKSLADKGIRVNAVAPGPI---------------------------
S16C6_BOVIN     IVGINELSDYCASKFAAYGFAESLHFELK-----------------------------------------
GRDH_ORYSJ      TSSINYKGNYTATKGAIVAFTRALALQLAEEGIRVNGVAPGPI---------------------------
EPHD_MYCTU      YAPLQSLSAYCTSKAATYMFSDCLRAELDAAGVGLTTICPGVID-----------TNIVATTGFHATDEE
EPHD_MYCBO      YAPLQSLSAYCTSKAATYMFSDCLRAELDAAGVGLTTICPGVID-----------TNIVATTGFHATDEE
DHI1L_DANRE     KICGPFALPYASTKFALNGFFGGLQNELQKSNVSITICILGLIDTDSAMEKIKGYINM------------
YOHF_ECOLI      HTPLPDASAYTAAKHALGGLTKAMALELVRHKILVNAVAPGAIAT-------------------------
DHG1_BACME      KIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINT-------------------------
CBR4_BOVIN      LKGNSGQSVYSASKGGLVGFSRALAKEVAKKKIRVNVVAPG-----------------------------
DS7CB_DANRE     KLAMPFRTTYAASKHAVQAFFECLRAEVQEYGITVSTIN---------HTFIKTSSSIPKDEITARS---
Y182_METEA      DVLMPTSAVYSGTKGALNAISGVLANELAPRKIRVNVVSPGYVVTE------------------------
TSC10_NEUCR     LFAILGYGPYTPTKWALRGLADTLAMEVNDNPVKVHIVYPGTIVSPERENQTKPDITVELEKDEPAESPD
PGDH_CAVPO      LMPVAQQPVYCASKHGIIGFTRSMARKLMNSGVRMNAICPGFVNTSILQS--------------------
DCXR_CAEEL      IRPLDNHTVYCASKAALDMVTRCLANELGSQNIRVNSVNTVVMTDMGRDN--------------------
CBR1_PIG        VRALNECSPELQQKFKSETITEEELVGL--MNKFVEDTKNGVHRKEGWSDSTYGVTKIGV--SVLSRIYA
CBR1_MACFA      LRALKSCSPELQQKFRSETITE------------------------------------------------
BDH2_HUMAN      SVGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARGN-------------
Y1570_MYCBO     QTRAPRFGAYIASKAALDSLCDALQAETVHDNVRFTTVH-------------------------------
Y1543_MYCTU     QTRAPRFGAYIASKAALDSLCDALQAETVHDNVRFTTVH-------------------------------
HETN_ANASP      KKGVAFNSVYSASKAGLIMWTDAMRQELVGTGVNISVVCPGYVS--------------------------
HDHA_ECOLI      ENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAI---------------------------
HDHA_ECO57      ENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAI---------------------------
FABG_SALTY      TMXXXXXXXXXXXXXXLIGFSKSLAREVASRGITVNVVAPG-----------------------------
FABG_SALTI      TMXXXXXXXXXXXXXXLIGFSKSLAREVASRGITVNVVAPG-----------------------------
DHB12_MACFA     MFPVPLLTIYSATKTFVDFFSQCLHEEYRSKGIFVQSV--------------------------------
CBR1_PONAB      VRALKSCSPELQQKFRSETITE------------------------------------------------
S16C6_MOUSE     LVGINGLSDYSSSKFAAFGFAESLFLEL------------------------------------------
MFEA_DICDI      LYGNFGQANYGSMKMALVGLSNTLAQEGKSKNIHCNTI--------------------------------
FABG5_BRANA     LIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIAS-------------------------
FIXR_BRAJA      SRVHPFAGAYATSKAALASLTRELAHDYAPHGIRVNAIAPGEI---------------------------
DHRS4_PIG       YHPFPNLGPYNVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKTNFSQ---------------------
DHG3_BACME      MIPWPLFVHYAASKGGMKQMTETLALEYAPKGIRVNNIGPGAMNT-------------------------
DHB12_HUMAN     MLPVPLLTIYSATKTFVDFFSQCLHEEYRSKGVFVQSV--------------------------------
YTKK_BACSU      APGWLHRSAFGAAKVGLASLTKTIAIEEAEFGITANMVCPGDIVGDMKEASIE-----------------
YCIK_ECOLI      RQGRANWGAYAASKFATEGMMQVLADEYQ-QRLRVNCINPGGTRTAMRASAFPT----------------
DHRS4_RAT       FVLFPSLGPYNVSKTALLGLTKNFAAELAPKNIRVNCLAPGLIKTHF-----------------------
YMFI_BACSU      ETGASCEVLYSMAKGAQHSFVKGLAKELAPSGIRVNAVAPGAV---------------------------
YJDA_BACSU      LGPLPGELAYAATKGAISAFTRSLSQELAPLGITVNAVNPGPTDSTWMTDEIRNFLSPKF----------
Y5909_MYXXD     FRGLAGHAAYSASKAFLSTFMESLRVDLRGTGVRVTCIYPGFVKSE------------------------
DHI1L_CHICK     KIPTPFTTSYSATKFALDGFFSSLRHELQKRNVSIT----------------------------------
DHGA_BACME      MIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNT-------------------------
DHG4_BACME      MIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNT-------------------------
DHB12_MOUSE     MLPVPLLTIYSATKAFVDFFSQCLHEEYKSKGIFVQSVMPYLVATKLAKIQKPTLDKPSAETFV------
HCDS_XANP2      LVGIPTMAAYCAAKGAVVNLTRQMAADYSGRGIRVNVVCPGTV---------------------------
DHB12_RAT       MLPVPLLTVYSATKAFVDFFSQCLHEEYKSKGIFVQSV--------------------------------
CBR1_HUMAN      VRALKSCSPELQQKFRSETITE------------------------------------------------
BDH2_BOVIN      SIGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARPN-------------
PGDH_MOUSE      LMPVAQQPVYCASKHGIIGFTRSMAANLMKSGVRLNVICPGFVDTPILES--------------------
DHI2_RABIT      EMPYPCLAAYGTSKAAMALLMDAFSCELLPWGVKVSVIQPG----CFKTESVSNVSH-------------
ADH2_CERCA      LEPCPPAAVYCASKFGVMGFS-------------------------------------------------
YLX6_SCHPO      HI---YLGAYSAAKAGLENLTKALAVRYGPLGIRVNVCAPGTIWS-------------------------
FABG_CHLPN      KIGSAGQTNYAAAKAGIIAFTKSLAKEVAARNIRVNCLAPG-----FIETDMTSVLNDN-----------
ADH_BACOL       LEPAPPAAIYCASKFGVMGFS-------------------------------------------------
ADH1_CERCO      LEPGPPAAIYCASKFGVMGFSRSL----------------------------------------------
FABG2_BRANA     LIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIAS-------------------------
DLTE_BACSU      FNPLAVYPVYCATKAALHSFSLTLRHQLRDTSVEVIEM--------------------------------
VER1_ASPPA      CVGVPKHAVYSGSKGAIDTFVRCMAIDCGDKKITVNAVAPGAITDMFLAVSREYIPN-------------
THR1_GLOLA      QAGVPKHAVYSGSKGTIETFVRCMAIDFGDKKITVNAVAPGGITDMYRDVCREYIPN-------------
YD114_YEAST     ELTPARLTSYGASKGAMIGFHKCMSRHFR-----------------------------------------
T4HR_MAGGR      QAAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGI---------------------------
DHGB_BACME      KIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINT-------------------------
Y4VI_RHISN      LLGNPKRSAYAASKAGLISITKSLACRWASRGIRVTAVAPGHV---------------------------
TSC10_CRYNE     YVSFAGYSSYSPAKYALRGLSDALRSEMLDIHIFLPCGISGP----------------------------
DR4L2_HUMAN     FSPSPGFSPYNVSKTALLGLNNTLAIELAPRNIRVNCLH-------------------------------
TSC10_YARLI     FYPLLGYGQYCASKAAVRSLIDSLRVEALPFNIRVVGVFPGNFQSEGFEEENKS----------------
TRNH1_ARATH     ----------------------------------------------------------------------
SDR2_ARATH      QVKNL------VNEWAKGILSDAENLEVRIDQVINQLLN------DLKEDTAKTVMSAYVVSKAGLNAYT
FABG3_BRANA     LIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIAS-------------------------
