[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30379.1

[Show Plain Result]


## Summary of Sequence Search
    1::167
    8::165     3e-16  29%  168 aa  SKP_BLOFL RecName: Full=Chaperone protein skp;Flags: Precursor;
    8::163     5e-16  28%  166 aa  SKP_BLOPB RecName: Full=Chaperone protein skp;Flags: Precursor;
    1::162     1e-14  29%  165 aa  SKP_PHOLL RecName: Full=Chaperone protein skp;Flags: Precursor;
   25::162     2e-14  30%  165 aa  SKP_ERWCT RecName: Full=Chaperone protein skp;Flags: Precursor;
   25::162     1e-13  28%  165 aa  SKP_YERPS RecName: Full=Chaperone protein skp;AltName:
   25::162     1e-13  28%  165 aa  SKP_YERPE RecName: Full=Chaperone protein skp;Flags: Precursor;
    1::162     1e-13  27%  165 aa  SKP_PHOLU RecName: Full=Chaperone protein skp;Flags: Precursor;
   27::161     6e-12  27%  164 aa  SKP_YEREN RecName: Full=Chaperone protein skp;AltName:
   10::166     8e-12  29%  168 aa  SKPL_PSEAE RecName: Full=Skp-like protein;Flags: Precursor;
   23::158     2e-09  27%  161 aa  SKP_SHISS RecName: Full=Chaperone protein skp;Flags: Precursor;
   23::158     2e-09  27%  161 aa  SKP_SHIFL RecName: Full=Chaperone protein skp;Flags: Precursor;
   23::158     2e-09  27%  161 aa  SKP_SHIDS RecName: Full=Chaperone protein skp;Flags: Precursor;
   23::158     2e-09  27%  161 aa  SKP_SHIBS RecName: Full=Chaperone protein skp;Flags: Precursor;
   23::158     2e-09  27%  161 aa  SKP_ECOLI RecName: Full=Chaperone protein skp;AltName:
   23::158     2e-09  27%  161 aa  SKP_ECOL6 RecName: Full=Chaperone protein skp;Flags: Precursor;
   23::158     2e-09  27%  161 aa  SKP_ECO57 RecName: Full=Chaperone protein skp;Flags: Precursor;
    1::158     3e-09  25%  161 aa  SKP_SALTY RecName: Full=Chaperone protein skp;AltName: Full=Outer
    1::158     3e-09  25%  161 aa  SKP_SALTI RecName: Full=Chaperone protein skp;Flags: Precursor;
    1::158     3e-09  25%  161 aa  SKP_SALPA RecName: Full=Chaperone protein skp;Flags: Precursor;
    1::158     3e-09  25%  161 aa  SKP_SALCH RecName: Full=Chaperone protein skp;Flags: Precursor;
   29::166     5e-09  25%  169 aa  SKP_VIBCH RecName: Full=Chaperone protein skp;Flags: Precursor;
   57::187     1e-04  22%  193 aa  OM25_PASMU RecName: Full=Outer membrane p25;AltName:
  352::458     2e-04  34%  683 aa  DIXC1_HUMAN RecName: Full=Dixin;AltName: Full=DIX domain-containing
  378::475     4e-04  35%  711 aa  DIXC1_MOUSE RecName: Full=Dixin;AltName: Full=DIX domain-containing
    1::167

