[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30394.1

[Show Plain Result]


## Summary of Sequence Search
    1::230
    1::230     e-126 100%  230 aa  RNC_FRATM RecName: Full=Ribonuclease 3;       
    1::230     e-126 100%  230 aa  RNC_FRATH RecName: Full=Ribonuclease 3;       
    1::230     e-126 100%  230 aa  RNC_FRATO RecName: Full=Ribonuclease 3;       
    1::230     e-126 100%  230 aa  RNC_FRATF RecName: Full=Ribonuclease 3;       
    1::230     e-126  99%  230 aa  RNC_FRATN RecName: Full=Ribonuclease 3;       
    1::230     e-125 100%  230 aa  RNC_FRATW RecName: Full=Ribonuclease 3;       
    1::230     e-125  99%  230 aa  RNC_FRATT RecName: Full=Ribonuclease 3;       
    1::230     e-125  99%  230 aa  RNC_FRAT1 RecName: Full=Ribonuclease 3;       
    1::230     e-103  80%  230 aa  RNC_FRAP2 RecName: Full=Ribonuclease 3;       
    6::220     2e-49  44%  226 aa  RNC_WIGBR RecName: Full=Ribonuclease 3;       
    9::226     1e-48  46%  226 aa  RNC_SHEAM RecName: Full=Ribonuclease 3;       
    9::226     3e-48  46%  226 aa  RNC_SHESR RecName: Full=Ribonuclease 3;       
    9::226     3e-48  46%  226 aa  RNC_SHESM RecName: Full=Ribonuclease 3;       
    9::226     3e-48  46%  226 aa  RNC_SHESA RecName: Full=Ribonuclease 3;       
    9::226     3e-48  46%  226 aa  RNC_SHEON RecName: Full=Ribonuclease 3;       
    9::226     4e-48  46%  226 aa  RNC_SHEB8 RecName: Full=Ribonuclease 3;       
    1::225     4e-48  45%  225 aa  RNC_PASMU RecName: Full=Ribonuclease 3;       
   13::223     4e-48  47%  226 aa  RNC_HAMD5 RecName: Full=Ribonuclease 3;       
    9::226     2e-47  46%  226 aa  RNC_SHESW RecName: Full=Ribonuclease 3;       
    9::226     2e-47  46%  226 aa  RNC_SHEPC RecName: Full=Ribonuclease 3;       
    9::226     2e-47  46%  226 aa  RNC_SHEB9 RecName: Full=Ribonuclease 3;       
    9::226     2e-47  46%  226 aa  RNC_SHEB5 RecName: Full=Ribonuclease 3;       
    9::226     2e-47  46%  226 aa  RNC_SHEB2 RecName: Full=Ribonuclease 3;       
    8::220     2e-47  46%  226 aa  RNC_BUCBP RecName: Full=Ribonuclease 3;       
   12::223     3e-47  46%  223 aa  RNC_VIBF1 RecName: Full=Ribonuclease 3;       
    9::225     5e-47  47%  225 aa  RNC_SHEPW RecName: Full=Ribonuclease 3;       
    9::225     5e-47  45%  225 aa  RNC_SHEPA RecName: Full=Ribonuclease 3;       
    1::209     6e-47  46%  225 aa  RNC_VIBC3 RecName: Full=Ribonuclease 3;       
    7::223     8e-47  46%  226 aa  RNC_SALCH RecName: Full=Ribonuclease 3;       
    7::209     8e-47  47%  226 aa  RNC_PHOLL RecName: Full=Ribonuclease 3;       
    9::225     1e-46  45%  225 aa  RNC_SHEHH RecName: Full=Ribonuclease 3;       
   13::210     1e-46  48%  226 aa  RNC_PROMH RecName: Full=Ribonuclease 3;       
    6::212     1e-46  45%  229 aa  RNC_IDILO RecName: Full=Ribonuclease 3;       
    8::220     2e-46  46%  226 aa  RNC_BUCAT RecName: Full=Ribonuclease 3;       
    8::220     2e-46  46%  226 aa  RNC_BUCAI RecName: Full=Ribonuclease 3;       
    8::220     2e-46  46%  226 aa  RNC_BUCA5 RecName: Full=Ribonuclease 3;       
    1::209     3e-46  45%  225 aa  RNC_VIBCM RecName: Full=Ribonuclease 3;       
    1::209     3e-46  45%  225 aa  RNC_VIBCH RecName: Full=Ribonuclease 3;       
    1::208     2e-45  46%  224 aa  RNC_PHOPR RecName: Full=Ribonuclease 3;       
    9::225     3e-45  45%  225 aa  RNC_SHELP RecName: Full=Ribonuclease 3;       
    1::211     3e-45  44%  226 aa  RNC_HAHCH RecName: Full=Ribonuclease 3;       
    7::209     3e-45  46%  226 aa  RNC_PECCP RecName: Full=Ribonuclease 3;       
    8::220     4e-45  45%  226 aa  RNC_BUCCC RecName: Full=Ribonuclease 3;       
    6::221     6e-45  45%  224 aa  RNC_MANSM RecName: Full=Ribonuclease 3;       
   12::209     8e-45  47%  225 aa  RNC_VIBSL RecName: Full=Ribonuclease 3;       
    4::211     8e-45  45%  226 aa  RNC_SHEDO RecName: Full=Ribonuclease 3;       
    7::225     1e-44  46%  228 aa  RNC_PSYIN RecName: Full=Ribonuclease 3;       
    7::223     1e-44  44%  226 aa  RNC_ENT38 RecName: Full=Ribonuclease 3;       
    9::212     1e-44  47%  266 aa  RNC_COLP3 RecName: Full=Ribonuclease 3;       
   12::209     1e-44  47%  225 aa  RNC_VIBPA RecName: Full=Ribonuclease 3;       
    7::209     1e-44  45%  226 aa  RNC_SODGM RecName: Full=Ribonuclease 3;       
    9::211     1e-44  46%  226 aa  RNC_SHEFN RecName: Full=Ribonuclease 3;       
    7::209     1e-44  45%  226 aa  RNC_ERWCT RecName: Full=Ribonuclease 3;       
   12::209     2e-44  46%  225 aa  RNC_VIBVY RecName: Full=Ribonuclease 3;       
   12::209     2e-44  46%  225 aa  RNC_VIBVU RecName: Full=Ribonuclease 3;       
   12::209     2e-44  47%  225 aa  RNC_VIBHB RecName: Full=Ribonuclease 3;       
    7::209     2e-44  45%  226 aa  RNC_EDWI9 RecName: Full=Ribonuclease 3;       
    7::209     3e-44  45%  226 aa  RNC_YERPS RecName: Full=Ribonuclease 3;       
    7::209     3e-44  45%  226 aa  RNC_YERPP RecName: Full=Ribonuclease 3;       
    7::209     3e-44  45%  226 aa  RNC_YERPN RecName: Full=Ribonuclease 3;       
    7::209     3e-44  45%  226 aa  RNC_YERPG RecName: Full=Ribonuclease 3;       
    7::209     3e-44  45%  226 aa  RNC_YERPE RecName: Full=Ribonuclease 3;       
    7::209     3e-44  45%  226 aa  RNC_YERPA RecName: Full=Ribonuclease 3;       
    7::209     3e-44  45%  226 aa  RNC_YERP3 RecName: Full=Ribonuclease 3;       
    7::209     4e-44  46%  226 aa  RNC_YERE8 RecName: Full=Ribonuclease 3;       
   11::224     4e-44  46%  227 aa  RNC_HAEIN RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_SHISS RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_SHIFL RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_SHIF8 RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_SHIDS RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_SHIBS RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_SHIB3 RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_ESCF3 RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_ECOUT RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_ECOSM RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_ECOSE RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_ECOLU RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_ECOLI RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_ECOLC RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_ECOL6 RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_ECOL5 RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_ECOK1 RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_ECOHS RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_ECODH RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_ECOBW RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_ECO8A RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_ECO81 RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_ECO7I RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_ECO5E RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_ECO57 RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_ECO55 RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_ECO45 RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_ECO27 RecName: Full=Ribonuclease 3;       
    7::209     6e-44  46%  226 aa  RNC_ECO24 RecName: Full=Ribonuclease 3;       
    7::220     6e-44  45%  226 aa  RNC_BUCAP RecName: Full=Ribonuclease 3;       
    7::210     8e-44  45%  226 aa  RNC_SERP5 RecName: Full=Ribonuclease 3;       
   11::224     8e-44  46%  227 aa  RNC_HAEIG RecName: Full=Ribonuclease 3;       
    1::215     1e-43  45%  229 aa  RNC_PSEPG RecName: Full=Ribonuclease 3;       
   10::223     1e-43  44%  229 aa  RNC_BLOPB RecName: Full=Ribonuclease 3;       
   11::224     2e-43  46%  227 aa  RNC_HAEIE RecName: Full=Ribonuclease 3;       
   11::224     2e-43  46%  227 aa  RNC_HAEI8 RecName: Full=Ribonuclease 3;       
   16::226     2e-43  44%  232 aa  RNC_BLOFL RecName: Full=Ribonuclease 3;       
   12::230     2e-43  46%  230 aa  RNC_ACIAD RecName: Full=Ribonuclease 3;       
    1::225     2e-43  45%  230 aa  RNC_METCA RecName: Full=Ribonuclease 3;       
    1::208     3e-43  46%  229 aa  RNC_PSEPW RecName: Full=Ribonuclease 3;       
    6::208     3e-43  48%  229 aa  RNC_PSEF5 RecName: Full=Ribonuclease 3;       
    7::209     4e-43  45%  226 aa  RNC_KLEP7 RecName: Full=Ribonuclease 3;       
    7::209     4e-43  45%  226 aa  RNC_KLEP3 RecName: Full=Ribonuclease 3;       
    2::220     4e-43  43%  223 aa  RNC_HAEPS RecName: Full=Ribonuclease 3;       
    6::208     5e-43  48%  229 aa  RNC_PSESM RecName: Full=Ribonuclease 3;       
   12::215     5e-43  47%  229 aa  RNC_PSEPK RecName: Full=Ribonuclease 3;       
   12::215     5e-43  47%  229 aa  RNC_PSEP1 RecName: Full=Ribonuclease 3;       
    1::208     5e-43  46%  229 aa  RNC_PSEMY RecName: Full=Ribonuclease 3;       
   10::220     5e-43  45%  223 aa  RNC_HAES2 RecName: Full=Ribonuclease 3;       
    7::223     7e-43  42%  227 aa  RNC_XYLFT RecName: Full=Ribonuclease 3;       
    7::223     7e-43  42%  227 aa  RNC_XYLF2 RecName: Full=Ribonuclease 3;       
    6::208     7e-43  47%  229 aa  RNC_PSEU2 RecName: Full=Ribonuclease 3;       
    7::209     9e-43  45%  226 aa  RNC_SALTI RecName: Full=Ribonuclease 3;       
    6::208     9e-43  47%  229 aa  RNC_PSE14 RecName: Full=Ribonuclease 3;       
    7::209     1e-42  45%  226 aa  RNC_SALTY RecName: Full=Ribonuclease 3;       
    7::209     1e-42  45%  226 aa  RNC_SALPK RecName: Full=Ribonuclease 3;       
    7::209     1e-42  45%  226 aa  RNC_SALPA RecName: Full=Ribonuclease 3;       
    7::209     1e-42  45%  226 aa  RNC_SALG2 RecName: Full=Ribonuclease 3;       
    7::209     1e-42  45%  226 aa  RNC_SALEP RecName: Full=Ribonuclease 3;       
    1::214     2e-42  44%  233 aa  RNC_NITOC RecName: Full=Ribonuclease 3;       
   11::220     2e-42  44%  233 aa  RNC_COXBN RecName: Full=Ribonuclease 3;       
    5::222     3e-42  43%  222 aa  RNC_HAEDU RecName: Full=Ribonuclease 3;       
    1::212     3e-42  45%  229 aa  RNC_AZOVD RecName: Full=Ribonuclease 3;       
    6::221     3e-42  43%  224 aa  RNC_ACTSZ RecName: Full=Ribonuclease 3;       
    1::208     4e-42  46%  229 aa  RNC_PSEFS RecName: Full=Ribonuclease 3;       
   13::210     4e-42  45%  226 aa  RNC_ERWT9 RecName: Full=Ribonuclease 3;       