FABG1_BRANA     LIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIAS-------------------------
YB45_SCHPO      VRVFPAWAAYCCSKAAINML--VMNLGSEEPDIMSVAVRPGPMQVSIRNDSNK-----------------
PHBB_CHRVI      QRGQFGQANYSAAKAGMHGFTMALAQEGASKGVTVNTISPG-----------------------------
PGDH_MACFA      LMPVAQQPVYCASKHGIVGFTRSAALNLMNSGVRLNAICPGFVNTAILES--------------------
PGDH_HUMAN      LMPVAQQPVYCASKHGIVGFTRSAALNLMNSGVRLNAICPGFVNTAILES--------------------
FABI_HELPJ      --STKYMAHYNVAKAALESAVRYLAVDLGKHNIRVNALSAGPI---------------------------
YQC8_SCHPO      TIAPQHIAAYCASKAAVRQLCKALAVE-------------------------------------------
FABI_HELPY      --STKYMAHYNVAKAALESAVRYLAVDLGKHHIRVNALSAGPI---------------------------
CBR1_RAT        LRALKSCSPELQQKFRSETITEEELVGL--MNKFIEDAKKGVHAKEGWPNSAYGVTKI------------
MTDH_AGABI      XXXXXXXXXYNSSKAACSNLVKGLAAEWASAGIRVNALSPG---------------YVNTDQTAHMD--K
KDUD_DICD3      FQGGIPVPSYTASKKRVMGITRIVANEWAKHNINVNAIAPG-----------------------------
DHI2_HUMAN      DMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPG----CFKTESVRNV---------------
DHI1L_HUMAN     RVPTSFSTPYSAAKFALDGFFGSLRLDVQDVNVAIT----------------------------------
Y019_THEMA      FQSEPDTEPYSASKGGLVALTHSLAVSLSRYHIRVVSISPGWITSEWKKKSLR-----------------
PGDH_BOVIN      LMPVAQQPVYCASKHGIVGFTRSMAANLMNSGVRLNAICPG-----------------------------
DHB12_ANAPL     MYPTPLLTLYSASKAFVDYFSRGLHAEYKSKGIIVQSVMPYYVATKMSKIS-------------------
CBR1_BOVIN      ----------------------------------------------------------------------
S16C6_HUMAN     VVGINVSPYYSASKFAAFGFAESLFFEL----------------TMIKKTEVK--STIVCPHFINTGMFE
MKAR_MALGO      QWSTPLLATYAGSKAFLIAWTQALGEEMRRSHVDVQLLNTYFVVSKVRKPSMMVPTPKNF----------
HSDL1_CHICK     CQPTPMLTTYGASKAYLDYFSRALYYEYASKGIFVQSLTPFVIATR------------------------
FABI_RICPR      IVTLTYYGAYNVAKAALEASVKYLANDMGENNIRVNAISAGPI---------------------------
FABG4_BRANA     LIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIAS-------------------------
ENTA_ECOLI      HTPRIGMSAYGXXXXXXXXXXXXVGLELAGSGVRCNVVSPG-----------------------------
DHI1L_BOVIN     RVPTSFSSPYSAAKFALDSFFSSLRLDVQEVNVAITMCVLGLRDRASAAEGVRGITRV------------
CSGA_MYXXA      SLAANTDGAYRMSKAALNMAVRSMSTDLRPEGFVTVLLHPG-----------------------------
YDFG_DICNO      ----------------------------------------------------------------------
RD10B_DANRE     LFTTAGVEDYCASKFGAIGFHESLSHELK-----------------------------------------
DHI1L_MACFA     RVPTSFSTPYSAAKFALDSFFGSLRLDVQDVNVAITMCVLGLRDRASAAEAVRGVTRV------------
YWFH_BACSU      KEPGANMFTNSMMNAALINASKNISIQLAPHNITVNCLNPGFIAT---DRYHQFVENVMKKNSISKQKAE
RD10A_DANRE     LFSTAGVEDYCASKFGAIGFHESLSHEIQAS---------------------------------------
NODG_RHIME      AIGNPGQTNYCASKAGMIGFSKSLAQEIATRNITVNCVAPGFIES-------------------------
TSC10_EMENI     FVPIAGYAPYSPAKAAMRALSDTLCQEIEVYN--------------------------------------
STCU_EMENI      VKGVPRHAVYSGSKGAIDTFVRCLAIDCGDKKITVNAVAPGAITDMFLSVSREYIPN-------------
FABI_RICBR      V-----------AKAALEASVRYLANDMGENNIRVNAISAGPI---------------------------
DH12A_DANRE     MFPVPLLTIYSSTKAFVDFFSRGLQTEYKCKGIIIQSV--------------------------------
YVAG_BACSU      IMPSQEMAHYSATKTMQLSISRSLAELATGTNVTVNTVMPGSTLTEGVETMLNSL---------------
SPS19_YEAST     YYGVPFQGHVGAAKAGIDALAKNLAVELGPLGIRSNCIAPGAI---------------------------
PECR_PONAB      LPLAVHSGAARAGVY---NLTKSLALEWACSGVRINCVAPGVIYSQTAVENYG-----SYGQSFFEESFQ
FABG_ACTAC      LIGNRGQVNYXXXXXXXXXXXXXLAVELAKRKITVNCVAPGLIDTDILDENV------------------
DHB8_HUMAN      KVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGPMTQKVPQKVVDKITEM------------
DHB14_BOVIN     AIGQSQAVPYVATKGAVTAMTKALALDESQYGVRVNCISPGNI---------------------------
UXUB_BACSU      YSPMTKVPAYSAAKASINNFTMWMAVHFAETGLRVNAIAPGFFLTKQNHDLL-----INQDGTFTSRSHK
RDH10_RAT       LFSTAGVEDYCASKFGVVGFHESLSHELK-----------------------------------------
RDH10_MOUSE     LFSTAGVEDYCASKFGVVGFHESLSHELK-----------------------------------------
RDH10_HUMAN     LFSTAGVEDYCASKFGVVGFHESLSHELK-----------------------------------------
RDH10_BOVIN     LFSTAGVEDYCASKFGVVGFHESLSHELK-----------------------------------------
HCD2_DROME      FDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPG-----------------------------
YJCD_SCHPO      LQA-PYSGRYGQSKYAQILYSIALAKRLEKYGIYSVSLHPGVIRTELTRYS-------------------
SRLD_ECOLI      KVGSKHNSGYSAAKFGGVGLTQSLALDLAEYGITVHSLMLG-----------------------------
YJGI_ECOLI      RMPVXXXXXXXXXXXXLQGMARGLARDFGPRGITINVVQPGPI---------------------------
YHXD_BACSU      YNPSPMLLDYAATKNAIIGFTVGLGKQLASKGIRVNSVAPGPI---------------------------
XYLL_PSEPU      ATRGIHRVPYGAAKGGVNALTACLAFETAERGIRVNA--TAPGGTEARHGGFRNSAEPSEQEKVWYQQ--
DHRS1_MOUSE     LQHM-FNVPYGVGKAACDRLAADCAHELRRHGVSYVSLWPGLVQTE------------------------
DECR2_DANRE     YRGQALQVHAGSAKAANDAMTRHLAVEWGPSGVRVNTVAPGPIS--------------------------
RDH10_XENTR     LFSTAGVEDYCASKFGVVGFHESLSHELK-----------------------------------------
RD10B_XENLA     LFSTAGVEDYCASKFGVVGFHESLSHELK-----------------------------------------
MTDH_ALTAL      HIAPQEQASYNVAKAGCIHLAKSLANEWRD----------------------------------------
MNR1_CAPAN      KLKLL------CNKWAIEVLRD------------------------------------------------
Y7799_EMENI     ----------------------------------------------------------------------
Y4MP_RHISN      ----------------------------------------------------------------------
Y1430_HAEIN     TYPYAGSNVYGGTKAFVTQFSLNLRADLAGTKIRVSNVEPG-----------------------------
RD10A_XENLA     LFSTAGVEDYCASKFGVVGFHESLSHEIKASD--------------------------------------
PECR_RAT        FPTAAHSGAARAGVY---NLTKTMALTWASSGVRINCVAPGTIYSQ------------------------
KDUD_ECOLI      FQGGIRVPSYTASKSGVMGVTRLMANEWAKHNINVNAIAPG-----------------------------
DHRS4_PONAB     FSPSPGFSPYNVSXXXXXXXXXXXXIELAPRNIRVNCLAPGLIKTSF-----------------------
DHR12_BOVIN     ----------------------------------------------------------------------
DHB3_RAT        VRPWPLYSLYSASKAFVCTFSKALNVEYRDKGIIIKYLNTSRVTDEFVKESLKYVT--------------
PECR_HUMAN      FPLAVHSGAARAGVY---NLTKSLALEWACSGIRINCVAPGVIYSQ------------------------