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKIALSICVLVSAFTAAYADTKIAVVNPVEIFNDSDLGSVSVKKLENDLKPDATKLKQEQDNIMQQMKT
SKP_BLOFL       -----LGIIIWLAQINYVNAANKIVVMNVANIFQQSAQRTEIIKQLEYEFKDRAAELEMMEHDLQTKMQT
SKP_BLOPB       -----LSMVIWITQISPVDAEDKIAIVNISNIFQQSSQRAKIIKQLEYEFKDRATELEKMEHDLQMKIQT
SKP_PHOLL       MKKLAASFGIALAFSVGAQAADKIAVVNVGEIFQQLPAREAVVKQLENEFKNRASELQRMETDLQSKIQK
SKP_ERWCT       ----------------------KIAVVNVSSIFQQLPQRESVGKQLENEFKGRASELQSMENDLQGKMQK
SKP_YERPS       ----------------------KIAIVNVSSIFQQLPAREAVAKQLENEFKGRATELQGMERDLQTKMQK
SKP_YERPE       ----------------------KIAIVNVSSIFQQLPAREAVAKQLENEFKGRATELQGMERDLQTKMQK
SKP_PHOLU       MKKLAASFGIALAFSAGAQAADKIAVVNVGEIFQQLPAREAVAKQLENEFKNRASELQRMETDLQSKIQK
SKP_YEREN       -------------------------IVNVSRIFQQLPESETVAKQLENEFKGRATELQGMESDLQTKMQK
SKPL_PSEAE      -------ITAAIMAAPSAFAEMKIAVLNYQMALLESDAAKQYAVDAEKKFGPQLNKLK----NLERDAKA
SKP_SHISS       ----------------------KIAIVNMGSLFQQVAQKTGVSNTLENEFKGRASELQRMETDLQAKMKK
SKP_SHIFL       ----------------------KIAIVNMGSLFQQVAQKTGVSNTLENEFKGRASELQRMETDLQAKMKK
SKP_SHIDS       ----------------------KIAIVNMGSLFQQVAQKTGVSNTLENEFKGRASELQRMETDLQAKMKK
SKP_SHIBS       ----------------------KIAIVNMGSLFQQVAQKTGVSNTLENEFKGRASELQRMETDLQAKMKK
SKP_ECOLI       ----------------------KIAIVNMGSLFQQVAQKTGVSNTLENEFKGRASELQRMETDLQAKMKK
SKP_ECOL6       ----------------------KIAIVNMGSLFQQVAQKTGVSNTLENEFKGRASELQRMETDLQAKMKK
SKP_ECO57       ----------------------KIAIVNMGSLFQQVAQKTGVSNTLENEFKGRASELQRMETDLQAKMKK
SKP_SALTY       MKKWXXXXXXXXXMVTSAQAADKIAIVNMGNLFQQVAQKTGVSNTLENEFKGRAAELQKMETDLQSKMQR
SKP_SALTI       MKKWXXXXXXXXXMVTSAQAADKIAIVNMGNLFQQVAQKTGVSNTLENEFKGRAAELQKMETDLQSKMQR
SKP_SALPA       MKKWXXXXXXXXXMVTSAQAADKIAIVNMGNLFQQVAQKTGVSNTLENEFKGRAAELQKMETDLQSKMQR
SKP_SALCH       MKKWXXXXXXXXXMVTSAQAADKIAIVNMGNLFQQVAQKTGVSNTLENEFKGRAAELQKMETDLQSKMQR
SKP_VIBCH       ----------------------KIGYINTAQVFQALPQREVVLQKMQEEFKDKAAELQAIQADAKTKIEK
OM25_PASMU      ------------------------------------------VEKLTANKKSIDEKIAASQKKVEAKVAA
DIXC1_HUMAN     ------------------------------------------------DLKKELLKCKQEARNLLQQRLT
DIXC1_MOUSE     ------------------------------------------------DLKKELLKCKQEARNLLQQRLT