   11::220     5e-42  44%  233 aa  RNC_COXB2 RecName: Full=Ribonuclease 3;       
   11::220     5e-42  44%  233 aa  RNC_COXB1 RecName: Full=Ribonuclease 3;       
    7::223     6e-42  42%  227 aa  RNC_XYLFA RecName: Full=Ribonuclease 3;       
    1::208     6e-42  45%  229 aa  RNC_PSEE4 RecName: Full=Ribonuclease 3;       
   12::228     6e-42  43%  228 aa  RNC_ALHEH RecName: Full=Ribonuclease 3;       
   12::230     6e-42  44%  230 aa  RNC_ACIBY RecName: Full=Ribonuclease 3;       
   12::230     6e-42  44%  230 aa  RNC_ACIBT RecName: Full=Ribonuclease 3;       
    2::221     8e-42  43%  223 aa  RNC_ACTPJ RecName: Full=Ribonuclease 3;       
    7::223     1e-41  42%  227 aa  RNC_XYLFM RecName: Full=Ribonuclease 3;       
   10::205     1e-41  45%  252 aa  RNC_BORPD RecName: Full=Ribonuclease 3;       
   12::212     2e-41  46%  229 aa  RNC_PSEA7 RecName: Full=Ribonuclease 3;       
   11::220     2e-41  44%  233 aa  RNC_COXBU RecName: Full=Ribonuclease 3;       
   11::220     2e-41  44%  233 aa  RNC_COXBR RecName: Full=Ribonuclease 3;       
   12::212     2e-41  46%  229 aa  RNC_PSEAE RecName: Full=Ribonuclease 3;       
   12::212     2e-41  46%  229 aa  RNC_PSEAB RecName: Full=Ribonuclease 3;       
   12::212     2e-41  46%  229 aa  RNC_PSEA8 RecName: Full=Ribonuclease 3;       
   13::209     3e-41  44%  256 aa  RNC_BORPE RecName: Full=Ribonuclease 3;       
   13::209     3e-41  44%  256 aa  RNC_BORPA RecName: Full=Ribonuclease 3;       
   13::209     3e-41  44%  256 aa  RNC_BORBR RecName: Full=Ribonuclease 3;       
   10::206     3e-41  44%  251 aa  RNC_BORA1 RecName: Full=Ribonuclease 3;       
    2::221     3e-41  42%  223 aa  RNC_ACTP2 RecName: Full=Ribonuclease 3;       
    5::208     7e-41  44%  227 aa  RNC_MARMS RecName: Full=Ribonuclease 3;       
    6::208     1e-40  46%  229 aa  RNC_PSEPF RecName: Full=Ribonuclease 3;       
   12::222     6e-40  40%  226 aa  RNC_XANCP RecName: Full=Ribonuclease 3;       
   12::222     6e-40  40%  226 aa  RNC_XANC8 RecName: Full=Ribonuclease 3;       
   10::218     6e-40  42%  256 aa  RNC_RALSO RecName: Full=Ribonuclease 3;       
   10::218     3e-39  42%  256 aa  RNC_RALPJ RecName: Full=Ribonuclease 3;       
    1::207     3e-39  42%  225 aa  RNC_PSEHT RecName: Full=Ribonuclease 3;       
   41::254     4e-39  44%  265 aa  RNC_PSYA2 RecName: Full=Ribonuclease 3;       
   12::225     1e-38  38%  226 aa  RNC_XANOR RecName: Full=Ribonuclease 3;       
   23::225     1e-38  44%  245 aa  RNC_NITEU RecName: Full=Ribonuclease 3;       
   12::222     2e-38  39%  226 aa  RNC_XANAC RecName: Full=Ribonuclease 3;       
   12::214     2e-38  45%  230 aa  RNC_ACIBS RecName: Full=Ribonuclease 3;       
    4::226     5e-38  39%  228 aa  RNC_ALCBS RecName: Full=Ribonuclease 3;       
    9::210     7e-38  42%  225 aa  RNC_SHEWM RecName: Full=Ribonuclease 3;       
    3::189     7e-38  45%  224 aa  RNC_ARCB4 RecName: Full=Ribonuclease 3;       
    8::208     2e-37  42%  226 aa  RNC_THIDA RecName: Full=Ribonuclease 3;       
   10::210     3e-37  44%  222 aa  RNC_DECAR RecName: Full=Ribonuclease 3;       
   10::202     4e-37  42%  256 aa  RNC_RALEJ RecName: Full=Ribonuclease 3;       
   11::228     6e-37  42%  232 aa  RNC_WOLWR RecName: Full=Ribonuclease 3;       
   11::228     6e-37  42%  232 aa  RNC_WOLPM RecName: Full=Ribonuclease 3;       
   10::202     8e-37  42%  256 aa  RNC_RALEH RecName: Full=Ribonuclease 3;       
   10::202     8e-37  42%  256 aa  RNC_CUPTR RecName: Full=Ribonuclease 3;       
   10::202     1e-36  42%  256 aa  RNC_RALME RecName: Full=Ribonuclease 3;       
    5::219     1e-36  39%  223 aa  RNC_CAMFF RecName: Full=Ribonuclease 3;       
   12::211     2e-36  43%  228 aa  RNC_RHOFD RecName: Full=Ribonuclease 3;       
   12::222     2e-36  40%  227 aa  RNC_DELAS RecName: Full=Ribonuclease 3;       
   12::222     4e-36  40%  224 aa  RNC_LEGPH RecName: Full=Ribonuclease 3;       
   12::222     4e-36  40%  224 aa  RNC_LEGPC RecName: Full=Ribonuclease 3;       
   12::222     4e-36  40%  224 aa  RNC_LEGPA RecName: Full=Ribonuclease 3;       
   12::226     5e-36  39%  228 aa  RNC_VARPS RecName: Full=Ribonuclease 3;       
    9::210     5e-36  40%  225 aa  RNC_SHESH RecName: Full=Ribonuclease 3;       
   12::222     5e-36  39%  224 aa  RNC_LEGPL RecName: Full=Ribonuclease 3;       
   23::225     8e-36  43%  245 aa  RNC_NITEC RecName: Full=Ribonuclease 3;       
   11::228     1e-35  41%  230 aa  RNC_WOLPP RecName: Full=Ribonuclease 3;       
   11::230     1e-35  40%  232 aa  RNC_HYDS0 RecName: Full=Ribonuclease 3;       
    1::190     1e-35  44%  225 aa  RNC_AZOSE RecName: Full=Ribonuclease 3;       
   11::221     1e-35  42%  225 aa  RNC_CAMJD RecName: Full=Ribonuclease 3;       
   11::221     3e-35  41%  224 aa  RNC_CAMJE RecName: Full=Ribonuclease 3;       
   11::221     4e-35  41%  224 aa  RNC_CAMJR RecName: Full=Ribonuclease 3;       
   18::213     5e-35  39%  239 aa  RNC_NEIMA RecName: Full=Ribonuclease 3;       
   18::213     5e-35  40%  239 aa  RNC_NEIG2 RecName: Full=Ribonuclease 3;       
   11::221     5e-35  41%  224 aa  RNC_CAMJ8 RecName: Full=Ribonuclease 3;       
   15::246     7e-35  38%  246 aa  RNC_TREDE RecName: Full=Ribonuclease 3;       
    9::226     7e-35  41%  228 aa  RNC_THETN RecName: Full=Ribonuclease 3;       
   18::213     2e-34  39%  239 aa  RNC_NEIMB RecName: Full=Ribonuclease 3;       
   17::236     4e-34  37%  238 aa  RNC_HELPS RecName: Full=Ribonuclease 3;       
   18::237     4e-34  37%  239 aa  RNC_HELP2 RecName: Full=Ribonuclease 3;       
   18::213     5e-34  39%  239 aa  RNC_NEIG1 RecName: Full=Ribonuclease 3;       
   18::237     5e-34  37%  239 aa  RNC_HELPY RecName: Full=Ribonuclease 3;       
   18::237     6e-34  37%  239 aa  RNC_HELPJ RecName: Full=Ribonuclease 3;       
   37::222     8e-34  39%  226 aa  RNC_XANC5 RecName: Full=Ribonuclease 3;       
   18::237     8e-34  37%  239 aa  RNC_HELPG RecName: Full=Ribonuclease 3;       
   17::221     1e-33  41%  240 aa  RNC_HELHP RecName: Full=Ribonuclease 3;       
   21::237     3e-33  40%  243 aa  RNC_WOLTR RecName: Full=Ribonuclease 3;       
    7::230     5e-33  38%  238 aa  RNC_WOLSU RecName: Full=Ribonuclease 3;       
    4::224     5e-33  40%  225 aa  RNC_RICFE RecName: Full=Ribonuclease 3;       
   15::238     1e-32  37%  241 aa  RNC_DESPS RecName: Full=Ribonuclease 3;       
   13::230     1e-32  37%  234 aa  RNC_HELAH RecName: Full=Ribonuclease 3;       
   10::223     1e-32  37%  223 aa  RNC_CAMC5 RecName: Full=Ribonuclease 3;       
   16::230     2e-32  40%  230 aa  RNC_STRU0 RecName: Full=Ribonuclease 3;       
   10::224     4e-32  40%  227 aa  RNC_RICAH RecName: Full=Ribonuclease 3;       
    2::211     4e-32  39%  229 aa  RNC_DESDG RecName: Full=Ribonuclease 3;       
    7::189     4e-32  43%  223 aa  RNC_CAMC1 RecName: Full=Ribonuclease 3;       
   12::230     4e-32  36%  232 aa  RNC_ANAMF RecName: Full=Ribonuclease 3;       
    3::192     7e-32  41%  226 aa  RNC_NITSB RecName: Full=Ribonuclease 3;       
   13::228     1e-31  35%  234 aa  RNC_BDEBA RecName: Full=Ribonuclease 3;       
    4::224     1e-31  39%  225 aa  RNC_RICPR RecName: Full=Ribonuclease 3;       
   12::230     2e-31  36%  232 aa  RNC_ANAMM RecName: Full=Ribonuclease 3;       
    3::194     2e-31  39%  223 aa  RNC_SULNB RecName: Full=Ribonuclease 3;       
    8::221     2e-31  39%  226 aa  RNC_EHRCR RecName: Full=Ribonuclease 3;       
   18::230     5e-31  37%  230 aa  RNC_NATTJ RecName: Full=Ribonuclease 3;       
    4::224     6e-31  39%  227 aa  RNC_RICTY RecName: Full=Ribonuclease 3;       
    1::225     8e-31  39%  231 aa  RNC_LACLS RecName: Full=Ribonuclease 3;       
   11::219     8e-31  40%  221 aa  RNC_AQUAE RecName: Full=Ribonuclease 3;       
    1::225     1e-30  39%  231 aa  RNC_LACLA RecName: Full=Ribonuclease 3;       
    1::225     1e-30  39%  231 aa  RNC_LACLM RecName: Full=Ribonuclease 3;       
    4::224     2e-30  38%  227 aa  RNC_RICRS RecName: Full=Ribonuclease 3;       
    4::224     2e-30  38%  227 aa  RNC_RICRO RecName: Full=Ribonuclease 3;       
    4::224     2e-30  38%  227 aa  RNC_RICAE RecName: Full=Ribonuclease 3;       
    4::224     2e-30  38%  227 aa  RNC_RICPU RecName: Full=Ribonuclease 3;       
   18::246     2e-30  35%  246 aa  RNC_BORBU RecName: Full=Ribonuclease 3;       
    4::224     5e-30  38%  227 aa  RNC_RICCK RecName: Full=Ribonuclease 3;       
   10::224     7e-30  39%  227 aa  RNC_RICM5 RecName: Full=Ribonuclease 3;       
    4::224     7e-30  38%  227 aa  RNC_RICCN RecName: Full=Ribonuclease 3;       
   25::226     9e-30  40%  242 aa  RNC_PARUW RecName: Full=Ribonuclease 3;       
   17::245     1e-29  35%  245 aa  RNC_BORGA RecName: Full=Ribonuclease 3;       
   11::222     2e-29  36%  234 aa  RNC_FUSNN RecName: Full=Ribonuclease 3;       
   17::245     2e-29  35%  245 aa  RNC_BORAP RecName: Full=Ribonuclease 3;       
   14::230     3e-29  38%  230 aa  RNC_ENTFA RecName: Full=Ribonuclease 3;       
   12::226     3e-29  40%  235 aa  RNC_CLOTE RecName: Full=Ribonuclease 3;       
   15::233     3e-29  36%  236 aa  RNC_ANAPZ RecName: Full=Ribonuclease 3;       
   16::225     4e-29  42%  232 aa  RNC_STRSV RecName: Full=Ribonuclease 3;       
    4::224     8e-29  37%  227 aa  RNC_RICBR RecName: Full=Ribonuclease 3;       
    4::224     8e-29  37%  227 aa  RNC_RICB8 RecName: Full=Ribonuclease 3;       
    3::229     8e-29  35%  229 aa  RNC_LISMH RecName: Full=Ribonuclease 3;       
    3::229     1e-28  35%  229 aa  RNC_LISMF RecName: Full=Ribonuclease 3;       
    3::229     1e-28  35%  229 aa  RNC_LISMC RecName: Full=Ribonuclease 3;       
   10::229     2e-28  39%  230 aa  RNC_STRS7 RecName: Full=Ribonuclease 3;       
   12::223     2e-28  38%  246 aa  RNC_MAGSM RecName: Full=Ribonuclease 3;       
    3::229     2e-28  35%  229 aa  RNC_LISW6 RecName: Full=Ribonuclease 3;       
   18::199     3e-28  38%  235 aa  RNC_SYMTH RecName: Full=Ribonuclease 3;       
   13::214     3e-28  37%  241 aa  RNC_PELTS RecName: Full=Ribonuclease 3;       
   12::203     4e-28  37%  238 aa  RNC_THELT RecName: Full=Ribonuclease 3;       
   10::229     4e-28  38%  230 aa  RNC_STRE4 RecName: Full=Ribonuclease 3;       