HSDL2_HUMAN     LVWFKQHCAYTIAKYGM-----------------------------------------------------
HDHA_CLOSO      XXPDISRIGYGVSKSGVNNITKQIAIQYAKYGIRCNAVLPGLIATDAAMNSM------------------
FABI_RICFE      IVTLTYYGAYNVSKAALEASVKYLATDLGENNIRVNAISAGPI---------------------------
BZRD_BACSU      AAKNPYKGAYCSSKAGLDMFTRTFGFEQEDEELPVNMISFSP----------------------------
SOU1_SCHPO      HIAPQQWASYHATKAAVKHLARALAVE-------------------------------------------
MFNA_META3      ----------------------------------------------------------------------
ILVC_GEOKA      ----------------------------------------------------------------------
DHRS4_HUMAN     FSPSPGFSPYNVSXXXXXXXXXXXXIELAPRNIRVNCLAPGLIKTSF-----------------------
STDH2_CAEEL     VVKLAEWSIYSATKKYVEWLTGCLRKEYSHHGIIFQAITPAMVATKMAGN--------------------
PTMA_CAMCO      VFAPKFENEYSVIKAGINHLGAWLAKELFNTNIRVNTLASGGI---------------------------
FABG_ARATH      LIGNIGQANYAAAKGGVISFSKTAAREGASRNINVNVVCPGFIAS-------------------------
DHB3_MOUSE      LRPWPLYSLYSASKAFVYTFSKALSVEYRDKGIIIQVLTSTPMTKYLNNKMTKT----------------
ADHR_DROIM      LDPSPVFCAYSASKFGVIGFTRSLALYYTQNGVAVMAVCCGP----------------------------
SDR1_PICAB      AMPIPRYGAYTASKAAVEMMTRILAQELRGTQITANCVAPGPVAT-------------------------
ILVC_LACLS      ----------------------------------------------------------------------
ILVC_LACLM      ----------------------------------------------------------------------
FABG_RICCN      XXXXPGQANYCASKAGLIGMTKSLSYEVATRGITVNTVAPGFIKS-------------------------
CAPD_RICB8      DKAVYPINAMGLSKALMEKLAAKARMNVRDKTVF------------------------------------
ILVC_STRSV      ----------------------------------------------------------------------
ILVC_STRGC      ----------------------------------------------------------------------
HSDL2_PONAB     LIWFKQHCAYTIAKYGM-----------------------------------------------------
DHR12_HUMAN     ----------------------------------------------------------------------
ADH_ZAPTU       FNAIYQVPVYSASKAAVVSFTQSIAKLAPITGVTAYSINPG-----------------------------
ADH2_DROWH      FNAIYQVPVYSASKAAALSFTNSLAKLAPITGVTAYSINPGPLVHKF-----------------------
Y3820_MYCBO     ERVRRANFVYGSTKAGLDGFYLGLSEALREYGVRVLVIRPGQVRTR------------------------
Y3791_MYCTU     ERVRRANFVYGSTKAGLDGFYLGLSEALREYGVRVLVIRPGQVRTR------------------------
MKAR_YARLI      LLPTPLLATYSGSKAFLQHWSNALAVELAPEHVDVELVVSYLVTS-------------------------
LE767_CAEBR     ANQMALWAVYSATKKYVSWLTAILRKEYEHQGITIQTIAPMMVATK------------------------
ADHR_DROTE      LDPSPVFCAYSASKFGVIGFTRSLALYYSQNGVAVMAVCCGP-TRVFVDRELK-----------------
ADHR_DROMA      LDPSPVFCAYSASKFGVIGFTRSLALYYSQNGVAVMAVCCGP-TRVFVDRELK-----------------


                         .         .         .         +         .         .         .:280
query           KILARQHKKVPFNEPAISVAKVVEKIINCDKPKPRYYITKATWIMTSLKRILPTNILDNFLNRY
YBBO_ECOLI      KPVENPGIAARFTLGPEAVVDKVRHAFISEKPKMRYPVTLVTWAVMVLKRLLPGRVMDKIL---
YBBO_ECOL6      KPVENPGIAARFTLGPEAVVDKVRHAFISEKPKMRYPVTLVTWAVMVLKRLLPGRVMDKIL---
VDLC_HELPY      -VNAAKSFYSGVYQNALSPKAVAQKIVMSQKIKARYLIGLKTQLLLALYQILPSSWYDS-----
VDLC_HELPJ      K--------------ALNAKEVAQKIVMSHKIKARYLIGLKTQLLLALYQILPSSWYDS-----
YUSZ_BACSU      KILSYVQKNGEESGDPQEVADLIYQLATKQHIKNRYPIGKGIKLTLLFRSLFPWSAWESILKK-
YQ53_SCHPO      ----------------------------------------------------------------
RDH8_HUMAN      ----------------------------------------------------------------
YAEB_SCHPO      KLILENRNPV------------------------------------------------------
YQJQ_BACSU      ----------------------------------------------------------------
H17B6_RAT       ----------------------------------------------------------------
YXJF_BACSU      ----------------------------------------------------------------
DRS7B_DANRE     ----------------------------------------------------------------
RDH8_BOVIN      RDLYLPASRELFHNVGQSVAKVIVKVIGSARPPLRRRTNTRYTPLIALKAMDPSGSL-------
BDH_MOUSE       KIAKMETYCNSGSTDTSSVINAVTHALTAATPYTRYHPMDYYW---------------------
AYR1_YEAST      KTMAKDNKPMPADAYA---KQLVKDILSTSDPVDVYRGTFAN-IMRFVMIFVPYWLLEKGLSK-
DRS7B_XENTR     ----------------------------------------------------------------
BDHA_RHIME      ----------------------------------------------------------------
BACC2_BACSU     ----------------------------------------------------------------
DRS7B_MOUSE     ----------------------------------------------------------------
DRS7B_XENLA     ----------------------------------------------------------------
BDH_RAT         KIAKMETYCNSGSTDTSSVINAVTHALTAATPYTRYHPMDYYW---------------------
DHB1_RAT        ----------------------------------------------------------------
Y2778_STAA8     ----------------------------------------------------------------
Y2488_STAAC     ----------------------------------------------------------------
Y2422_STAA3     ----------------------------------------------------------------
DHRS9_RAT       ----------------------------------------------------------------
DHRS7_ANOGA     ----------------------------------------------------------------
Y2403_STAAW     ----------------------------------------------------------------
Y2370_STAAS     ----------------------------------------------------------------
DHRS7_HUMAN     ----------------------------------------------------------------
BDH_BOVIN       KVARMESYCTSGSTDTSPVIKAVTHALTATTPYTRYHPMDYYW---------------------
H17B6_MOUSE     ----------------------------------------------------------------
DHB1_HUMAN      QYLA--HSKQVFREAAQNVAEVFLTALRAPKPTLRYFTTE------------------------
DRS7B_PONAB     ----------------------------------------------------------------
DHB1_PANTR      QYLA--HSKQVFREAAQNVAEVFLTALRAPKPTLRYFTTE------------------------
DRS7B_HUMAN     ----------------------------------------------------------------
DR9C7_MOUSE     TYTKKLVNLMRSAEPRISVTNSMEHAIVSRSPRIRYNPGLDVKFLYLTLAKLPTPVTDFILSRY
Y2478_STAAM     ----------------------------------------------------------------
Y2266_STAAN     ----------------------------------------------------------------
DRS7B_BOVIN     ----------------------------------------------------------------