                         .         .         *         .         .         .         .:140
query           LQDNSATMTKSELDKKXXXXXXXXXNFAEKARILQQKEYTAKDKLSKKFQASFDKAVQTIAKQKNYNVVL
SKP_BLOFL       LQRDGATMTASDRNTLEKSLIAQRELFSNKAKLFQQENHARQTEERDKILDMIYKIVKNIAKKENYDIVI
SKP_BLOPB       LQRDGATMKTIERSELEKSLINQREIFSNKAKEFQQENHSRQTEERDKILNMIQNVVTNVAKKENYDIVI
SKP_PHOLL       LQRDGSTMKSSERTNLEKEVMAKREEFAKKAQAFEQDHRRREMEERNKILSRIQDAIKVVAGKEGYDVVI
SKP_ERWCT       LQRDGSTMKASDRSKMEKDVMAQREQFSTKAQAFEQDNRRRQTEERNKILSRIQDAVKAVATKEGYDVVI
SKP_YERPS       LQRDGSTMKASDRTKLENEVMKQRETFSTKAQAFEQDNRRRQAEERNKILSRIQDAVKSVATKGGYDVVI
SKP_YERPE       LQRDGSTMKASDRTKLENEVMKQRETFSTKAQAFEQDNRRRQAEERNKILSRIQDAVKSVATKGGYDVVI
SKP_PHOLU       LQRDGSTMKSSERTNLEKEVMAKREEFGKKAQAFEQDHRRREMEERNKILSRIQDAIKVVAGKEGYDIVI
SKP_YEREN       LQRDGSTMKASDRTKLENDVMKQRETFSTKAQAFEQDNRRRQMEERNKILSRIQDAVKSVASKGGYDVVI
SKPL_PSEAE      LQDNGSKMSQGDREKAELDFKQKARDFQFQSKELNESKAAADRDMLKKLKPKLDQAVEETIKKGGYDMVI
SKP_SHISS       LQSMKAGSDRTKLEK---DVMAQRQTFAQKAQAFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVV
SKP_SHIFL       LQSMKAGSDRTKLEK---DVMAQRQTFAQKAQAFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVV
SKP_SHIDS       LQSMKAGSDRTKLEK---DVMAQRQTFAQKAQAFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVV
SKP_SHIBS       LQSMKAGSDRTKLEK---DVMAQRQTFAQKAQAFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVV
SKP_ECOLI       LQSMKAGSDRTKLEK---DVMAQRQTFAQKAQAFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVV
SKP_ECOL6       LQSMKAGSDRTKLEK---DVMAQRQTFAQKAQAFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVV
SKP_ECO57       LQSMKAGSDRTKLEK---DVMAQRQTFAQKAQAFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVV
SKP_SALTY       LQSMKAGSDRTKLEK---DVMSQRQTFAQKAQAFEKDRARRSNEERNKLVTRIQTAVKKVANDQSIDLVV
SKP_SALTI       LQSMKAGSDRTKLEK---DVMSQRQTFAQKAQAFEKDRARRSNEERNKLVTRIQTAVKKVANDQSIDLVV
SKP_SALPA       LQSMKAGSDRTKLEK---DVMSQRQTFAQKAQAFEKDRARRSNEERNKLVTRIQTAVKKVANDQSIDLVV
SKP_SALCH       LQSMKAGSDRTKLEK---DVMSQRQTFAQKAQAFEKDRARRSNEERNKLVTRIQTAVKKVANDQSIDLVV
SKP_VIBCH       LKRDGQLMGQDEVEKLRIEIGQLDSKYKIKAQALEQREAEEKQKLFKVIQ----DAVKKVAEKEGYDIVL
OM25_PASMU      LQKDAPKLRSADIKKREEEINKLGNSEQEAINKLYQDDYAKRERETAKLVDSIQNAVNTVAREKNYTLVL
DIXC1_HUMAN     QQDTSVLQLKQELDELHNQNVDLQRKLDERNRLLGEKELGQKDRLLQQHQAKLEEALRKLSDVSYHQVDL
DIXC1_MOUSE     QQDTSVLQLKQELDELHNQNVDLQRKLEERNRLLYKKELGQKDRLFQQQQAKLEEALRKLS---------


                         +         .         .         .         .         *         .:210
query           TTQALAYVNNVDDISSQVVELMNKxxx
SKP_BLOFL       DTNAVVYFSHIKDITDSVSNQM-----
SKP_BLOPB       DTNAVLYHSRVTDITNSVMK-------
SKP_PHOLL       DANAVAYSVSGKNITTSVLK-------
SKP_ERWCT       DANAVAYVANAKDITADVLK-------
SKP_YERPS       DANAVAYADSSKDITADVLK-------
SKP_YERPE       DANAVAYADSSKDITADVLK-------
SKP_PHOLU       DANAVAYSVSGKNITASVLK-------
SKP_YEREN       DANAVAYADPSKDITADVLK-------
SKPL_PSEAE      ERGAVVDVKPQYDITRQVIERMNQ---
SKP_SHISS       DANAVAYSSDVKDITADVLK-------
SKP_SHIFL       DANAVAYSSDVKDITADVLK-------
SKP_SHIDS       DANAVAYSSDVKDITADVLK-------
SKP_SHIBS       DANAVAYSSDVKDITADVLK-------
SKP_ECOLI       DANAVAYSSDVKDITADVLK-------
SKP_ECOL6       DANAVAYSSDVKDITADVLK-------
SKP_ECO57       DANAVAYSSDVKDITADVLK-------
SKP_SALTY       DANTVAYSSDVKDITADVLK-------
SKP_SALTI       DANTVAYSSDVKDITADVLK-------
SKP_SALPA       DANTVAYSSDVKDITADVLK-------
SKP_SALCH       DANTVAYSSDVKDITADVLK-------
SKP_VIBCH       DTSSMQYGKPEHNLSEKVIK-------
OM25_PASMU      NEGAVVFAADAKNITEDVLKVI-----
DIXC1_HUMAN     ---------------------------
DIXC1_MOUSE     ---------------------------