   34::216     4e-28  43%  272 aa  RNC_STRCO RecName: Full=Ribonuclease 3;       
    3::229     4e-28  35%  229 aa  RNC_LISIN RecName: Full=Ribonuclease 3;       
   28::210     5e-28  43%  276 aa  RNC_STRAW RecName: Full=Ribonuclease 3;       
    3::226     6e-28  35%  229 aa  RNC_LISMO RecName: Full=Ribonuclease 3;       
   10::225     8e-28  38%  232 aa  RNC_STRZT RecName: Full=Ribonuclease 3;       
   10::225     8e-28  38%  232 aa  RNC_STRPJ RecName: Full=Ribonuclease 3;       
   10::225     8e-28  38%  232 aa  RNC_STRPI RecName: Full=Ribonuclease 3;       
   14::231     8e-28  37%  231 aa  RNC_LACPL RecName: Full=Ribonuclease 3;       
   25::195     1e-27  41%  240 aa  RNC_THEFY RecName: Full=Ribonuclease 3;       
   10::225     1e-27  38%  232 aa  RNC_STRZJ RecName: Full=Ribonuclease 3;       
   10::225     1e-27  38%  232 aa  RNC_STRPS RecName: Full=Ribonuclease 3;       
   10::225     1e-27  38%  232 aa  RNC_STRPN RecName: Full=Ribonuclease 3;       
   10::225     1e-27  38%  232 aa  RNC_STRP7 RecName: Full=Ribonuclease 3;       
   38::242     1e-27  37%  249 aa  RNC_CORDI RecName: Full=Ribonuclease 3;       
   35::242     1e-27  38%  263 aa  RNC_BACHD RecName: Full=Ribonuclease 3;       
   10::225     1e-27  38%  232 aa  RNC_STRZP RecName: Full=Ribonuclease 3;       
   13::227     1e-27  37%  239 aa  RNC_RHILW RecName: Full=Ribonuclease 3;       
    6::228     1e-27  38%  231 aa  RNC_MESFL RecName: Full=Ribonuclease 3;       
    5::193     1e-27  40%  232 aa  RNC_CLOBB RecName: Full=Ribonuclease 3;       
   12::199     1e-27  41%  244 aa  RNC_CHLSY RecName: Full=Ribonuclease 3;       
   12::199     1e-27  41%  244 aa  RNC_CHLAA RecName: Full=Ribonuclease 3;       
   16::225     2e-27  39%  232 aa  RNC_STRR6 RecName: Full=Ribonuclease 3;       
   16::225     2e-27  39%  232 aa  RNC_STRP4 RecName: Full=Ribonuclease 3;       
   16::225     2e-27  39%  232 aa  RNC_STRP2 RecName: Full=Ribonuclease 3;       
   37::243     2e-27  38%  244 aa  RNC_CORJK RecName: Full=Ribonuclease 3;       
    5::193     2e-27  40%  232 aa  RNC_CLOBA RecName: Full=Ribonuclease 3;       
    8::211     2e-27  36%  236 aa  RNC_CHRVO RecName: Full=Ribonuclease 3;       
    9::223     2e-27  37%  238 aa  RNC_ANOFW RecName: Full=Ribonuclease 3;       
   13::227     2e-27  37%  239 aa  RNC_RHIE6 RecName: Full=Ribonuclease 3;       
   13::227     3e-27  37%  239 aa  RNC_RHIL3 RecName: Full=Ribonuclease 3;       
   14::228     3e-27  36%  230 aa  RNC_CLOAB RecName: Full=Ribonuclease 3;       
    8::220     3e-27  36%  235 aa  RNC_BART1 RecName: Full=Ribonuclease 3;       
   12::230     4e-27  34%  234 aa  RNC_ROSCS RecName: Full=Ribonuclease 3;       
   24::194     5e-27  43%  233 aa  RNC_SYNWW RecName: Full=Ribonuclease 3;       
   12::239     5e-27  39%  271 aa  RNC_SOLUE RecName: Full=Ribonuclease 3;       
    6::192     5e-27  39%  227 aa  RNC_JANSC RecName: Full=Ribonuclease 3;       
   12::203     5e-27  37%  235 aa  RNC_CARHZ RecName: Full=Ribonuclease 3;       
   11::227     5e-27  33%  239 aa  RNC_AGRT5 RecName: Full=Ribonuclease 3;       
   18::227     7e-27  38%  239 aa  RNC_RHIEC RecName: Full=Ribonuclease 3;       
   12::229     7e-27  34%  237 aa  RNC_CLOPE RecName: Full=Ribonuclease 3;       
    6::198     9e-27  38%  225 aa  RNC_SILPO RecName: Full=Ribonuclease 3;       
   22::207     9e-27  38%  245 aa  RNC_BACCR RecName: Full=Ribonuclease 3;       
   22::207     9e-27  38%  245 aa  RNC_BACC4 RecName: Full=Ribonuclease 3;       
   22::207     9e-27  38%  245 aa  RNC_BACC2 RecName: Full=Ribonuclease 3;       
   11::230     1e-26  36%  232 aa  RNC_LACS1 RecName: Full=Ribonuclease 3;       
   14::208     2e-26  37%  223 aa  RNC_ZYMMO RecName: Full=Ribonuclease 3;       
   16::217     2e-26  36%  232 aa  RNC_PEDPA RecName: Full=Ribonuclease 3;       
   19::207     2e-26  37%  245 aa  RNC_BACHK RecName: Full=Ribonuclease 3;       
   19::207     2e-26  37%  245 aa  RNC_BACC3 RecName: Full=Ribonuclease 3;       
   19::207     2e-26  37%  245 aa  RNC_BACC0 RecName: Full=Ribonuclease 3;       
   19::207     2e-26  37%  245 aa  RNC_BACAN RecName: Full=Ribonuclease 3;       
   19::207     2e-26  37%  245 aa  RNC_BACAC RecName: Full=Ribonuclease 3;       
   19::207     2e-26  37%  245 aa  RNC_BACAA RecName: Full=Ribonuclease 3;       
   16::226     3e-26  34%  233 aa  RNC_LACRJ RecName: Full=Ribonuclease 3;       
   16::226     3e-26  34%  233 aa  RNC_LACRD RecName: Full=Ribonuclease 3;       
   22::207     3e-26  38%  245 aa  RNC_BACCQ RecName: Full=Ribonuclease 3;       
   22::207     3e-26  38%  245 aa  RNC_BACC7 RecName: Full=Ribonuclease 3;       
   22::207     3e-26  38%  245 aa  RNC_BACC1 RecName: Full=Ribonuclease 3;       
   13::227     4e-26  37%  228 aa  RNC_STRA5 RecName: Full=Ribonuclease 3;       
   13::227     4e-26  37%  228 aa  RNC_STRA3 RecName: Full=Ribonuclease 3;       
   13::227     4e-26  37%  228 aa  RNC_STRA1 RecName: Full=Ribonuclease 3;       
   22::207     4e-26  37%  245 aa  RNC_BACWK RecName: Full=Ribonuclease 3;       
    9::225     5e-26  39%  232 aa  RNC_STRGC RecName: Full=Ribonuclease 3;       
   15::225     5e-26  37%  238 aa  RNC_PHEZH RecName: Full=Ribonuclease 3;       
   10::226     5e-26  34%  228 aa  RNC_OCEIH RecName: Full=Ribonuclease 3;       
    6::194     5e-26  38%  229 aa  RNC_DINSH RecName: Full=Ribonuclease 3;       
   38::244     5e-26  36%  247 aa  RNC_CORGL RecName: Full=Ribonuclease 3;       
   22::207     5e-26  38%  245 aa  RNC_BACCZ RecName: Full=Ribonuclease 3;       
    5::183     6e-26  39%  221 aa  RNC_RHILO RecName: Full=Ribonuclease 3;       
   14::237     6e-26  36%  244 aa  RNC_CLOK5 RecName: Full=Ribonuclease 3;       
   14::237     6e-26  36%  244 aa  RNC_CLOK1 RecName: Full=Ribonuclease 3;       
   19::207     6e-26  37%  245 aa  RNC_BACCN RecName: Full=Ribonuclease 3;       
   35::245     8e-26  35%  247 aa  RNC_COREF RecName: Full=Ribonuclease 3;       
   12::198     2e-25  36%  237 aa  RNC_ROSS1 RecName: Full=Ribonuclease 3;       
   14::200     2e-25  35%  232 aa  RNC_PELCD RecName: Full=Ribonuclease 3;       
    5::191     2e-25  37%  235 aa  RNC_METSB RecName: Full=Ribonuclease 3;       
    1::199     2e-25  39%  229 aa  RNC_CHLAD RecName: Full=Ribonuclease 3;       
   27::208     2e-25  39%  249 aa  RNC_BACLD RecName: Full=Ribonuclease 3;       
   18::216     3e-25  37%  233 aa  RNC_LEUCK RecName: Full=Ribonuclease 3;       
   47::257     4e-25  39%  276 aa  RNC_PELLD RecName: Full=Ribonuclease 3;       
   51::260     5e-25  37%  272 aa  RNC_RHOPA RecName: Full=Ribonuclease 3;       
   27::215     5e-25  37%  249 aa  RNC_BACSU RecName: Full=Ribonuclease 3;       
   12::217     7e-25  35%  222 aa  RNC_PELUB RecName: Full=Ribonuclease 3;       
   17::240     9e-25  34%  246 aa  RNC_GEOKA RecName: Full=Ribonuclease 3;       
   27::215     9e-25  37%  249 aa  RNC_BACA2 RecName: Full=Ribonuclease 3;       
   11::229     1e-24  36%  231 aa  RNC_SYNY3 RecName: Full=Ribonuclease 3;       
   24::242     1e-24  32%  245 aa  RNC_STAEQ RecName: Full=Ribonuclease 3;       
   31::238     1e-24  33%  266 aa  RNC_RHOBA RecName: Full=Ribonuclease 3;       
   13::235     1e-24  34%  239 aa  RNC_RHISN RecName: Full=Ribonuclease 3;       
   36::220     1e-24  37%  225 aa  RNC_PHYMT RecName: Full=Ribonuclease 3;       
    4::220     1e-24  34%  235 aa  RNC_BARQU RecName: Full=Ribonuclease 3;       
    9::198     2e-24  38%  246 aa  RNC_DESRM RecName: Full=Ribonuclease 3;       
   27::233     2e-24  35%  245 aa  RNC_BRUSU RecName: Full=Ribonuclease 3;       
   27::233     2e-24  35%  245 aa  RNC_BRUSI RecName: Full=Ribonuclease 3;       
   27::233     2e-24  35%  245 aa  RNC_BRUME RecName: Full=Ribonuclease 3;       
   27::233     2e-24  35%  245 aa  RNC_BRUMB RecName: Full=Ribonuclease 3;       
   27::233     2e-24  35%  245 aa  RNC_BRUC2 RecName: Full=Ribonuclease 3;       
   27::233     2e-24  35%  245 aa  RNC_BRUAB RecName: Full=Ribonuclease 3;       
   27::233     2e-24  35%  245 aa  RNC_BRUA2 RecName: Full=Ribonuclease 3;       
   27::233     2e-24  35%  245 aa  RNC_BRUA1 RecName: Full=Ribonuclease 3;       
   12::203     3e-24  35%  240 aa  RNC_THEMA RecName: Full=Ribonuclease 3;       
   12::203     3e-24  35%  240 aa  RNC_THESQ RecName: Full=Ribonuclease 3;       
   24::242     3e-24  31%  245 aa  RNC_STAES RecName: Full=Ribonuclease 3;       
   12::234     3e-24  34%  238 aa  RNC_RHIME RecName: Full=Ribonuclease 3;       
   13::203     3e-24  37%  232 aa  RNC_CLOB8 RecName: Full=Ribonuclease 3;       
   24::241     4e-24  33%  243 aa  RNC_STAAB RecName: Full=Ribonuclease 3;       
   12::234     4e-24  33%  238 aa  RNC_SINMW RecName: Full=Ribonuclease 3;       
   25::244     4e-24  35%  246 aa  RNC_GEOSW RecName: Full=Ribonuclease 3;       
    7::197     4e-24  42%  228 aa  RNC_ANASP RecName: Full=Ribonuclease 3;       
    1::201     6e-24  38%  240 aa  RNC_MYCTU RecName: Full=Ribonuclease 3;       
    1::201     6e-24  38%  240 aa  RNC_MYCBO RecName: Full=Ribonuclease 3;       
   36::238     6e-24  34%  253 aa  RNC_DESVH RecName: Full=Ribonuclease 3;       
    3::227     6e-24  34%  235 aa  RNC_BARHE RecName: Full=Ribonuclease 3;       
   41::234     6e-24  36%  260 aa  RNC_BACSK RecName: Full=Ribonuclease 3;       
    6::195     7e-24  37%  228 aa  RNC_RHOCA RecName: Full=Ribonuclease 3;       
   11::224     7e-24  35%  226 aa  RNC_EHRCJ RecName: Full=Ribonuclease 3;       
   16::239     1e-23  31%  245 aa  RNC_STAHJ RecName: Full=Ribonuclease 3;       
   24::241     1e-23  32%  243 aa  RNC_STAAW RecName: Full=Ribonuclease 3;       
   24::241     1e-23  32%  243 aa  RNC_STAAT RecName: Full=Ribonuclease 3;       
   24::241     1e-23  32%  243 aa  RNC_STAAS RecName: Full=Ribonuclease 3;       
   24::241     1e-23  32%  243 aa  RNC_STAAR RecName: Full=Ribonuclease 3;       
   24::241     1e-23  32%  243 aa  RNC_STAAN RecName: Full=Ribonuclease 3;       
   24::241     1e-23  32%  243 aa  RNC_STAAE RecName: Full=Ribonuclease 3;       
   24::241     1e-23  32%  243 aa  RNC_STAAC RecName: Full=Ribonuclease 3;       
   24::241     1e-23  32%  243 aa  RNC_STAA9 RecName: Full=Ribonuclease 3;       