DHRS9_BOVIN     KSLEQLKGTASFVNVDLSVVECMDHALTSLFPKTRYAAAKTFWIPLS-----------------
YI78_SCHPO      DLL----PKLKTATPPQKIAEVILQAATDESDELRY----------------------------
DHRS9_HUMAN     ----------------------------------------------------------------
TRN1_DATST      ----------------------------------------------------------------
DHRS7_DROME     KLAERILQCILRKEPDIIVSDVQAKI--------------------------------------
DHB1_MOUSE      ----------------------------------------------------------------
TRN2_HYONI      ----------------------------------------------------------------
DRS7B_RAT       ----------------------------------------------------------------
DHRS9_MOUSE     GYIEKSLHRLKSNTSSVNVVGCMDHALTSLFPKTRYIAAKTFWIPLS-----------------
ACT3_STRCO      ----------------------------------------------------------------
Y2049_STAEQ     ----------------------------------------------------------------
Y2036_STAES     ----------------------------------------------------------------
Y1627_STAS1     ----------------------------------------------------------------
DHR11_HUMAN     ----------------------------------------------------------------
YKVO_BACSU      ----------------------------------------------------------------
Y452_LISIN      SIVA------------------------------------------------------------
FABG_STAES      ----------------------------------------------------------------
FABG_STAEQ      ----------------------------------------------------------------
BDH_HUMAN       KIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHMDYYWWLRMQIMTHLPGAISD------
Y2567_STAAR     ----------------------------------------------------------------
DHR11_BOVIN     ----------------------------------------------------------------
BACC_BACAM      ----------------------------------------------------------------
TRN2_DATST      ----------------------------------------------------------------
PHBB_RHIME      ----------------------------------------------------------------
FABG_BACSU      ----------------------------------------------------------------
Y325_THEMA      ----------------------------------------------------------------
H17B6_HUMAN     E--APKHIKETYGQQYFDALYNIEGLLNC-----------------------------------
UCPA_SALTY      AIPLRR----------------------------------------------------------
UCPA_SALTI      AIPLRR----------------------------------------------------------
RDH16_HUMAN     KFVADYKKSAEQMEQKCTVTNCMEHALIACHPRTRY---SAGWDAKLL--YLPMSYMPTFL---
KDUD_BACSU      ----------------------------------------------------------------
DHRS4_RABIT     ----------------------------------------------------------------
BACC_BACSU      ----------------------------------------------------------------
RDH2_RAT        KMLNGLDQRC--NKDLSLVTDCMEHALTSCHPRTRY---SAGWDAKFF--YLPMSYLPTFL---
PHAB_ACISR      ----------------------------------------------------------------
LVR_LEIAQ       ----------------------------------------------------------------
Y432_LISMO      ----------------------------------------------------------------
RDH3_RAT        Q-TTEEVKEIYGEKFQDSYMKAMESLVN------------------------------------
RDH7_RAT        Q-ATEEVKEIYGEKFRDSYMKAMESLVN------------------------------------
PHAB_PARDE      ----------------------------------------------------------------
FABG_RICPR      ----------------------------------------------------------------
FABG_HAEIN      ----------------------------------------------------------------
DHRS7_MOUSE     ----------------------------------------------------------------
RDH7_MOUSE      KIKAIQSLTDTCSDDLSVVTDCMEHALTACHPRTRY----------------------------
FABG_CUPLA      ----------------------------------------------------------------
YM71_YEAST      ----------------------------------------------------------------
KDSR_HUMAN      ----------------------------------------------------------------
DHR11_MOUSE     ----------------------------------------------------------------
YOXD_BACSU      EYMVAQLKLDP-----------------------------------------------------
TRNH_DATST      ----------------------------------------------------------------
DRS7C_XENTR     KLSYGAH-PVEVAEEVLSTVSRKKQEVFMANPIPRAAVYIRTFLPELFFAVVATGV--------
CPNA_COMTE      ----------------------------------------------------------------
CPNA_COMS9      ----------------------------------------------------------------
DHI1_HUMAN      ----------------------------------------------------------------
Y945_MYCTU      ----------------------------------------------------------------
KDSR_MOUSE      ----------------------------------------------------------------
DR9C7_BOVIN     ----------------------------------------------------------------
MAS12_AGRRH     ----------------------------------------------------------------
FABG_BUCAP      ----------------------------------------------------------------
DHKR_STRCM      AILTKFQAKIP-----------------------------------------------------
GNO_GLUOX       ----------------------------------------------------------------
KDSR_BOVIN      ----------------------------------------------------------------
FABG_VIBHA      ----------------------------------------------------------------
FABG_VIBCH      ----------------------------------------------------------------
DHB2_MOUSE      DYVHTQKLIIPTNPDITPVLRDIQHAISARNPSSFYYPGRMAYLWVCLAAYCPTSLLDYVIKK-
CBR2_PIG        ----------------------------------------------------------------
BUDC_KLEPN      ----------------------------------------------------------------
HSD_MYCTU       ----------------------------------------------------------------
HSD_MYCBO       ----------------------------------------------------------------
BDH_CHICK       KYFDEQVSKMECNSGSTDTSPVIESVLTSTAPYTRYHMDYYWWLRMQIMTHMPAAISD------
YGCW_ECOLI      ----------------------------------------------------------------
SDH_RHIRD       ----------------------------------------------------------------
FABG_AQUAE      ----------------------------------------------------------------
KDSR_DICDI      ----------------------------------------------------------------
DR9C7_HUMAN     RIYTDKLKNIQVAEPRVDVINSMEHAIVSRSPRIRYNPGLDAKLLYIPLAKLPTPVTDFILSRY
BDH2_MOUSE      ----------------------------------------------------------------
Y4EK_RHISN      ----------------------------------------------------------------
FABG_PSEAE      ----------------------------------------------------------------
BUTA_STAEQ      ----------------------------------------------------------------
DHI1_SAISC      ----------------------------------------------------------------
DHI1_MESAU      ----------------------------------------------------------------
FABG_SHIFL      ----------------------------------------------------------------
FABG_MYCAV      ----------------------------------------------------------------
FABG_ECOLI      ----------------------------------------------------------------
Y0419_STAS1     ----------------------------------------------------------------
FABG_STAAW      ----------------------------------------------------------------
FABG_STAAS      ----------------------------------------------------------------
FABG_STAAR      ----------------------------------------------------------------
FABG_STAAN      ----------------------------------------------------------------
FABG_STAAM      ----------------------------------------------------------------
FABG_STAAC      ----------------------------------------------------------------
DHR11_CHICK     ----------------------------------------------------------------
DHB2_HUMAN      YILAQRNFLLLINSLASKVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYDYFAKRH
ACR1_ACIBI      ----------------------------------------------------------------
ACR1_ACIAD      ----------------------------------------------------------------
YXNA_BACSU      ----------------------------------------------------------------
YVRD_BACSU      ----------------------------------------------------------------
RDH1_HUMAN      KMQQRIMNLI-CDPDLTKVSRCLEHALTARHPRTRYWDAKLLWLPAS---YLPASLVDAVL---
NODG_AZOBR      ----------------------------------------------------------------
HCDR_XANP2      ----------------------------------------------------------------
DHI1_RABIT      ----------------------------------------------------------------
DHB11_PONAB     ----------PTLEPEEVVNRLMHGILTEQK---MIFIPSSIAFLTTLERILPERFL-------
BUDC_KLETE      ----------------------------------------------------------------
Y1385_MYCBO     ----------------------------------------------------------------
Y1350_MYCTU     ----------------------------------------------------------------
DHI1A_XENLA     ----------------------------------------------------------------
DHB2_RAT        LPVMREMS----NPDITPVLRDIQHAICAKNPSSFYCSGRMTYLWICFAAYSPISLLDYILKNY
DER_CHICK       ----------------------------------------------------------------
GS39_BACSU      ----------------------------------------------------------------
FABL_BACSU      ----------------------------------------------------------------
BUTA_STAES      ----------------------------------------------------------------
DHRS4_BOVIN     ----------------------------------------------------------------
DHI1_MOUSE      ----------------------------------------------------------------
DHB11_HUMAN     ----------PTLEPEEVVNRLMHGILTEQK---MIFIPSSIAFLTTLERILPERFL-------
YXBG_BACSU      ----------------------------------------------------------------
YDFG_SHIFL      ----------------------------------------------------------------
UCPA_ECOLI      AIPMRR----------------------------------------------------------
UCPA_ECO57      AIPLRR----------------------------------------------------------
FOX2_YEAST      ----------------------------------------------------------------
DRS7C_BOVIN     KLTYGTHPVDVAEEVMRTVRRKKQEVFLANPPKAAVYI--------------------------
RIDH_KLEAE      ----------------------------------------------------------------
PHBB_RALEH      ----------------------------------------------------------------
DHI1_RAT        ----------------------------------------------------------------
CBR4_DANRE      ----------------------------------------------------------------
YDFG_ECOL6      ----------------------------------------------------------------
PHBB_ZOORA      ----------------------------------------------------------------
FABG_MYCTU      ----------------------------------------------------------------
FABG_MYCBO      ----------------------------------------------------------------
BUTA_STAAW      ----------------------------------------------------------------
BUTA_STAAS      ----------------------------------------------------------------
BUTA_STAAR      ----------------------------------------------------------------
BUTA_STAAN      ----------------------------------------------------------------
BUTA_STAAM      ----------------------------------------------------------------
BUTA_STAAC      ----------------------------------------------------------------
YI13_SCHPO      ----------------------------------------------------------------
Y484_MYCTU      ----------------------------------------------------------------
MAS11_AGRRH     ----------------------------------------------------------------
FABG_BUCAI      ----------------------------------------------------------------
DHI1L_XENTR     ----------------------------------------------------------------
GRDH_DAUCA      ----------------------------------------------------------------
GRDH1_ARATH     ----------------------------------------------------------------
FOX2_CANTR      ----------------------------------------------------------------
FABG_MYCS2      ----------------------------------------------------------------
FABG1_SYNY3     ----------------------------------------------------------------
YDFG_ECO57      ----------------------------------------------------------------
GRDH2_ARATH     ----------------------------------------------------------------
FABG_THEMA      ----------------------------------------------------------------
DRS7C_MOUSE     ----------------------------------------------------------------