   24::241     1e-23  32%  243 aa  RNC_STAA8 RecName: Full=Ribonuclease 3;       
   24::241     1e-23  32%  243 aa  RNC_STAA3 RecName: Full=Ribonuclease 3;       
   24::241     1e-23  32%  243 aa  RNC_STAA2 RecName: Full=Ribonuclease 3;       
   10::192     1e-23  35%  229 aa  RNC_RHOSK RecName: Full=Ribonuclease 3;       
   10::192     1e-23  35%  229 aa  RNC_RHOS4 RecName: Full=Ribonuclease 3;       
   10::192     1e-23  35%  229 aa  RNC_RHOS1 RecName: Full=Ribonuclease 3;       
    6::192     2e-23  35%  228 aa  RNC_ROSDO RecName: Full=Ribonuclease 3;       
   25::240     2e-23  34%  246 aa  RNC_GEOTN RecName: Full=Ribonuclease 3;       
   12::195     3e-23  36%  226 aa  RNC_SPHAL RecName: Full=Ribonuclease 3;       
   15::235     3e-23  35%  235 aa  RNC_HELMI RecName: Full=Ribonuclease 3;       
   29::240     3e-23  36%  250 aa  RNC_BRAJA RecName: Full=Ribonuclease 3;       
   18::227     3e-23  34%  239 aa  RNC_AGRVS RecName: Full=Ribonuclease 3;       
   24::241     4e-23  32%  243 aa  RNC_STAAM RecName: Full=Ribonuclease 3;       
   24::241     4e-23  32%  243 aa  RNC_STAA1 RecName: Full=Ribonuclease 3;       
   10::192     4e-23  35%  229 aa  RNC_RHOS5 RecName: Full=Ribonuclease 3;       
  299::533     4e-23  37%  538 aa  RNC_MIMIV RecName: Full=Probable ribonuclease 3;       
   14::212     4e-23  35%  232 aa  RNC_LACF3 RecName: Full=Ribonuclease 3;       
   19::227     4e-23  35%  239 aa  RNC_AGRRK RecName: Full=Ribonuclease 3;       
    9::217     5e-23  33%  237 aa  RNC_DEHSC RecName: Full=Ribonuclease 3;       
   20::233     5e-23  39%  308 aa  RNC_BACV8 RecName: Full=Ribonuclease 3;       
   23::239     8e-23  33%  248 aa  RNC_GEOSL RecName: Full=Ribonuclease 3;       
   56::242     1e-22  31%  244 aa  RNC_STAS1 RecName: Full=Ribonuclease 3;       
   12::231     1e-22  34%  235 aa  RNC_BARBK RecName: Full=Ribonuclease 3;       
   20::234     1e-22  36%  261 aa  RNC_AZOPC RecName: Full=Ribonuclease 3;       
   14::211     1e-22  36%  230 aa  RNC_LACSS RecName: Full=Ribonuclease 3;       
   14::183     1e-22  39%  228 aa  RNC_LACAC RecName: Full=Ribonuclease 3;       
   10::228     2e-22  33%  232 aa  RNC_MYCCT RecName: Full=Ribonuclease 3;       
   15::185     2e-22  38%  226 aa  RNC_LACJO RecName: Full=Ribonuclease 3;       
    9::223     2e-22  35%  227 aa  RNC_EHRRW RecName: Full=Ribonuclease 3;       
    9::223     2e-22  34%  227 aa  RNC_EHRRG RecName: Full=Ribonuclease 3;       
    1::209     4e-22  38%  247 aa  RNC_VEREI RecName: Full=Ribonuclease 3;       
   10::228     4e-22  36%  232 aa  RNC_MYCMS RecName: Full=Ribonuclease 3;       
   18::239     4e-22  31%  247 aa  RNC_LEPBL RecName: Full=Ribonuclease 3;       
   26::240     4e-22  39%  248 aa  RNC_CHLCH RecName: Full=Ribonuclease 3;       
   13::198     5e-22  37%  231 aa  RNC_OENOB RecName: Full=Ribonuclease 3;       
   18::239     5e-22  31%  247 aa  RNC_LEPBJ RecName: Full=Ribonuclease 3;       
   28::246     7e-22  31%  247 aa  RNC_LEPIN RecName: Full=Ribonuclease 3;       
   28::246     7e-22  31%  247 aa  RNC_LEPIC RecName: Full=Ribonuclease 3;       
   14::239     1e-21  31%  248 aa  RNC_SPICI RecName: Full=Ribonuclease 3;       
   27::228     2e-21  35%  242 aa  RNC_BIFLO RecName: Full=Ribonuclease 3;       
   21::235     2e-21  36%  237 aa  RNC_STRT2 RecName: Full=Ribonuclease 3;       
   21::235     2e-21  36%  237 aa  RNC_STRT1 RecName: Full=Ribonuclease 3;       
   13::227     3e-21  36%  229 aa  RNC_STRTD RecName: Full=Ribonuclease 3;       
   26::249     4e-21  35%  254 aa  RNC_TREPS RecName: Full=Ribonuclease 3;       
   26::249     4e-21  35%  254 aa  RNC_TREPA RecName: Full=Ribonuclease 3;       
   16::229     6e-21  34%  230 aa  RNC_STRPZ RecName: Full=Ribonuclease 3;       
   16::229     6e-21  34%  230 aa  RNC_STRPG RecName: Full=Ribonuclease 3;       
   16::229     6e-21  34%  230 aa  RNC_STRPD RecName: Full=Ribonuclease 3;       
   16::229     6e-21  34%  230 aa  RNC_STRP6 RecName: Full=Ribonuclease 3;       
   11::210     6e-21  33%  237 aa  RNC_DEHE1 RecName: Full=Ribonuclease 3;       
   20::243     6e-21  34%  311 aa  RNC_BACTN RecName: Full=Ribonuclease 3;       
   20::240     8e-21  33%  290 aa  RNC_BACFR RecName: Full=Ribonuclease 3;       
   20::240     8e-21  33%  290 aa  RNC_BACFN RecName: Full=Ribonuclease 3;       
   16::229     1e-20  34%  230 aa  RNC_STRPF RecName: Full=Ribonuclease 3;       
   16::229     1e-20  34%  230 aa  RNC_STRPC RecName: Full=Ribonuclease 3;       
   16::229     1e-20  34%  230 aa  RNC_STRPB RecName: Full=Ribonuclease 3;       
   16::229     1e-20  34%  230 aa  RNC_STRP8 RecName: Full=Ribonuclease 3;       
   16::229     1e-20  34%  230 aa  RNC_STRP3 RecName: Full=Ribonuclease 3;       
   16::229     1e-20  34%  230 aa  RNC_STRP1 RecName: Full=Ribonuclease 3;       
   17::144     1e-20  40%  236 aa  RNC_LEUMM RecName: Full=Ribonuclease 3;       
   23::241     1e-20  30%  260 aa  RNC_MYXXD RecName: Full=Ribonuclease 3;       
   11::200     1e-20  37%  237 aa  RNC_MYCPA RecName: Full=Ribonuclease 3;       
   20::220     2e-20  34%  237 aa  RNC_LEIXX RecName: Full=Ribonuclease 3;       
   16::229     2e-20  33%  230 aa  RNC_STRPM RecName: Full=Ribonuclease 3;       
   14::182     2e-20  34%  237 aa  RNC_CHLAB RecName: Full=Ribonuclease 3;       
   20::185     3e-20  35%  223 aa  RNC_TROWT RecName: Full=Ribonuclease 3;       
   20::185     3e-20  35%  223 aa  RNC_TROW8 RecName: Full=Ribonuclease 3;       
    8::204     5e-20  35%  238 aa  RNC_ONYPE RecName: Full=Ribonuclease 3;       
   20::201     5e-20  36%  238 aa  RNC_MYCLE RecName: Full=Ribonuclease 3;       
   51::261     6e-20  35%  272 aa  RNC_CHLTE RecName: Full=Ribonuclease 3;       
  826::1066    6e-20  32% 1086 aa  RNC_CAEEL RecName: Full=Ribonuclease 3;         EC=3.1.26.3;AltName:
   57::261     6e-20  33%  275 aa  A464_PBCV1 RecName: Full=Putative protein A464R;
   14::203     1e-19  34%  231 aa  RNC_CHLTB RecName: Full=Ribonuclease 3;       
   16::202     1e-19  36%  237 aa  RNC_AYWBP RecName: Full=Ribonuclease 3;       
   14::203     2e-19  34%  231 aa  RNC_CHLT2 RecName: Full=Ribonuclease 3;       
   15::214     2e-19  34%  231 aa  RNC_CAUCR RecName: Full=Ribonuclease 3;       
   15::214     2e-19  34%  231 aa  RNC_CAUCN RecName: Full=Ribonuclease 3;       
 1102::1341    3e-19  32% 1373 aa  RNC_MOUSE RecName: Full=Ribonuclease 3;         EC=3.1.26.3;AltName:
 1103::1342    3e-19  32% 1374 aa  RNC_HUMAN RecName: Full=Ribonuclease 3;         EC=3.1.26.3;AltName:
   14::179     4e-19  36%  232 aa  RNC_CHLMU RecName: Full=Ribonuclease 3;       
   50::231     5e-19  35%  266 aa  RNC_NITWN RecName: Full=Ribonuclease 3;       
   14::203     9e-19  34%  231 aa  RNC_CHLTR RecName: Full=Ribonuclease 3;       
   14::203     9e-19  34%  231 aa  RNC_CHLTA RecName: Full=Ribonuclease 3;       
   22::206     1e-18  31%  242 aa  RNC_STACT RecName: Full=Ribonuclease 3;       
    9::188     2e-18  35%  231 aa  RNC_MYCS5 RecName: Full=Ribonuclease 3;       
  810::1003    2e-18  34% 1061 aa  RNC_CAEBR RecName: Full=Ribonuclease 3;         EC=3.1.26.3;AltName:
   23::229     4e-18  28%  246 aa  RNC_GEOMG RecName: Full=Ribonuclease 3;       
   14::195     5e-18  32%  235 aa  RNC_AZOC5 RecName: Full=Ribonuclease 3;       
   12::200     8e-18  34%  242 aa  RNC_SYNFM RecName: Full=Ribonuclease 3;       
   14::142     1e-17  38%  237 aa  RNC_CHLFF RecName: Full=Ribonuclease 3;       
   16::229     1e-17  32%  231 aa  RNC_STRMU RecName: Full=Ribonuclease 3;       
   29::195     1e-17  34%  233 aa  RNC_MOOTA RecName: Full=Ribonuclease 3;       
 1220::1453    1e-17  35% 1657 aa  DCL4_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 4;       
   14::142     2e-17  38%  237 aa  RNC_CHLCV RecName: Full=Ribonuclease 3;       
  172::356     3e-17  30%  363 aa  PAC1_SCHPO RecName: Full=Double-strand-specific pac1 ribonuclease; 
 1544::1728    7e-17  36% 1883 aa  DCL1_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 1;AltName:
   18::173     9e-17  37%  236 aa  RNC_UREPA RecName: Full=Ribonuclease 3;       
   12::203     9e-17  32%  240 aa  RNC_THEP1 RecName: Full=Ribonuclease 3;       
 1566::1744    1e-16  36% 1909 aa  DICER_ARATH RecName: Full=Endoribonuclease Dicer homolog;       
   27::189     3e-16  33%  244 aa  Y346_SYNY3 RecName: Full=Uncharacterized protein slr0346;
    2::227     3e-16  29%  230 aa  RNC_DESVM RecName: Full=Ribonuclease 3;       
   29::219     1e-15  33%  240 aa  RNC_NOCFA RecName: Full=Ribonuclease 3;       
 1248::1413    1e-15  43% 1651 aa  DCL3A_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 3a;AltName:
 1138::1327    1e-15  35% 1377 aa  DCL2B_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 2b;AltName:
   21::194     2e-15  28%  246 aa  RNC_MYCMO RecName: Full=Ribonuclease 3;       
   14::142     3e-15  36%  237 aa  RNC_CHLPN RecName: Full=Ribonuclease 3;       
 1167::1359    3e-15  35% 1410 aa  DCL2A_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 2a;AltName:
 1248::1406    5e-15  40% 1637 aa  DCL3B_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 3b;AltName:
   38::202     4e-14  38%  299 aa  RTL3_ORYSJ RecName: Full=Ribonuclease 3-like protein 3;       
   45::152     4e-14  31%  262 aa  RNC_MYCGE RecName: Full=Ribonuclease 3;       
   15::214     7e-14  31%  232 aa  RNC_CAUSK RecName: Full=Ribonuclease 3;       
 2002::2248    9e-14  34% 2249 aa  DCR1_DROME RecName: Full=Endoribonuclease Dcr-1;       
   17::139     2e-13  32%  282 aa  RNC_MYCPN RecName: Full=Ribonuclease 3;       
   16::214     3e-13  28%  240 aa  RNC_THENN RecName: Full=Ribonuclease 3;       
  932::1116    6e-13  34% 1388 aa  DCL2_NEOFI RecName: Full=Dicer-like protein 2;Includes:  RecName:
 1663::1878    8e-13  33% 1923 aa  DICER_BOVIN RecName: Full=Endoribonuclease Dicer;       
 1081::1235    8e-13  36% 1374 aa  DCR1_SCHPO RecName: Full=Protein Dicer;AltName: Full=Cell cycle
 1577::1739    8e-13  39% 1845 aa  DCR1_CAEEL RecName: Full=Endoribonuclease dcr-1;         EC=3.1.26.-;
 1656::1852    1e-12  33% 1916 aa  DICER_MOUSE RecName: Full=Endoribonuclease Dicer;       
 1657::1853    1e-12  33% 1917 aa  DICER_CRIGR RecName: Full=Endoribonuclease Dicer;       
 1001::1175    1e-12  35% 1485 aa  DCL2_MAGGR RecName: Full=Dicer-like protein 2;Includes:  RecName:
  940::1082    1e-12  37% 1388 aa  DCL2_ASPFU RecName: Full=Dicer-like protein 2;Includes:  RecName:
   46::209     1e-12  38%  317 aa  RTL2_ORYSJ RecName: Full=Ribonuclease 3-like protein 2;       
 1633::1829    1e-12  35% 1893 aa  DICER_XENTR RecName: Full=Endoribonuclease Dicer;       
 1662::1858    1e-12  34% 1922 aa  DICER_HUMAN RecName: Full=Endoribonuclease Dicer;       
 1605::1801    2e-12  34% 1865 aa  DICER_DANRE RecName: Full=Endoribonuclease Dicer;       
 1661::1857    2e-12  32% 1921 aa  DICER_CHICK RecName: Full=Endoribonuclease Dicer;       
 1061::1143    3e-12  41% 1429 aa  DCL2_EMENI RecName: Full=Dicer-like protein 2;Includes:  RecName:
  206::361     1e-11  31%  471 aa  RNT1_YEAST RecName: Full=Ribonuclease 3;       
  953::1082    1e-11  38% 1389 aa  DCL2_ASPCL RecName: Full=Dicer-like protein 2;Includes:  RecName:
  939::1054    2e-11  42% 1377 aa  DCL2_ASPTN RecName: Full=Dicer-like protein 2;Includes:  RecName:
  945::1050    3e-11  40% 1377 aa  DCL2_ASPOR RecName: Full=Dicer-like protein 2;Includes:  RecName:
 1260::1505    3e-11  33% 1537 aa  DCL1_ASPFU RecName: Full=Dicer-like protein 1;Includes:  RecName:
 1261::1506    4e-11  33% 1538 aa  DCL1_NEOFI RecName: Full=Dicer-like protein 1;Includes:  RecName:
 1100::1187    1e-10  39% 1399 aa  DCL2_PHANO RecName: Full=Dicer-like protein 2;Includes:  RecName:
  114::278     2e-10  37%  333 aa  RNC_IIV3 RecName: Full=Putative ribonuclease 3;       
  985::1109    4e-10  37% 1451 aa  DCL2_CRYPA RecName: Full=Dicer-like protein 2;Includes:  RecName:
 1250::1496    5e-10  29% 1525 aa  DCL1_ASPNC RecName: Full=Dicer-like protein 1;Includes:  RecName:
 1226::1312    6e-10  37% 1589 aa  DCL4_ARATH RecName: Full=Dicer-like protein 4;         EC=3.1.26.-;
  928::1076    2e-09  32% 1387 aa  DCL21_ASPNC RecName: Full=Dicer-like protein 2-1;Includes:  RecName:
 1257::1404    2e-09  38% 1534 aa  DCL1_ASPCL RecName: Full=Dicer-like protein 1;Includes:  RecName:
 1248::1433    4e-09  35% 1523 aa  DCL1_ASPOR RecName: Full=Dicer-like protein 1;Includes:  RecName:
 1244::1429    1e-08  31% 1591 aa  DCL1_MAGGR RecName: Full=Dicer-like protein 1;Includes:  RecName:
  968::1166    3e-08  35% 1540 aa  DCL2_NEUCR RecName: Full=Dicer-like protein 2;Includes:  RecName:
 1194::1340    3e-08  37% 1464 aa  DCL1_COCIM RecName: Full=Dicer-like protein 1;Includes:  RecName:
   63::275     3e-08  28%  292 aa  RNC_IIV6 RecName: Full=Putative ribonuclease 3;       
 1185::1272    3e-08  33% 1478 aa  DCL2_COCIM RecName: Full=Dicer-like protein 2;Includes:  RecName:
  332::414     2e-07  31%  754 aa  DCL_GIALA RecName: Full=Endoribonuclease Dicer-like;       
 1081::1158    2e-07  34% 1362 aa  DCL22_ASPNC RecName: Full=Dicer-like protein 2-2;Includes:  RecName:
 1242::1388    3e-07  36% 1519 aa  DCL1_ASPTN RecName: Full=Dicer-like protein 1;Includes:  RecName:
 1250::1434    1e-06  30% 1548 aa  DCL1_CRYPA RecName: Full=Dicer-like protein 1;Includes:  RecName:
 1097::1204    2e-06  41% 1584 aa  DCL1_NEUCR RecName: Full=Dicer-like protein 1;Includes:  RecName:
 1100::1239    3e-06  34% 1607 aa  DCL1_CHAGB RecName: Full=Dicer-like protein 1;Includes:  RecName:
  155::218     9e-06  37%  351 aa  TRBP2_XENLA RecName: Full=RISC-loading complex subunit tarbp2;
  155::213     2e-05  38%  351 aa  TRBP2_XENTR RecName: Full=RISC-loading complex subunit tarbp2;
  145::206     3e-05  34%  345 aa  TRBP2_TETNG RecName: Full=RISC-loading complex subunit tarbp2;
  164::222     3e-05  36%  366 aa  TRBP2_HUMAN RecName: Full=RISC-loading complex subunit
  144::205     3e-05  34%  346 aa  TRBP2_DANRE RecName: Full=RISC-loading complex subunit tarbp2;
  164::222     3e-05  36%  366 aa  TRBP2_BOVIN RecName: Full=RISC-loading complex subunit TARBP2;
  163::221     6e-05  36%  365 aa  TRBP2_RAT RecName: Full=RISC-loading complex subunit TARBP2;
  163::221     6e-05  36%  365 aa  TRBP2_MOUSE RecName: Full=RISC-loading complex subunit
  104::165     1e-04  35%  282 aa  PRKRA_DANRE RecName: Full=Interferon-inducible double stranded
  131::193     1e-04  29%  313 aa  PRKRA_RAT RecName: Full=Interferon-inducible double stranded
  131::193     1e-04  29%  313 aa  PRKRA_MOUSE RecName: Full=Interferon-inducible double stranded
  131::193     1e-04  29%  313 aa  PRKRA_HUMAN RecName: Full=Interferon-inducible double stranded
  131::193     1e-04  29%  313 aa  PRKRA_BOVIN RecName: Full=Interferon-inducible double stranded
  117::175     1e-04  32%  298 aa  PRKAB_XENLA RecName: Full=Interferon-inducible double stranded
  128::186     1e-04  32%  309 aa  PRKAA_XENLA RecName: Full=Interferon-inducible double stranded
  150::202     2e-04  41%  256 aa  RTL1_ORYSJ RecName: Full=Ribonuclease 3-like protein 1;       
  310::405     5e-04  32%  549 aa  SYR_ARCFU RecName: Full=Arginyl-tRNA synthetase;       
 2942::3076    9e-04  25% 3462 aa  RELN_RAT RecName: Full=Reelin;         EC=3.4.21.-;Flags: Precursor;
    1::230

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVPEYSRFYNILGYNFKDYTLLIRALTHRSKTKKNYERLEFLGDSVLSFVIAEVLYKQFTDLAEGKLSQL
RNC_FRATM       MVPEYSRFYNILGYNFKDYTLLIRALTHRSKTKKNYERLEFLGDSVLSFVIAEVLYKQFTDLAEGKLSQL
RNC_FRATH       MVPEYSRFYNILGYNFKDYTLLIRALTHRSKTKKNYERLEFLGDSVLSFVIAEVLYKQFTDLAEGKLSQL
RNC_FRATO       MVPEYSRFYNILGYNFKDYTLLIRALTHRSKTKKNYERLEFLGDSVLSFVIAEVLYKQFTDLAEGKLSQL
RNC_FRATF       MVPEYSRFYNILGYNFKDYTLLIRALTHRSKTKKNYERLEFLGDSVLSFVIAEVLYKQFTDLAEGKLSQL
RNC_FRATN       MVPEYSRFYNILGYNFKDYTLLIRALTHRSKTKKNYERLEFLGDSVLSFVIAEVLYKQFTDLAEGKLSQL
RNC_FRATW       MVPEYSRFYNILGYNFKDCTLLIRALTHRSKTKKNYERLEFLGDSVLSFVIAEVLYKQFTDLAEGKLSQL
RNC_FRATT       MVPEYSRFYNILGYNFKDYTLLIRALTHRSKTKKNYERLEFLGDSVLSFVIAEVLYKQFIDLAEGKLSQL
RNC_FRAT1       MVPEYSRFYNILGYNFKDYTLLIRALTHRSKTKKNYERLEFLGDSVLSFVIAEVLYKQFIDLAEGKLSQL
RNC_FRAP2       MVPEYSRLYKILGYSFKNYTLLVRALTHRSKTKKNYERLEFLGDSILGFVIAEVLYMEFPDLAEGKLSQI
RNC_WIGBR       ----FNKLQKKMGYLFHNNIILKQALTHRSFSSKNNERLEFLGDSILNYIISDALYNNFTNIPEGKLSQM
RNC_SHEAM       ------RLCRTLGYEFSDIRLLEQALTHRSASNQHNERLEFLGDSILSIVISDALFHQFPKATEGDLSRM
RNC_SHESR       ------RLCRTLGYEFKNLELLTQALTHRSAANKHNERLEFLGDSILSIVISDALYHQFPKATEGDLSRM
RNC_SHESM       ------RLCRTLGYEFKNIELLTQALTHRSAANKHNERLEFLGDSILSIVISDALYHQFPKATEGDLSRM
RNC_SHESA       ------RLCRTLGYEFKNIDLLTQALTHRSAANKHNERLEFLGDSILSIVISDALYHQFPKATEGDLSRM
RNC_SHEON       ------RLCRTLGYEFKNLDLLTQALTHRSAANKHNERLEFLGDSILSIVISDALYHQFPKATEGDLSRM
RNC_SHEB8       ------RLCRTLGYEFKNIELLTQALTHRSAANKHNERLEFLGDSILSIVISDALYHQFPKATEGDLSRM
RNC_PASMU       MTQNLERLQRQIGYQFNQPALLKQALTHRSAAVKHNERLEFLGDAILNFIIAEALYHQFPKCNEGELSRM
RNC_HAMD5       -----------LRYSFKERSLLLQALTHRSLHTQHNERLEFLGDSILSFVIANQLYHRFPEINEGNMSRM
RNC_SHESW       ------RLCRTLGYEFTQIELLTQALTHRSAANKHNERLEFLGDSILSIVISDALYHQFPKATEGDLSRM
RNC_SHEPC       ------RLCRTLGYEFTQIELLTQALTHRSAANKHNERLEFLGDSILSIVISDALYHQFPKATEGDLSRM
RNC_SHEB9       ------RLCRTLSYEFKNIELLTQALTHRSAANKHNERLEFLGDSILSIVISDALYHQFPKATEGDLSRM
RNC_SHEB5       ------RLCRTLSYEFKNIELLTQALTHRSAANKHNERLEFLGDSILSIVISDALYHQFPKATEGDLSRM
RNC_SHEB2       ------RLCRTLSYEFKNIELLTQALTHRSAANKHNERLEFLGDSILSIVISDALYHQFPKATEGDLSRM
RNC_BUCBP       ------KLQKILGYTFIKKDLLIQALTHRSANSKHNERLEFLGDSILSFVIANALYHCFPHVNEGDMSRM
RNC_VIBF1       -----------IGYQFKDESFLKLALTHRSANGTHNERLEFLGDSILSFVVADDLYHRFPKVDEGDMSRM
RNC_SHEPW       ------RLCRTLGYEFAEQALLDQALTHRSASNKHNERLEFLGDSILSIVISDALYHQFPKATEGDLSRM
RNC_SHEPA       ------RLCRTLGYEFNEKAFLDQALTHRSASNKHNERLEFLGDSILSIVISDALYHQFPAATEGDLSRM
RNC_VIBC3       MTPPMNKLTSKLGYTFKETELLNLALTHRSANGKHNERLEFLGDSILSFVIADELYRRFPKVNEGDMSRM
RNC_SALCH       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSFVIANALYHRFPRVDEGDMSRM
RNC_PHOLL       -----NRLQRKLGYTFDQYDLLIQALTHRSASSKHNERLEFLGDSILSFVIANALYHRFPRVDEGDMSRM
RNC_SHEHH       ------RLCRTLGYEFTEQAFLDQALTHRSASNKHNERLEFLGDSILSIVISDALYHQFPTATEGDLSRM
RNC_PROMH       -----------LGYTFKQNELLLQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_IDILO       --PPLTELEKIVGYSFEQQGLLHQAMTHRSASSTHNERLEFLGDSILGLVIAEALYQKFPKVAEGDLSRM
RNC_BUCAT       ------KIQKVLGYTFTHKDLLKQALTHRSASSKHNERLEFLGDSILSFVIANALYQHFPYIDEGDMSRM
RNC_BUCAI       ------KIQKVLGYTFTHKDLLKQALTHRSASSKHNERLEFLGDSILSFVIANALYQHFPYIDEGDMSRM
RNC_BUCA5       ------KIQKVLGYTFTHKDLLKQALTHRSASSKHNERLEFLGDSILSFVIANALYQHFPYIDEGDMSRM
RNC_VIBCM       MTPPMNKLTSKLGYTFKETELLNLALTHRSANGKHNERLEFLGDSILSFVIADELYRRFPKVNEGDMSRM
RNC_VIBCH       MTPPMNKLTSKLGYTFKETELLNLALTHRSANGKHNERLEFLGDSILSFVIADELYRRFPKVNEGDMSRM
RNC_PHOPR       MTSPANRLQRRLGYQFNSSELMTLSLTHRSANGKHNERLEFLGDSILSFVIADDLYHRFPHVDEGDMSRM
RNC_SHELP       ------RLGRILGYQFQQIALLEQALTHRSAASKHNERLEFLGDSILSIVISDALYHQFPKATEGDLSRM
RNC_HAHCH       MTAKLERLQRALGYTFKEPALLTLALTHRSFGGRNNERLEFLGDSVLNFIIADYLFGRFEEAREGQLSRL
RNC_PECCP       -----NRLQRKLGYTFQQYELLLQALTHRSASSKHNERLEFLGDSILSFVIANALYHRFPKVDEGDMSRM
RNC_BUCCC       ------KLQKFIGYTFTNITLLKHALTHRSASSQHNERLEFLGDSILSFIIAKALYHHFPKMNEGGMSRM
RNC_MANSM       ------RLQRQISYEFKDITLLKQALTHRSAATKHNERLEFLGDAILNYTIADALYHQFPKCNEGELSRM
RNC_VIBSL       -----------IGYQFNDADLIHLALTHRSAAGKHNERLEFLGDSILSFVIADDLYHRFPKVNEGDMSRM
RNC_SHEDO       -VKNLARLSRTLGYEFTNQELLVQALTHRSAANKHNERLEFLGDSILSIVISDALYHQFPKATEGDLSRM
RNC_PSYIN       ---ELKRLERRVDYTFSDFSLLQQALTHRSALGNHNERLEFLGDSILSYAISTDLYARFPKVDEGDLSRM
RNC_ENT38       -----NRLQRKLGYTFQHHELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_COLP3       -----ARLTKKLGYEFNEPLLLVQALTHRSAKGAHNERLEFLGDSILGFVIAEALYDKFPKHDEGDLTRM
RNC_VIBPA       -----------LGYQFKDAGLINLALTHRSANSKHNERLEFLGDSILSFVIADDLYHRFPKVNEGDMSRM
RNC_SODGM       -----NRLQKKLGYTFQQHDLLLQALTHRSASSKHNERLEFLGDSILSYVIANALYQRFPRVDEGDMSRM
RNC_SHEFN       ------RLCRTLGYEFNNIELLIQALTHRSAANKHNERLEFLGDSILSIAISDALYHQFPKATEGDLSRM
RNC_ERWCT       -----NRLQRKLGYTFQQYELLLQALTHRSASSKHNERLEFLGDSILSFVIANALYDRFPKVDEGDMSRM
RNC_VIBVY       -----------LGYQFQDDELLNLALTHRSANSKHNERLEFLGDSILSFVIADELYHRFPKVNEGDMSRM
RNC_VIBVU       -----------LGYQFQDDELLNLALTHRSANSKHNERLEFLGDSILSFVIADELYHRFPKVNEGDMSRM
RNC_VIBHB       -----------LGYQFKDAGLINLALTHRSANSKHNERLEFLGDSILSFVIADDLYHRFPKVNEGDMSRM
RNC_EDWI9       -----NRLQRKLGYTFRQHDLLMQALTHRSASSKHNERLEFLGDSILSFVIANALYHRFPRVDEGDMSRM
RNC_YERPS       -----NRLQRKLGYTFQQQELLLQALTHRSASSKHNERLEFLGDSILSFVIANELYRRFPRVDEGDMSRM
RNC_YERPP       -----NRLQRKLGYTFQQQELLLQALTHRSASSKHNERLEFLGDSILSFVIANELYRRFPRVDEGDMSRM