DRS7C_HUMAN     KLTYGVHPVEVAEEVMRTVRRKKQEVFMANPPKAAVYV--------------------------
CBR2_MOUSE      ----------------------------------------------------------------
YDFG_SALTY      ----------------------------------------------------------------
YDFG_SALTI      ----------------------------------------------------------------
YDFG_ECOLI      ----------------------------------------------------------------
IDNO_ECOLI      ----------------------------------------------------------------
IDNO_ECOL6      ----------------------------------------------------------------
FABG_RICTY      ----------------------------------------------------------------
FABG_BUCBP      ----------------------------------------------------------------
BDHA_RALEH      ----------------------------------------------------------------
RDHE2_HUMAN     GCTTGCPSLLPILEPKYAVEKIVEAIL---QEKMYLYMPKLLYFMMFLKSFLP-----------
MAS1_AGRT9      ----------------------------------------------------------------
DHI1_CAVPO      ----------------------------------------------------------------
DHB13_MOUSE     GILT--NKKMIFVPSYINIFLILEK---------------------------------------
LINC_PSEPA      ----------------------------------------------------------------
FABG_RICBR      ----------------------------------------------------------------
FABG_CHLMU      ----------------------------------------------------------------
DHI2_RAT        LLLANLPRELAYGEDYIDLSPVVDAIIDAAQPRSRYYTGRGLGLMYFIHHYLPGGLRRRFLQNF
YF3H_SCHPO      ----------------------------------------------------------------
FOX2_NEUCR      ----------------------------------------------------------------
DS7CA_DANRE     ----------------------------------------------------------------
DHB11_MOUSE     GILT--EKQMIFVPSSIALLTVLERIV-------------------------------------
CBR1_MOUSE      ----------------------------------------------------------------
RDH1_BOVIN      ----------------------------------------------------------------
HSD_STREX       ----------------------------------------------------------------
DHI1B_XENLA     ----------------------------------------------------------------
DHB4_MOUSE      ----------------------------------------------------------------
DHB13_RAT       GILT--NKKMIFVPSYINISLIVE----------------------------------------
DHB11_MACFA     GILTEQ--KMIFSPSSIAFLTILERIL-------------------------------------
FABG_CHLTR      ----------------------------------------------------------------
DHB13_HUMAN     ----------------------------------------------------------------
BAIA2_EUBSP     ----------------------------------------------------------------
ADH2_CERRO      ----------------------------------------------------------------
ADH2_CERCO      ----------------------------------------------------------------
DHK1_STRVN      ----------------------------------------------------------------
DHB4_RAT        ----------------------------------------------------------------
RHLG_PSEAE      ----------------------------------------------------------------
DHSO_RHOSH      ----------------------------------------------------------------
DHRS4_MOUSE     ----------------------------------------------------------------
DHI1_SHEEP      ----------------------------------------------------------------
SDH_AGRT5       ----------------------------------------------------------------
LIMC_RHOER      ----------------------------------------------------------------
NODG_RHIS3      ----------------------------------------------------------------
DHB4_HUMAN      ----------------------------------------------------------------
YCP8_SCHPO      ----------------------------------------------------------------
Y0585_STAHJ     ----------------------------------------------------------------
DHB11_RAT       EHLMHTNQKMIFVPGSIALLTVLERV--------------------------------------
BAIA1_EUBSP     ----------------------------------------------------------------
ADH1_CERCA      ----------------------------------------------------------------
YAY8_SCHPO      ----------------------------------------------------------------
RDHE2_MOUSE     GCTTKCPTLLPILDPEYAVRKIIDAIL---QEQLYLYMPKFLYFIVFLKSILP-----------
DHI2_MOUSE      DYIEHVHGQFSLRMALPDLSPVVDAIIDAAQPRSRYYPGRGLGLMYFIHHYLPEGLRRCFLQNF
DHG_BACSU       ----------------------------------------------------------------
DHG_BACME       ----------------------------------------------------------------
DHG2_BACSU      ----------------------------------------------------------------
DHG2_BACME      ----------------------------------------------------------------
YHXC_BACSU      ----------------------------------------------------------------
YHDF_BACSU      ----------------------------------------------------------------
S16C6_BOVIN     ----------------------------------------------------------------
GRDH_ORYSJ      ----------------------------------------------------------------
EPHD_MYCTU      KIDGRRGQDKMFALRSYGPDKVADAIVSAKKKKPIRPVAPEAYALYGISRVLP-----------
EPHD_MYCBO      KIDGRRGQDKMFALRSYGPDKVADAIVSAKKKKPIRPVAPEAYALYGISRVLP-----------
DHI1L_DANRE     ----------------------------------------------------------------
YOHF_ECOLI      ----------------------------------------------------------------
DHG1_BACME      ----------------------------------------------------------------
CBR4_BOVIN      ----------------------------------------------------------------
DS7CB_DANRE     --MKTDHRQTPLGVSPKDVATELLRTLSSKKKE----ILMARWV--------------------
Y182_METEA      ----------------------------------------------------------------
TSC10_NEUCR     TVARR-----------------------------------------------------------
PGDH_CAVPO      ----------------------------------------------------------------
DCXR_CAEEL      ----------------------------------------------------------------
CBR1_PIG        RKLREQ----------------------------------------------------------
CBR1_MACFA      ----------------------------------------------------------------
BDH2_HUMAN      ----------------------------------------------------------------