RNC_YERPN       -----NRLQRKLGYTFQQQELLLQALTHRSASSKHNERLEFLGDSILSFVIANELYRRFPRVDEGDMSRM
RNC_YERPG       -----NRLQRKLGYTFQQQELLLQALTHRSASSKHNERLEFLGDSILSFVIANELYRRFPRVDEGDMSRM
RNC_YERPE       -----NRLQRKLGYTFQQQELLLQALTHRSASSKHNERLEFLGDSILSFVIANELYRRFPRVDEGDMSRM
RNC_YERPA       -----NRLQRKLGYTFQQQELLLQALTHRSASSKHNERLEFLGDSILSFVIANELYRRFPRVDEGDMSRM
RNC_YERP3       -----NRLQRKLGYTFQQQELLLQALTHRSASSKHNERLEFLGDSILSFVIANELYRRFPRVDEGDMSRM
RNC_YERE8       -----NRLQRKLGYTFQQQELLLQALTHRSASSKHNERLEFLGDSILSFVIANELYRRFPRVDEGDMSRM
RNC_HAEIN       -----------IGYRFNDIALLKQALTHRSAATQHNERLEFLGDSILNFTIAEALYHQFPRCNEGELSRM
RNC_SHISS       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_SHIFL       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_SHIF8       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_SHIDS       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_SHIBS       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_SHIB3       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_ESCF3       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_ECOUT       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_ECOSM       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_ECOSE       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_ECOLU       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_ECOLI       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_ECOLC       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_ECOL6       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_ECOL5       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_ECOK1       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_ECOHS       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_ECODH       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_ECOBW       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_ECO8A       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_ECO81       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_ECO7I       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_ECO5E       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_ECO57       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_ECO55       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_ECO45       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_ECO27       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_ECO24       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMSRM
RNC_BUCAP       -----NKIQQILGYTFTHQELLKQALTHRSASSKHNERLEFLGDSILSFVIANALYQHFPYIDEGDMSRM
RNC_SERP5       -----NRLQRKLGYTFQQQELLLQALTHRSASSKHNERLEFLGDSILSFVIANALFQRFPRVDEGDMSRM
RNC_HAEIG       -----------IGYRFNDIALLKQALTHRSAATQHNERLEFLGDSILNFTIAEALYHQFPRCNEGELSRM
RNC_PSEPG       MTASLARLERKLGYTFKNQDQMLLALTHRSYAGRNNERLEFLGDAILNFVAGEALFERFPQAREGQLSRL
RNC_BLOPB       -----------LGYIFNRYDLLLQALTHRSSSNQHNERLEFLGDAILNYVIANLLYHRFPHISEGGMSRM
RNC_HAEIE       -----------IGYCFNDIALLKQALTHRSAATQHNERLEFLGDSILNFTIAEALYHQFPRCNEGELSRM
RNC_HAEI8       -----------IGYCFNDIALLKQALTHRSAATQHNERLEFLGDSILNFTIAEALYHQFPRCNEGELSRM
RNC_BLOFL       -----------LGYFFHTVDLLLRALTHRSFSNKHNERLEFLGDSILNYSITNILYHRYNHMDEGDMSRI
RNC_ACIAD       ------RLQSRIGYEFKQLELLQLALTHRSVSHKNYERLEFLGDSLLGMIIANYLYQAYPHENEGRLTRM
RNC_METCA       MIRSHEHLARKLGIPFRDPGLLRNALTHRSAEGVNNERLEFLGDSVLGFVVTEYLYQRFPSADEGVLSRL
RNC_PSEPW       MSASLARLERKLGYTFKDQDQMVLALTHRSYAGRNNERLEFLGDAILNFVAGEALFERFPQAREGQLSRL
RNC_PSEF5       -----SRLERQLGYSFKDQELMLLALTHRSFAGRNNERLEFLGDAILNFVAGEALFERFPQAREGQLSRL
RNC_KLEP7       -----NRLQRKLGYTFHHQELLQQALTHRSASSKHNERLEFLGDSILSFVIANALYHRFPRVDEGDMSRM
RNC_KLEP3       -----NRLQRKLGYTFHHQELLQQALTHRSASSKHNERLEFLGDSILSFVIANALYHRFPRVDEGDMSRM
RNC_HAEPS       ---QLERLQKKLGYQFANLDYLTQALTHRSAASKNNERLEFLGDSILNFAIGKALYEKFPKANEGELSRM
RNC_PSESM       -----SRLERQLGYTFKDQELMILALTHRSFAGRNNERLEFLGDAILNFVAGEALFERFPQAREGQLSRL
RNC_PSEPK       -----------LGYTFKNQDQMLLALTHRSYAGRNNERLEFLGDAILNFVAGEALFERFPQAREGQLSRL
RNC_PSEP1       -----------LGYTFKNQDQMLLALTHRSYAGRNNERLEFLGDAILNFVAGEALFERFPQAREGQLSRL
RNC_PSEMY       MSPNLSRLERKLGHSFKDQDLMILALTHRSFAGRNNERLEFLGDAILNFVAGEALFERFPQAREGQLSRL
RNC_HAES2       -----------LGHQFTNLDYLKQALTHRSAAAFNNERLEFLGDSILNFAIGKALYEKFPKSNEGELSRM
RNC_XYLFT       -----SDYQQRIGYVFTDPSLLLQALRHRSAGTPHNERLEFLGDSVVNLLIAEALFQRWPRADEGALTRA
RNC_XYLF2       -----SDYQQRIGYVFTDPSLLLQALRHRSAGTPHNERLEFLGDSVVNLLIAEALFQRWPRADEGALTRA
RNC_PSEU2       -----SRLERQLGYTFKDQELMVLALTHRSFAGRNNERLEFLGDAILNFVAGEALFERFPQAREGQLSRL
RNC_SALTI       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSFVIANALYHRFPRVDEGDMSRM
RNC_PSE14       -----SRLERQLGYTFKDQELMVLALTHRSFAGRNNERLEFLGDAILNFVAGEALFERFPQAREGQLSRL
RNC_SALTY       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSFVIANALYHRFPRVDEGDMSRM
RNC_SALPK       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSFVIANALYHRFPRVDEGDMSRM
RNC_SALPA       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSFVIANALYHRFPRVDEGDMSRM
RNC_SALG2       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSFVIANALYHRFPRVDEGDMSRM
RNC_SALEP       -----NRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSFVIANALYHRFPRVDEGDMSRM
RNC_NITOC       MTDGLERLCRKLGYRFAEPALLRHAITHRSATKENNERLEFLGDSILNFLIADFLYSGFPRAQEGELSRL
RNC_COXBN       -----------LGHQFNNLELLKIALTHRSSGADNNERLEFLGDSVLGFIIASELYQRRPQAREGDLSRM
RNC_HAEDU       ------RLQKKIGYQFANLDYLLQALTHRSAAAKNNERLEFLGDSILNYAIGQALFERFPQANEGELSRM
RNC_AZOVD       MSASLNRLERKLGHTFKNQDLMLLALTHRSFASRNNERLEFLGDAILNFVAGEALFERFPQAKEGQLSRL
RNC_ACTSZ       ------RLQHKIGYEFSNLTLLKQALTHRSAAKVHNERLEFLGDAILNLTIGEALYLQFPHCNEGELSRM
RNC_PSEFS       MTVSLARLERQLGYTFKDQELMVLALTHRSFAGRNNERLEFLGDAILNFVAGEALFERFPQAREGQLSRL
RNC_ERWT9       -----------LGYTFTHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYQRFPRVDEGDMSRM
RNC_COXB2       -----------LGHQFNNLELLKIALTHRSSGADNNERLEFLGDSVLGFIIASELYQRRPQAREGDLSRM
RNC_COXB1       -----------LGHQFNNLELLKIALTHRSSGADNNERLEFLGDSVLGFIIASELYQRRPQAREGDLSRM
RNC_XYLFA       -----SDYQQRIGYVFTDPSLLLQALRHCSAGTPHNERLEFLGDSVVNLLIAEALFQRWPRADEGALTRA
RNC_PSEE4       MSASLDRLERKLGYTFKNQDQMLLALTHRSYAGRNNERLEFLGDAILNFVVGEALFERFPQAREGQLSRL
RNC_ALHEH       -----------LGYRFRRPELLDEALTHRSVTGPDNERLEFLGDGILNFVIADELYHRRPDATEGVLSRL
RNC_ACIBY       ------RLLSRIGYQFKQPELLQLALTHRSVSHKNYERLEFLGDSLLGMIIANYLYHAYPHENEGRLTRM
RNC_ACIBT       ------RLLSRIGYQFKQPELLQLALTHRSVSHKNYERLEFLGDSLLGMIIANYLYHAYPHENEGRLTRM
RNC_ACTPJ       ---QLERLQKKLGYQFTNLDYLLQALTHRSAGAKNNERLEFLGDSILNFAIGKALFEKFPKANEGELSRM
RNC_XYLFM       -----SDYQQRIGYVFTDPSLLLQALRHCSAGTPHNERLEFLGDSVVNLLIAEALFQRWPRADEGALTRA
RNC_BORPD       -----------LDHRFGNAALLEQALTHRSHSARHNERLEFLGDSVLNFVVAAMLFERFPKLDEGDLSRL
RNC_PSEA7       -----------LGYTFKDQDLMVLALTHRSYAGRNNERLEFLGDAILNFVIGEALFHHFPQAREGQLSRL
RNC_COXBU       -----------LGHQFNNLELLKIALTHCSSGADNNERLEFLGDSVLGFIIASELYQRRPQAREGDLSRM
RNC_COXBR       -----------LGHQFNNLELLKIALTHCSSGADNNERLEFLGDSVLGFIIASELYQRRPQAREGDLSRM
RNC_PSEAE       -----------LGYTFKDRDLMVLALTHRSYAGRNNERLEFLGDAILNFVIGEALFHHFPQAREGQLSRL
RNC_PSEAB       -----------LGYTFKDRDLMVLALTHRSYAGRNNERLEFLGDAILNFVIGEALFHHFPQAREGQLSRL
RNC_PSEA8       -----------LGYTFKDRDLMVLALTHRSYAGRNNERLEFLGDAILNFVIGEALFHHFPQAREGQLSRL
RNC_BORPE       -----------LDHRFGDKALLEQALTHRSHGARHNERLEFLGDSVLNFVVAAMLFERYGKLDEGDLSRL
RNC_BORPA       -----------LDHRFGDKALLEQALTHRSHGARHNERLEFLGDSVLNFVVAAMLFERYGKLDEGDLSRL
RNC_BORBR       -----------LDHRFGDKALLEQALTHRSHGARHNERLEFLGDSVLNFVVAAMLFERYGKLDEGDLSRL
RNC_BORA1       -----------LGHHFGDQALLEQALTHRSHGARHNERLEFLGDSVLNFVVAAMLFERYAKLDEGDLSRV
RNC_ACTP2       ---QLERLQKKLSYQFTNLDYLLQALTHRSAGAKNNERLEFLGDSILNFAIGKALFEKFPKANEGELSRM
RNC_MARMS       ----YQKLSRRIGYFFADLGLLELALTHRSFGGKNNERLEFLGDSILNYVIAEDLFHRFPKAKEGELSRL
RNC_PSEPF       -----SRLERQLGYTFKDQELMVLALTHRSFAGRNNERLEFLGDAILNFVAGEALFDRFPLAREGQLSRL
RNC_XANCP       -----------IGHAFADPGLLAQALRHRSAGTPHNERLEFLGDGIVNLLIAEALYQRWPKADEGALTRA
RNC_XANC8       -----------IGHAFADPGLLAQALRHRSAGTPHNERLEFLGDGIVNLLIAEALYQRWPKADEGALTRA
RNC_RALSO       -----------LGYRFSKPELLQQALTHRSHNAMHNERLEFLGDSILNCAVADMLYGMFGKLDEGDLSRV
RNC_RALPJ       -----------LGYRFSKPELLQQALTHRSHSAMHNERLEFLGDSILNCAVADMLYGMFGKLDEGDLSRV
RNC_PSEHT       MKKNVTELYKTIDYIFADQGLLEQAMTHRSHKGQHNERLEFLGDSILSFVIANALYAKFPKAREGDLSRM
RNC_PSYA2       -----------LGYVFNDLSLAKLALTHRSDSKKNYERLEFLGDALLGMIVGEALYHRYPTQNEGRLTRM
RNC_XANOR       -----------IGHAFADPDLLAQALRHRSAGTPHNERLEFLGDGIVNLLVAEALYQRWPKADEGALTRA
RNC_NITEU       ---DYAVFLQKLGYTFKQPDLLREALTHRSLGFPNNERFEFLGDSVLNCAVSTLLFKRFPSLPEGDLTRL
RNC_XANAC       -----------IGHAFADPALLAQALRHRSAGTPHNERLEFLGDGIVNLLIAEALYHRWPKADEGALTRA
RNC_ACIBS       ------RLLSRIGYQFKQPELLQLALTHRSVSHKNYERLEFLGDSLLGMIIANYLYHAYPHENEGRLTRM
RNC_ALCBS       ---DLNRLMARLGYQFQDLSLLELALTHRSVSRRNYERLEFLGDAQLGQIISVALFEQFPEAAEGQLTRM
RNC_SHEWM       ------RLCRTLGYDFSELALLDHALTHRSAASKHNERLEFLGDXXXXXXXXDALYHQFPKATEGDLSRM
RNC_ARCB4       ---DYSKLEKCLDYQFKNKNLIIEALTHKSKKPYNNERLEFLGDAVLNLIVGEYLYLKFPKSNEGELSKI
RNC_THIDA       -----ARLQQALGYTFSRSGLLQQALTHRSYGALNNERLEFLGDSVLNCSVARALYDAFPDLPEGSLSRL
RNC_DECAR       -----------LNHCFSDQALFRTALTHRSFGTPNNERLEFLGDGVLDFVIAASLYHRFPDLPEGDLSRL
RNC_RALEJ       -----------LGYRFSKPELLQQALTHRSHSAQHNERLEFLGDSVLNCAVADMLFGMFGKLDEGDLSRV
RNC_WOLWR       ----------IIDYKFTNYAILEEALTHPSVNKRNYERLEFLGDSVLNMVVSATLFKLFPEEKEGALAKR
RNC_WOLPM       ----------IIDYKFTNYAILEEALTHPSVNKRNYERLEFLGDSVLNMVVSATLFKLFPEEKEGALAKR
RNC_RALEH       -----------LGYRFSKPELLQQALTHRSHSAQHNERLEFLGDSVLNCAVADMLYGMFGKLDEGDLSRV
RNC_CUPTR       -----------LGYRFSKPELLQQALTHRSHSAQHNERLEFLGDSVLNCAVADMLYGMFGKLDEGDLSRV
RNC_RALME       -----------LGYRFSKPELLQQALTHRSHSAQHNERLEFLGDSVLNCAVADMLFGMFGKLDEGDLSRV
RNC_CAMFF       -----NRLEEHLGYKFKNKTLLKEALTHKSKSSVNNERLEFLGDAVLDLIVGEYLFFKFKDTDEGNLSKL
RNC_RHOFD       -----------LQHEFSNPGLLTRALTHRSFSLDHNERLEFLGDSVLGLAVADLLYERLSTLPEGDLSRV
RNC_DELAS       -----------LQHQFAEPALLQRAVTHRSFSADNNERLEFLGDSVLNLAISSLLYQRLSSMPEGDLSRV
RNC_LEGPH       -----------LNYHFNNIAYLKQALTHCSAGSDNYERFEFLGDSILSFVIANELFNRFPLHSEGQLSRL
RNC_LEGPC       -----------LNYHFNNIAYLKQALTHCSAGSDNYERFEFLGDSILSFVIANELFNRFPLHSEGQLSRL
RNC_LEGPA       -----------LNYHFNNIAYLKQALTHCSAGSDNYERFEFLGDSILSFVIANELFNRFPLHSEGQLSRL
RNC_VARPS       -----------LKHSFSDTRLLQLALTHRSFSADHNERLEFLGDSVLNLAVSHLLYTRLSALPEGDLSRV
RNC_SHESH       ------RLCRTLGYEFNDQSLLEHALTHRSASSKHNERLEFLGDXXXXXXXXDALFHQFPKATEGDLSRM
RNC_LEGPL       -----------LNYHFNNMAYLKQALTHCSAGSDNYERFEFLGDSILSFVIANELFNRFPLHSEGQLSRL
RNC_NITEC       ---DYTVFSQKLGYTFKQPDLLQEALTHRSLGFPNNERLEFLGDSVLNCAVSTLLFKRFLLLPEGDLTRL
RNC_WOLPP       ----------VINYKFTDYAILEEALTHPSVNKRNYERLEFLGDSVLNMVVSVMLFKMFPEEKEGALAKR
RNC_HYDS0       -----------IGYRFKDKNLVKKAFTHISKSSENYEVLEFLGDALVNFMTVNILVEAFPNKKEGELSQL
RNC_AZOSE       MAGKLDRLQRSLGHRFDNPALLEQALTHRSFGQPNNERLEFLGDSILNCVVAIALFERFASLREGEMSRL
RNC_CAMJD       -----------LTYEFKDKNLLIHALTHKSKKSYNNERLEFLGDAVLDLVVGEYLFHKFTKDAEGDLSKL
RNC_CAMJE       -----------LTYEFKDKNLLIHALTHKSKKSYNNERLEFLGDAVLDLVVGEYLFHKFAKDAEGDLSKL
RNC_CAMJR       -----------LTYEFKDKNLLIHALTHKSKKSYNNERLEFLGDAVLDLVVGEYLFHKFAKDAEGDLSKL
RNC_NEIMA       -----------LGYAFRDISLLRQALTHRSHHAKHNERFEFVGDSILNYTVARMLFDAFPKLTEGELSRL
RNC_NEIG2       -----------LGYAFRDMSLLRRALTHRSHHAKHNERFEFVGDSILNYTVARMLFDAFPKLTEGELSRL
RNC_CAMJ8       -----------LTYEFKDKNLLIHALTHKSKKSYNNERLEFLGDAVLDLVVGEYLFHKFAKDAEGDLSKL
RNC_TREDE       ---ELLEFQKQAGLKFKDLRLLDLAFHHRSFSNENNERLEFLGDSVLGLVAASYLYKSFEDRPEGELAKI
RNC_THETN       -----------INYEFKDKTLLLEALTHSSNEKVSNERLEFLGDSVLSLVISEYLYKNRKDLEEGSLSKY
RNC_NEIMB       -----------LGYAFRDISLLRQALTHRSHHAKHNERFEFVGDSILNYTVARMLFDAFPKLTEGELSRL
RNC_HELPS       ----YATLEKALGYSFKDKRLLEQALTHKSKLALNNERLEFLGDAVLGLVIGELLYHKFYQYDEGKLSKL
RNC_HELP2       ----YLTLEKALGYSFKDKRLLEQALTHKSKLALNNERLEFLGDAVLGLVIGELLYHKFYQYDEGKLSKL
RNC_NEIG1       -----------LGYAFRDMSLLRRALTHRSHHAKHNERFEFVGDSILNYTVARMLFDAFPKLTEGELSRL
RNC_HELPY       ----YTTLEKALGYSFKDKRLLEQALTHKSKLALNNERLEFLGDAVLGLVIGELLYHKFYQYDEGKLSKL
RNC_HELPJ       ----YLTLEKALGYSFKDKRLLEQALTHKSKLALNNERLEFLGDAVLGLVIGELLYHKFYQYDEGKLSKL
RNC_XANC5       ------------------------------------ERLEFLGDGIVNLLIAEALYQRWPKADEGALTRA
RNC_HELPG       ----YTTLEKALGYSFKDKRLLEQALTHKSKLALNNERLEFLGDAVLGLVIGELLYHKFYQYDEGKLSKL
RNC_HELHP       -----------LGYVFQNQQLLLEALTHKSKKQYNNERLEFLGDAVLDLLVGEYLFKKFPLAKEGELSKL
RNC_WOLTR       ----------IINYRFKNDAILEEALTHPSLNKRNYERLEFLGDSILNMIVSAILFRLFPKEKEGALARR
RNC_WOLSU       -------FEKRLGYRFQNKNLLIEALTHKSYKKPNNERLEFLGDAVLDLVIGEFLFLKFPKADEGELSKM
RNC_RICFE       ----FEKLEKLLGYSFKNKELLIEALSHPSKDDKDYERLEFLGDAVLNLVVTEILFKNFANYNEGNLAKI
RNC_DESPS       ---KHAEFEKKINYKFIDLRLLQKALIHSSQAGKNNERLEFVGDAVLDLVVGNALYRRFPEMREGELTRL
RNC_HELAH       ----YITLEKALGYSFKDKHLLEQALTHKSKLALNNERLEFLGDAVLGLVIGELLYHKFYQYDEGKLSKL
RNC_CAMC5       ----------LLGYEFENTKLLNEALTHKS-TKLPYERLEFLGDAVMDLIVGEYLFKKFSKTNEGDMSKL
RNC_STRU0       ---------------FEDKTLLETAFTHTSYANEHRERLEFLGDAVLQLIISEYLFKKYPHKAEGELSKQ
RNC_RICAH       ----------LLGYSFKNQELLIEALSHPSKYDKDYERLEFLGDAVLNLVVTEILFRNFASYNEGNLAKI
RNC_DESDG       ----FEKLQDVLCYRFADVRLLETALTHSSYANEHNERLEYLGDAVLELTVSEQLFTRFPEAREGQLTRM
RNC_CAMC1       -------FERNLGYKFKKSELLEEALTHKSKQALNNERLEFLGDAVMDLLVAEYLFKKFSKIAEGDMSKL
RNC_ANAMF       ------KIYEATGYQFRDLDLLLEALTHPSKSAANYERLEFLGDAVLSMTVSEMLYRLFPDDDEGCLTRK
RNC_NITSB       ---QLEEFEKKLGYSFEDKKLLKEALTHKSKSPVNNERLEFLGDAVLDLVVGEYLFKKFPKANEGELSKL
RNC_BDEBA       -----------VGHQFKNPALLERALTHKSNTVEHNEKLEFLGDAVLDLVVGEFLYEKFPTDTEGGLSKK
RNC_RICPR       ----FEKLETLLGYSFKNKELLIEALSHPSKYDKDYERLEFLGDAVLNLLITEILFKNFENYKEGNLAKI
RNC_ANAMM       ------KIYEATGYQFRDLDLLLEALTHPRKSAANYERLEFLGDAVLSMTVSEMLYRLFPDDDEGCLTRK
RNC_SULNB       ---DYSQLEKRLNYTFKDKQLIIEALTHKSYKKPNNERLEFLGDAVLDLIVGEYLFKKFPKSDEGILSKI
RNC_EHRCR       ----------IIKYNFKNPQLLNEALTHPSLVSKNYERLEFLGDAVLNIVISEMLFNIFPKDTEGNLAKK
RNC_NATTJ       ---------------YVDDKLLLQAVTHTSYAHEHNERLEFLGDAVLELAISETLYKKYPELPEGELTKL
RNC_RICTY       ----FEKLETLLGYSFKNKELLIEALSHPSKYDKDYERLEFLGDAVLNLLITEILFKNFENYKEGNLAKI
RNC_LACLS       MLKLQEKLKNDYGLVFNDEDLLKTAFTHSSFTNENNERLEFLGDVALSLVISDYLYRTYPEKLEGELSKM
RNC_AQUAE       -----------LGYTFKDKSLLEKALTHVSYSKKHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPL
RNC_LACLA       MLKLQKKLKNDYGLVFNDEDLLKTAFTHSSFTNENNERLEFLGDVALSLVISDYLYRTYPEKLEGELSKM
RNC_LACLM       MLKLQKKLKNDYGLVFNDEYLLKTAFTHSSFTNENNERLEFLGDVALSLVISDYLYRTYPEKLEGELSKM
RNC_RICRS       ----FEKLEKLLSYSFKNKELLIEALSHPSKDDKDYERLEFLGDAVLNLVITEILFRNFANYNEGNLAKI
RNC_RICRO       ----FEKLEKLLSYSFKNKELLIEALSHPSKDDKDYERLEFLGDAVLNLVITEILFRNFANYNEGNLAKI
RNC_RICAE       ----FEKLEKLLSYSFKNKELLIEALSHPSKDDKDYERLEFLGDAVLNLVITEILFRNFANYNEGNLAKI
RNC_RICPU       ----FEKLEKLLSYSFKNKELLIEALSHPSKDDKDYERLEFLGDAVLNLVITEILFRNFANYNEGNLAKI
RNC_BORBU       ---QLSKFLENLSIDFSNFDLLNTALCHSSYSNENNERLEFLGDSVLNLIITDHLYKTYPNKSEGELSKA
RNC_RICCK       ----FNELEKLLGYSFKNKELLIEALSHPSKDNKDYERLEFLGDAVLNLVITKILFSNFASYNEGNLAKI
RNC_RICM5       ----------LLSYSFKNKELLIEALSHPSKDDKDYERLEFLGDAVLNLVITEILFRNFANYNEGHLAKI
RNC_RICCN       ----FEKLEKLLSYSFKNKELLIEALSHPSKDDKDYERLEFLGDAVLNLVITEILFRNFANYNEGNLAKI
RNC_PARUW       -----------LGYTFKDPQLLVLAFVHRSFINENRERLEFLGDSVLGMLISDYLYCKLPKTPEGQLSYL
RNC_BORGA       ---QLSEFLENLSIDFNNFDLLNTALSHSSYSNENNERLEFLGDSVLNLIITDHLYKTYPNKSEGELSKA
RNC_FUSNN       -----------LNYYFNDRNLLKNALLHKSNERKEYERLELLGDAVLDLIVAEYLYKSYKNASEGPIAKL
RNC_BORAP       ---QLSEFLENLSIDFNNFDLLNTALSHSSYSNENNERLEFLGDSVLNLIITDHLYKTYPNKSEGELSKA
RNC_ENTFA       ------------GIVFHDVNLLEQAFTHSSYVNEHRERLEFLGDAVLELIVSQYLYLKFPELPEGKLTKM
RNC_CLOTE       ---------NKIEIKFENIKLLHIALTHSSKKRIQYERLEFLGDSVLQLVITEYLFMNYKDKSEGELSKK
RNC_ANAPZ       ------KVFKISGYRFQDHELLKTAVTHPSIAAESYERLEFLGDAVLGLVVSEMLYTLFPDDSEGLLTKK
RNC_STRSV       ---------------FSDETLLETAFTHTSYANEHRERLEFLGDAVLQLIISEYLYTKYPKRPEGDLSKL
RNC_RICBR       ----FEELEKLLDYSFKNKALLTEALSHPSKANKDYERLEFLGDAVLNLIITEILFNNFKEYNEGNLAKI
RNC_RICB8       ----FEELEKLLDYSFKNKALLTEALSHPSKANKDYERLEFLGDAVLNLIITEILFNNFKEYNEGNLAKI
RNC_LISMH       ---QWEELQESVGFDFKDVELLKQAFTHRRENVKDNERLEFLGDAVLELTVSDYLFNKYPDMAEGHMTKM
RNC_LISMF       ---QWEELQESVGFDFKDVELLKQAFTHRRENVKDNERLEFLGDAVLELTVSNYLFNKYPDMAEGHMTKM
RNC_LISMC       ---QWEELQESVGFDFKDVELLKQAFTHRRENVKDNERLEFLGDAVLELTVSNYLFNKYPDMAEGHMTKM
RNC_STRS7       ---------NSFNIRFDDKRLLETAFTHTSYANEHRERLEFLGDAVLQLIISEYLFAKYPKQTEGDMSKL
RNC_MAGSM       ------RLEQALDYRFTQSDLLQLALTHRSAATTHNERLEFLGDSVLNLIVSHRLYKRFGEVPEGQLSQW
RNC_LISW6       ---QWEELQESVGFDFQDVELLKQAFTHRRENVKDNERLEFLGDAVLELTVSNYLFNKYPDMAEGHMTKM
RNC_SYMTH       -----------LGYEFRDESLLLEALTHTTYANEHNERLEFLGDSVLGMVIAAHLYERYPDLPEGELTKI
RNC_PELTS       ---------NRLGIAWRDEGLLTRALTHSSFTYENRQRLEFLGDAVLELAVSDYLYRSKPEMDEGDLTKL
RNC_THELT       -------FMEKIGYRFYEPELLYNALCHSSKDVESNERLEFLGDAVIDLLLAEYLYLEFPEASEGVMAKV
RNC_STRE4       ---------NSFNIRFDDKRLLETAFTHTSYANEHRERLEFLGDAVLQLIISEYLFAKYPKQTEGDMSKL
RNC_STRCO       -----------LGYQLES-ALLVRALTHRSYAYENNERLEFLGDSVLGLVVTDTLYRTHPDLPEGQLAKL
RNC_LISIN       ---QWEELQESVGFDFQNVELLQQAFTHRRENVKDNERLEFLGDAVLELTVSDYLFNKYPDMAEGHMTKM
RNC_STRAW       -----------LGYKLES-ALLVRALTHRSYAYENNERLEFLGDSVLGLVVTDTLYRTHPDLPEGQLAKL
RNC_LISMO       ---QWEELQESVGFDFKNVELLKQAFTHRRENVKDNERLEFLGDAVLELTVSDYLFNKYPDMAEGHMTKM
RNC_STRZT       ---------NHFAIEFTDKNLLETAFTHTSYANEHRERLEFLGDAVLQLLISEYLXXXXXXXXEGDLSKL
RNC_STRPJ       ---------NHFAIEFADKNLLETAFTHTSYANEHRERLEFLGDAVLQLLISEYLXXXXXXXXEGDLSKL
RNC_STRPI       ---------NHFAIEFADKNLLETAFTHTSYANEHRERLEFLGDAVLQLLISEYLXXXXXXXXEGDLSKL
RNC_LACPL       ------------GIVFNDPDLLAEAFTHQDQQLKYYERVEFLGDAVLELVVSEYLYKRYKDMPQGKLTRL
RNC_THEFY       --------------------ILTRALTHRSYAYENNERLEFLGDSVLGLVVTDTLYRTHPDLSEGQLAKL
RNC_STRZJ       ---------NHFAIEFTDKKLLETAFTHTSYANEHRERLEFLGDAVLQLLISEYLXXXXXXXXEGDLSKL
RNC_STRPS       ---------NHFAIEFTDKKLLETAFTHTSYANEHRERLEFLGDAVLQLLISEYLXXXXXXXXEGDLSKL
RNC_STRPN       ---------NHFAIEFADKKLLETAFTHTSYANEHRERLEFLGDAVLQLLISEYLXXXXXXXXEGDLSKL
RNC_STRP7       ---------NHFAIEFTDKKLLETAFTHTSYANEHRERLEFLGDAVLQLLISEYLXXXXXXXXEGDLSKL
RNC_CORDI       --------------------LLVLALTHRSFANENNERLEFLGDSVLGLSVAGQLYQQYTSSPESDISKM
RNC_BACHD       ----FDELLRTLNLTFANKKLLVQAFTHSSQSCKDNERLEFLGDAVLELAVSQYLYKAFEQMSEGDMTKL
RNC_STRZP       ---------NHFAIEFADKNLLETAFTHTSYANEHRERLEFLGDAVLQLLISEYLXXXXXXXXEGDLSKL
RNC_RHILW       -----AKLEGLIGHDFAEKERLDRALTHASRTEKNYERLEFLGDRVLGLCIAELLFRTFGTAGEGELSVR
RNC_MESFL       -------FFENFGIKINDSKIFSTALTHNSKTKETYQRLEFLGDAVLQMYVSKFLYLNFTNAPEGKLTKT
RNC_CLOBB       ---KFNDIENRLGVYFNNPSLIKTALTHSSKDAKYNERLEFLGDSVLQLCITEYLFNKFKDKSEGELTKI
RNC_CHLSY       -----------IGITFRDRTLLQTAFMHRSLFNEDNERLEFLGDSVLHFVTTTWLFETFPDQDEATLTNW
RNC_CHLAA       -----------IGITFRDRTLLQTAFMHRSLFNEDNERLEFLGDSVLHFVTTTWLFETFPDQDEATLTNW
RNC_STRR6       ---------------FADKKLLETAFTHTSYANEHRERLEFLGDAVLQLLISEYLXXXXXXXXEGDLSKL
RNC_STRP4       ---------------FADKKLLETAFTHTSYANEHRERLEFLGDAVLQLLISEYLXXXXXXXXEGDLSKL
RNC_STRP2       ---------------FADKKLLETAFTHTSYANEHRERLEFLGDAVLQLLISEYLXXXXXXXXEGDLSKL
RNC_CORJK       --------------------LLRLALTHRSFANENNERLEFLGDAVLGLAVAEQLYRQFPERAESDISKM
RNC_CLOBA       ---KFNDIENRLGVYFNNPSLIKTALTHSSKDAKYNERLEFLGDSVLQLCITEYLFNKFKDKSEGELTKI
RNC_CHRVO       ----FRRLSQALDYAFQKPELLRQALTHRSYSSANNERFEFVGDSILNYTVARMLYDQFPQLTEGELSRL
RNC_ANOFW       ---KFKQFQEQTGIFFRNEKLLIQAFTHRKRLHEDNERLEFLGDAVLELTVSQYLFEQFPQMSEGELTKM
RNC_RHIE6       -----AKLESLIGHDFAEKERLDRALTHASRTEKNYERLEFLGDRVLGLCIAELLFRTFGTAGEGELSVR
RNC_RHIL3       -----AKLEGLIGHDFAEKERLDRALTHASRTEKNYERLEFLGDRVLGLCIAELLFRTFGTAGEGELSVR
RNC_CLOAB       -----------LGIEFQNINLLVTALTHSSXXXXXXXRLEFLGDAVLQLSISEYFFKKYPTISEGELTKK
RNC_BART1       ------QLFKLTGHRFKDEEKLKRALTHASSEQGNYERLEFLGDRVLGLLIAEMLYQLFPQASEGELSVR
RNC_ROSCS       -----------LDVTFSDQRLLWQALTHRSFLNERVERLEFLGDAIVNFLATTLVFERFPDAGEGYLTAW
RNC_SYNWW       --------------------LITMALTHPSNTVANNQRLEFLGDAVLNLVVAEYLYNHYGRKAEGELTKI
RNC_SOLUE       -----------LDYRFNDPELLRRALTHSSLANENREQLEFLGDSVLGFLIAEALVRRFPEYHEGDLSRL
RNC_JANSC       ---ELTAFMDRLGYVFEDPALLARALTHSSPTRGDNQRLEFLGDRVLGLVMAEAVLAADTDAKEGTLAPR
RNC_CARHZ       ----------ILGFNFNNPSILLSAITHPSEGIEHNERLEFLGDAVLELFISDYLFRTFPQKSEGDLTKL
RNC_AGRT5       ---EISRLEALIGYEFKEKARLDRALTHXXXXXXNYERLEFLGDRVLGLCVAELLFSTFRNASEGELSVR
RNC_RHIEC       ----------LIGHDFAEKERLDRALTHASRTEKNYERLEFLGDRVLGLCIAELLFRTFGTAGEGELSVR
RNC_CLOPE       ----------LIGIEFENKGVLITALTHSSKDVKYNERLEFLGDSVLQLCVTKYLFNNYKDKSEGELTKI
RNC_SILPO       ---EMKAFEARLGYSFERPELLVRALTHSSSTRQDNQRLEFLGDRVLGLVMATALLEADKDATEGQLAPR
RNC_BACCR       -------FQEKIGITFTDEKLLIQAFTHRKKPHEDNERLEFLGDAVLELTVSQYLFQKYPTMSEGELTKL
RNC_BACC4       -------FQEKIGITFTDEKLLIQAFTHRKKPHEDNERLEFLGDAVLELTVSQYLFQKYPTMSEGELTKL
RNC_BACC2       -------FQEKIGITFTDEKLLIQAFTHRKKPHEDNERLEFLGDAVLELTVSQYLFQKYPTMSEGELTKL
RNC_LACS1       ------RDFNI---TFKDVDLLDAAFTHRKKKLKYYERIEFLGDAVMQLCVSEYIYEHYPEMPEGKMSRL