Y1570_MYCBO     ----------------------------------------------------------------
Y1543_MYCTU     ----------------------------------------------------------------
HETN_ANASP      ----------------------------------------------------------------
HDHA_ECOLI      ----------------------------------------------------------------
HDHA_ECO57      ----------------------------------------------------------------
FABG_SALTY      ----------------------------------------------------------------
FABG_SALTI      ----------------------------------------------------------------
DHB12_MACFA     ----------------------------------------------------------------
CBR1_PONAB      ----------------------------------------------------------------
S16C6_MOUSE     ----------------------------------------------------------------
MFEA_DICDI      ----------------------------------------------------------------
FABG5_BRANA     ----------------------------------------------------------------
FIXR_BRAJA      ----------------------------------------------------------------
DHRS4_PIG       ----------------------------------------------------------------
DHG3_BACME      ----------------------------------------------------------------
DHB12_HUMAN     ----------------------------------------------------------------
YTKK_BACSU      ----------------------------------------------------------------
YCIK_ECOLI      ----------------------------------------------------------------
DHRS4_RAT       ----------------------------------------------------------------
YMFI_BACSU      ----------------------------------------------------------------
YJDA_BACSU      ----------------------------------------------------------------
Y5909_MYXXD     ----------------------------------------------------------------
DHI1L_CHICK     ----------------------------------------------------------------
DHGA_BACME      ----------------------------------------------------------------
DHG4_BACME      ----------------------------------------------------------------
DHB12_MOUSE     ----------------------------------------------------------------
HCDS_XANP2      ----------------------------------------------------------------
DHB12_RAT       ----------------------------------------------------------------
CBR1_HUMAN      ----------------------------------------------------------------
BDH2_BOVIN      ----------------------------------------------------------------
PGDH_MOUSE      ----------------------------------------------------------------
DHI2_RABIT      ----------------------------------------------------------------
ADH2_CERCA      ----------------------------------------------------------------
YLX6_SCHPO      ----------------------------------------------------------------
FABG_CHLPN      ----------------------------------------------------------------
ADH_BACOL       ----------------------------------------------------------------
ADH1_CERCO      ----------------------------------------------------------------
FABG2_BRANA     ----------------------------------------------------------------
DLTE_BACSU      ----------------------------------------------------------------
VER1_ASPPA      ----------------------------------------------------------------
THR1_GLOLA      ----------------------------------------------------------------
YD114_YEAST     ----------------------------------------------------------------
T4HR_MAGGR      ----------------------------------------------------------------
DHGB_BACME      ----------------------------------------------------------------
Y4VI_RHISN      ----------------------------------------------------------------
TSC10_CRYNE     ----------------------------------------------------------------
DR4L2_HUMAN     ----------------------------------------------------------------
TSC10_YARLI     ----------------------------------------------------------------
TRNH1_ARATH     ----------------------------------------------------------------
SDR2_ARATH      RILAKKHPEIRVN---------------------------------------------------
FABG3_BRANA     ----------------------------------------------------------------
FABG1_BRANA     ----------------------------------------------------------------
YB45_SCHPO      ----------------------------------------------------------------
PHBB_CHRVI      ----------------------------------------------------------------
PGDH_MACFA      ----------------------------------------------------------------
PGDH_HUMAN      ----------------------------------------------------------------
FABI_HELPJ      ----------------------------------------------------------------
YQC8_SCHPO      ----------------------------------------------------------------
FABI_HELPY      ----------------------------------------------------------------
CBR1_RAT        ----------------------------------------------------------------
MTDH_AGABI      KIRDHQASNIPLN---------------------------------------------------
KDUD_DICD3      ----------------------------------------------------------------
DHI2_HUMAN      ----------------------------------------------------------------
DHI1L_HUMAN     ----------------------------------------------------------------
Y019_THEMA      ----------------------------------------------------------------
PGDH_BOVIN      ----------------------------------------------------------------
DHB12_ANAPL     ----------------------------------------------------------------
CBR1_BOVIN      ----------------------------------------------------------------
S16C6_HUMAN     GCTS----KYPFLLPILEQEYVAKKILNAILEEQVYMIPKFAYIGLILKQIISPKMLIAF----
MKAR_MALGO      ----------------------------------------------------------------
HSDL1_CHICK     ----------------------------------------------------------------
FABI_RICPR      ----------------------------------------------------------------
FABG4_BRANA     ----------------------------------------------------------------
ENTA_ECOLI      ----------------------------------------------------------------
DHI1L_BOVIN     ----------------------------------------------------------------
CSGA_MYXXA      ----------------------------------------------------------------
YDFG_DICNO      ----------------------------------------------------------------
RD10B_DANRE     ----------------------------------------------------------------
DHI1L_MACFA     ----------------------------------------------------------------
YWFH_BACSU      EQIA------------------------------------------------------------
RD10A_DANRE     ----------------------------------------------------------------
NODG_RHIME      ----------------------------------------------------------------
TSC10_EMENI     ----------------------------------------------------------------
STCU_EMENI      ----------------------------------------------------------------
FABI_RICBR      ----------------------------------------------------------------
DH12A_DANRE     ----------------------------------------------------------------
YVAG_BACSU      ----------------------------------------------------------------
SPS19_YEAST     ----------------------------------------------------------------
PECR_PONAB      KIPAKR----------------------------------------------------------
FABG_ACTAC      ----------------------------------------------------------------
DHB8_HUMAN      ----------------------------------------------------------------
DHB14_BOVIN     ----------------------------------------------------------------
UXUB_BACSU      IIAGTPMKR--FGKP-------------------------------------------------
RDH10_RAT       ----------------------------------------------------------------
RDH10_MOUSE     ----------------------------------------------------------------
RDH10_HUMAN     ----------------------------------------------------------------
RDH10_BOVIN     ----------------------------------------------------------------
HCD2_DROME      ----------------------------------------------------------------
YJCD_SCHPO      ----------------------------------------------------------------
SRLD_ECOLI      ----------------------------------------------------------------
YJGI_ECOLI      ----------------------------------------------------------------
YHXD_BACSU      ----------------------------------------------------------------
XYLL_PSEPU      ----------------------------------------------------------------
DHRS1_MOUSE     ----------------------------------------------------------------
DECR2_DANRE     ----------------------------------------------------------------
RDH10_XENTR     ----------------------------------------------------------------
RD10B_XENLA     ----------------------------------------------------------------
MTDH_ALTAL      ----------------------------------------------------------------
MNR1_CAPAN      ----------------------------------------------------------------
Y7799_EMENI     ----------------------------------------------------------------
Y4MP_RHISN      ----------------------------------------------------------------
Y1430_HAEIN     ----------------------------------------------------------------
RD10A_XENLA     ----------------------------------------------------------------
PECR_RAT        ----------------------------------------------------------------
KDUD_ECOLI      ----------------------------------------------------------------
DHRS4_PONAB     ----------------------------------------------------------------
DHR12_BOVIN     ----------------------------------------------------------------
DHB3_RAT        ----------------------------------------------------------------
PECR_HUMAN      ----------------------------------------------------------------
HSDL2_HUMAN     ----------------------------------------------------------------
HDHA_CLOSO      ----------------------------------------------------------------
FABI_RICFE      ----------------------------------------------------------------
BZRD_BACSU      ----------------------------------------------------------------
SOU1_SCHPO      ----------------------------------------------------------------
MFNA_META3      ----------------------------------------------------------------
ILVC_GEOKA      ----------------------------------------------------------------
DHRS4_HUMAN     ----------------------------------------------------------------
STDH2_CAEEL     ----------------------------------------------------------------
PTMA_CAMCO      ----------------------------------------------------------------
FABG_ARATH      ----------------------------------------------------------------
DHB3_MOUSE      ----------------------------------------------------------------
ADHR_DROIM      ----------------------------------------------------------------
SDR1_PICAB      ----------------------------------------------------------------
ILVC_LACLS      ----------------------------------------------------------------
ILVC_LACLM      ----------------------------------------------------------------
FABG_RICCN      ----------------------------------------------------------------
CAPD_RICB8      ----------------------------------------------------------------
ILVC_STRSV      ----------------------------------------------------------------
ILVC_STRGC      ----------------------------------------------------------------
HSDL2_PONAB     ----------------------------------------------------------------
DHR12_HUMAN     ----------------------------------------------------------------
ADH_ZAPTU       ----------------------------------------------------------------
ADH2_DROWH      ----------------------------------------------------------------
Y3820_MYCBO     ----------------------------------------------------------------
Y3791_MYCTU     ----------------------------------------------------------------
MKAR_YARLI      ----------------------------------------------------------------
LE767_CAEBR     ----------------------------------------------------------------
ADHR_DROTE      ----------------------------------------------------------------
ADHR_DROMA      ----------------------------------------------------------------