RNC_ZYMMO       -----------LGHRPKDPALFLRAMTHPSHGNSDYQRLEFLGDRVLGLVIANWLYDLFPREPEGKLSRR
RNC_PEDPA       --------------HFNNHALLDEAFTHPHQELKFYERIEFLGDAVLQLIVSEYLFKRYPEMPQGKLTRL
RNC_BACHK       ----FKLFQEKIGITFTDEKLLIQAFTHRKKPHEDNERLEFLGDAVLELTVSQYLFQKYPTMSEGELTKL
RNC_BACC3       ----FKLFQEKIGITFTDEKLLIQAFTHRKKPHEDNERLEFLGDAVLELTVSQYLFQKYPTMSEGELTKL
RNC_BACC0       ----FKLFQEKIGITFTDEKLLIQAFTHRKKPHEDNERLEFLGDAVLELTVSQYLFQKYPTMSEGELTKL
RNC_BACAN       ----FKLFQEKIGITFTDEKLLIQAFTHRKKPHEDNERLEFLGDAVLELTVSQYLFQKYPTMSEGELTKL
RNC_BACAC       ----FKLFQEKIGITFTDEKLLIQAFTHRKKPHEDNERLEFLGDAVLELTVSQYLFQKYPTMSEGELTKL
RNC_BACAA       ----FKLFQEKIGITFTDEKLLIQAFTHRKKPHEDNERLEFLGDAVLELTVSQYLFQKYPTMSEGELTKL
RNC_LACRJ       --------------HFDNPALLAEAFTHPNQGLKYYERIEFLGDAVLELIVSEYIYKRFPELPQGKLTRL
RNC_LACRD       --------------HFDNPALLAEAFTHPNQGLKYYERIEFLGDAVLELIVSEYIYKRFPELPQGKLTRL
RNC_BACCQ       -------FQEKIGITFTDEKLLIQAFTHRKKPHEDNERLEFLGDAVLELTVSQYLFQKYPTMSEGELTKL
RNC_BACC7       -------FQEKIGITFTDEKLLIQAFTHRKKPHEDNERLEFLGDAVLELTVSQYLFQKYPTMSEGELTKL
RNC_BACC1       -------FQEKIGITFTDEKLLIQAFTHRKKPHEDNERLEFLGDAVLELTVSQYLFQKYPTMSEGELTKL
RNC_STRA5       ------------GIVFANQELLDTAFTHTSYANEHRERLEFLGDAVLQLLISQYLFTKYPQKAEGDLSKL
RNC_STRA3       ------------GIVFANQELLDTAFTHTSYANEHRERLEFLGDAVLQLLISQYLFTKYPQKAEGDLSKL
RNC_STRA1       ------------GIVFANQELLDTAFTHTSYANEHRERLEFLGDAVLQLLISQYLFTKYPQKAEGDLSKL
RNC_BACWK       -------FQEEIGITFTDEKLLIQAFTHRKKPHEDNERLEFLGDAVLELTVSQYLFQKYPTMSEGELTKL
RNC_STRGC       --------FDRFGLVFKDVSLLETAFTHTSYANEHRERLEFLGDAVLQLIISEYLFEKYPKRPEGDLTKL
RNC_PHEZH       -----------IGYVFTDRDLLERALTHASRAVRHNERLEFLGDRVLNLCAAERLMALDPDAREGEMSRL
RNC_OCEIH       -----------LGISFQQKALLKEAFTHRKQRLSDNERLEFLGDAVLELAVSQYLYRNNKDMPEGEMTKL
RNC_DINSH       ---EISAFCDRIGHRFDRPELLVRALTHASRSRSDNQRLEFLGDRVLGLVMAEALLEADPQAREGQLAPR
RNC_CORGL       --------------------LLVLALTHRSFANENNERLEFLGDAVLGLSVANKLYEQYPSSPESDVSKM
RNC_BACCZ       -------FQEKIGITFTDEKLLIQAFTHRKKPHEDNERLEFLGDAVLELTVSQYLFQKYPTMSEGELTKL
RNC_RHILO       ------------GHAFADRQRLQRALTHASARGANYERFEFLGDRVLGLVVADMLLAAFPDAAEGELSLR
RNC_CLOK5       -----------LNISFNDKELIDTALTHSSKGVKFNERMEFLGDSVLQLCISEYLFLIYKSKSEGELTKK
RNC_CLOK1       -----------LNISFNDKELIDTALTHSSKGVKFNERMEFLGDSVLQLCISEYLFLIYKSKSEGELTKK
RNC_BACCN       ----FRAFQQKLGITFTNEKLLIQAFTHRKKPHEDNERLEFLGDAVLELTVSQYLFQKYPTMSEGELTKL
RNC_COREF       -----------------DRDLLVLALTHRSFANENNERLEFLGDAVLGLAVANRLYELYPSSPESDISKM
RNC_ROSS1       -----------LGVTFSDQRLLEQALTHSSFLNEHVERLEFLGDAIINFLAARLVFERFPDAGEGELTAW
RNC_PELCD       -----------IDYVFDNQALLLEALTHKSRTEPDNERLEFLGDAVLGVVVSHYIFRTFPHLPEGELTRI
RNC_METSB       --PDLSALEARIGHRFSAADLIEAALTHVSAARVSYQRLEFLGDRVLGVVVANMLYGAFPDADEGELSRR
RNC_CHLAD       MVERLAELERALGITFRDRKLLQTALMHRSSNLSDNERLEFLGDSVLHFVTTTWLFQQFPHQNESTLTSW
RNC_BACLD       -----------ISVQFQNEKLLYQAFTHRKKPYEDNERLEFLGDAVLELTISQFLYAKYPAMSEGDLTKL
RNC_LEUCK       ---------------FNNETLLLEALTQRNEPGRDYQRLEFLGDSVMQVSVAEYLFKRYPNWHEGQLTEM
RNC_PELLD       --------------------LYATALTHRSEITRSNQRLEFLGDSVLGLIISEYLYRRFPEGTEGELSSY
RNC_RHOPA       -----------LGHSFADPSLLTTAFTHVSALKSSYQRLEFLGDHVLGLIVSDMLYRAFPDADEGELSKR
RNC_BACSU       -----------ISVHFQNEKLLYQAFTHRKKPYEDNERLEFLGDAVLELTISRFLFAKYPAMSEGDLTKL
RNC_PELUB       -----------LKLKFSDQKIFIKSLTHKSDSINNNEKIEFLGDRVLGLIIAKKLLELYPDEKEGVLDKK
RNC_GEOKA       ---KFQELQNKIGITFRNEKLLIQAFTHRRRLHEDNERLEFLGDAVLELTVSQYLFQKFPHMSEGQLTKL
RNC_BACA2       -----------ISVHFQNEKLLYQAFTHRKKPYEDNERLEFLGDAVLELTISQFLFAKYPAMSEGDLTKL
RNC_SYNY3       -----------------DPQLKLEALTHRSYCNEHYDRLEFLGDAVLGFVVGRILFERYPHFTEAELTRL
RNC_STAEQ       -----------LGLHFKNIDLYQQAFSHSSNRLEHNERLEFLGDAVLELTVSRYLFDRHPHLPEGNLTKM
RNC_RHOBA       -VAKIERCQEILGYDFRDLDLLRSALTHASGASHRLERLEFLGDSVLGLTVCEWLFNEYPEYSEGDLTKI
RNC_RHISN       -----ARLETAIGYQFAEKERLDRALTHRNARASNYQRLEFLGDRVLGLCVAELLFQTFLDANEGELSVR
RNC_PHYMT       --------------------------------KKDNERLEFLGDAVINLLMADYLYTKKEKENEGFMSKK
RNC_BARQU       --PIIDQLERLTEHHFKDEERLKKALTHSSSEQGNYERLEFLGDRVLGLLIAEMLYKLFPQASEGELSVR
RNC_DESRM       -----NRLKTRLGFKWHNPTLLIQALTHSSCVHENRQRLEFLGDAVLELIISEHLYKMFPDRTEGELTKM
RNC_BRUSU       ------------GHRFLNLKRLERALTHSSPARANYERLEFLGDRVLGLTVAEMLFEAFPEASEGELSVR
RNC_BRUSI       ------------GHRFLNLKRLERALTHSSPARANYERLEFLGDRVLGLTVAEMLFEAFPEASEGELSVR
RNC_BRUME       ------------GHRFLNLKRLERALTHSSPARANYERLEFLGDRVLGLTVAEMLFEAFPEASEGELSVR
RNC_BRUMB       ------------GHRFLNLKRLERALTHSSPARANYERLEFLGDRVLGLTVAEMLFEAFPEASEGELSVR
RNC_BRUC2       ------------GHRFLNLKRLERALTHSSPARANYERLEFLGDRVLGLTVAEMLFEAFPEASEGELSVR
RNC_BRUAB       ------------GHRFLNLKRLERALTHSSPARANYERLEFLGDRVLGLTVAEMLFEAFPEASEGELSVR
RNC_BRUA2       ------------GHRFLNLKRLERALTHSSPARANYERLEFLGDRVLGLTVAEMLFEAFPEASEGELSVR
RNC_BRUA1       ------------GHRFLNLKRLERALTHSSPARANYERLEFLGDRVLGLTVAEMLFEAFPEASEGELSVR
RNC_THEMA       -------FQKETGINFKNEELLFRALCHSSKDVESNEKLEFLGDAVLELFVCEILYKKYPEAEVGDLARV
RNC_THESQ       -------FQKKTGINFKNEELLFRALCHSSKNVESNEKLEFLGDAVLELFVCEILYKKYPEAEVGDLARV
RNC_STAES       -----------LGLHFKNIDLYQQAFSHSSNRLEHNERLEFLGDAVLELTVSRYLFDRHPHLPEGNLTKM
RNC_RHIME       -----ARLEAAIGYRFAEKERLDRALTHRSGRAINYQRLEFLGDRVLGLCVAELLFQTFTDANEGELSVR
RNC_CLOB8       -----------LGVFFNNHTLLKTALTHSSKDAEYNERLEFLGDSVLQLCITEYLFNNYKHKTEGELTKI
RNC_STAAB       -----------LGFTYQNIDLYQQAFSHSSNRLDHNERLEFLGDAVLELTVSRYLFDKHPNLPEGNLTKM
RNC_SINMW       -----ARLEAAIGYQFAEKERLDRALTHRSGRAINYQRLEFLGDRILGLCVAELLFQTFSDANEGELSVR
RNC_GEOSW       -----------IGIFFTNEKLLIQAFTHRRRPHEDNERLEFLGDAVLELTVSQYLFKKFPHMSEGELTKL
RNC_ANASP       ---------------FRDDKLLRRALTHRSYVNENNERLEFLGDAILNFLSGEYLYRSHPDRGEDELTRR
RNC_MYCTU       MIRSRQPLLDALGVDLPD-ELLSLALTHRSYAYENNERLEFLGDAVLGLTITDALFHRHPDRSEGDLAKL
RNC_MYCBO       MIRSRQPLLDALGVDLPD-ELLSLALTHRSYAYENNERLEFLGDAVLGLTITDALFHRHPDRSEGDLAKL
RNC_DESVH       -----------IGHRFGDMELLLTAMTHSSWANEHNERLEFLGDAVLELCVSEELFRRFPSAREGDLTRM
RNC_BARHE       -LPMIDQLEKLTGHYFXXXXXXXXALTHSSSEQGNYERLEFLGDRVLGLLIAEMLYQLFPQASEGELSVR
RNC_BACSK       ------------GLTFENRKLLIQAFTHSSYVNEDNERLEFLGDAVLELAVSQYLFKTYKNMSEGDMTKL
RNC_RHOCA       ---DLSAFMDRLGHRFTTPEHLVRALTHSSATRPDNQRLEFLGDRVLGLSMAEALFHADGRASEGQLAPR
RNC_EHRCJ       -------------YHFKNPQLLHEALTHPSIISKNYERLEFLGDAVLNIVISEMLFNIFPKDTEGNLAKK
RNC_STAHJ       ---QFAKKMNELGFTYSNIDLYQQAFSHSSFINDHNERLEFLGDAVLELTVSRYLFDKHPDLPEGNLTKM
RNC_STAAW       -----------LGFTYQNIDLYQQAFSHSSNRLDHNERLEFLGDAVLELTVSRYLFDKHPNLPEGNLTKM
RNC_STAAT       -----------LGFTYQNIDLYQQAFSHSSNRLDHNERLEFLGDAVLELTVSRYLFDKHPNLPEGNLTKM
RNC_STAAS       -----------LGFTYQNIDLYQQAFSHSSNRLDHNERLEFLGDAVLELTVSRYLFDKHPNLPEGNLTKM
RNC_STAAR       -----------LGFTYQNIDLYQQAFSHSSNRLDHNERLEFLGDAVLELTVSRYLFDKHPNLPEGNLTKM
RNC_STAAN       -----------LGFTYQNIDLYQQAFSHSSNRLDHNERLEFLGDAVLELTVSRYLFDKHPNLPEGNLTKM
RNC_STAAE       -----------LGFTYQNIDLYQQAFSHSSNRLDHNERLEFLGDAVLELTVSRYLFDKHPNLPEGNLTKM
RNC_STAAC       -----------LGFTYQNIDLYQQAFSHSSNRLDHNERLEFLGDAVLELTVSRYLFDKHPNLPEGNLTKM
RNC_STAA9       -----------LGFTYQNIDLYQQAFSHSSNRLDHNERLEFLGDAVLELTVSRYLFDKHPNLPEGNLTKM
RNC_STAA8       -----------LGFTYQNIDLYQQAFSHSSNRLDHNERLEFLGDAVLELTVSRYLFDKHPNLPEGNLTKM
RNC_STAA3       -----------LGFTYQNIDLYQQAFSHSSNRLDHNERLEFLGDAVLELTVSRYLFDKHPNLPEGNLTKM
RNC_STAA2       -----------LGFTYQNIDLYQQAFSHSSNRLDHNERLEFLGDAVLELTVSRYLFDKHPNLPEGNLTKM
RNC_RHOSK       -------FEGRIGHQFREPERLLRAVTHSSLTRSDNQRLEFLGDRVLGLVMXXXXXXXXXXXSEGQLAPR
RNC_RHOS4       -------FEGRIGHQFREPERLLRAVTHSSLTRSDNQRLEFLGDRVLGLVMXXXXXXXXXXXSEGQLAPR
RNC_RHOS1       -------FEGRIGHQFREPERLLRAVTHSSLTRSDNQRLEFLGDRVLGLVMXXXXXXXXXXXSEGQLAPR
RNC_ROSDO       ---ELKSFQKRLGHQFNQPALLAQAVTHASMSTANRQRMEFLGDRVLGLVMAEALLRLDNNATEGQLAPR
RNC_GEOTN       -----------IGITFQNEKLLIQAFTHRRRFHEDNERLEFLGDAVLELTVSQYLFQKFPHMSEGQLTKL
RNC_SPHAL       ---------DIIGCIPDDLTLYDLALTHGSTGRADYQRLEFLGDRVLGLVLASELYTRFPAASEGEMSSR
RNC_HELMI       -----------IGIASEDLATLEMALTHPSFVYENNQRLEFLGDAVLGLVIGEQLFVRYPTWTEGELSRR
RNC_BRAJA       -----------IGHSFADPNLLMQGITHVSALKSSYQRLEFLGDHVLGLVVSDMLYHAFPNADEGELSKR
RNC_AGRVS       ----------VIGYHFIGKERLDKALTHSSARPSDYERLEFLGDRVLGLCVAEHLFKVFRAATEGELSVR
RNC_STAAM       -----------LGFTYQNIDLYQQAFSHSSNRLDHNERLEFLGDAVLELTVSRYLFDKHPNLPEGNLTKM
RNC_STAA1       -----------LGFTYQNIDLYQQAFSHSSNRLDHNERLEFLGDAVLELTVSRYLFDKHPNLPEGNLTKM
RNC_RHOS5       -------FESRIGHAFREPDRLLRAVTHASATRPDNQRLEFLGDRVLGLVMXXXXXXXXXXXTEGQLAPR
RNC_MIMIV       ----------LLQYNTKDLKLFYEAMTHRSYLKKSNERLQFLGDAVIHFIIGEYLFNKYADSGEGYLTRL
RNC_LACF3       ------------GIHFNNPALLAEAFTHPHENLKYYERIEFLGDAVLQLFVSEYIYRRYPELPQGKLTRL
RNC_AGRRK       -----------IGHAFVEKERLDWALTHASRTHKNYERLEFLGDRVLGLCIAELLFRTFGTATEGELSVR
RNC_DEHSC       ---------NSLGVKFEQPSLLEQALIHTSWVNENNERMEFLGDAVLGVIFADRLYHDFPDIQEGDLTXX
RNC_BACV8       ----YLRFYKMLGFYPKDISIYEQALLHKSLSVKNNERLEFLGDAILDAVVADIVYKRFEGKREGFLTNT
RNC_GEOSL       -----------IGYRFTDRRFLDEALTHRSPTVPDNERLEFFGDAILGFCIGKMLLRHYPESREGALARM
RNC_STAS1       ------------------------------------ERLEFLGDAVLELTVSRYLFDKYPELPEGNLTKM
RNC_BARBK       ----------LTGHSFKNEDLLKKALTHSSVQRSNYERLEFLGDRVLGLLVAEMLYQFFPQASEGELSVR
RNC_AZOPC       ----YFALYRMLGFPPKNFSIYEKALLHKSSSKRNNERLEFLGDAIFNAIIAVILYKKFPTNDEGFLTNT
RNC_LACSS       ------------GIEFNNLALLDEAFTHSSYVNRDNERLEFLGDAVMEITVSEYLYKKYPDWPEGKLTRL
RNC_LACAC       --------YNI---EFNNEKLLEEAFTHSSYSNRDYEKLEFLGDAVLELAVSNYLYRHYPKLNEGELTRL
RNC_MYCCT       -------------YNIKDQQIYKEALTHNSKLKYSYQRLEFLGDAILQMYVSKFLFFHYSKLGEGELTRL
RNC_LACJO       ------------GIKFNNEKLLEDAFTHSSYARKDYEKLEFLGDAVLELAVSDYLYRHFPRLNEGELTRM
RNC_EHRRW       ----------IIKYDFKNTQLLNEALTHPSVLSKNYERLEFLGDAVLNLVISEMLFNIFPYDTEGNLAKK
RNC_EHRRG       ----------IIKYDFKNTQLLNEALTHPSVLSKNYERLEFLGDAVLNLVVSEMLFNIFPYDTEGNLAKK
RNC_VEREI       MRPDLIALQERLQHVFSDPGLLERATTHRSFSAEHNERLEFLGDSVLNLAVSSLLYQRLSALPEGELSRV
RNC_MYCMS       -------------YNIKNEKLFNEALTHNSKLKYSYQRLEFLGDAILQMYVSRFLFFNYSKLSEGELTRL
RNC_LEPBL       -IQSFKKLSKKIGIKFSKIEYYNTAFIHSSYKNENNERLEFLGDSVLGLVAARSLFQKYPKASEGELSRI
RNC_CHLCH       ------------------------ALTHRSVINESNQRLEFLGDAVLGLLISHFLFQNFPASAEGDLSKT
RNC_OENOB       ------------GIEFANQDLLLEAFTHPEEKGRDYQRLEFLGDSVMQLIVADYLFTRYPAWEEGQLTEM
RNC_LEPBJ       -IQSFKKLSKKIGIKFSKIEYYNTAFIHSSYKNENNERLEFLGDSVLGLVAARSLFQKYPKASEGELSRI
RNC_LEPIN       -----------IGIKFSKVEYYNTAFIHSSYKNENQERLEFLGDSVLGLVAARSLFRKYPKANEGELSRI
RNC_LEPIC       -----------IGIKFSKVEYYNTAFIHSSYKNENQERLEFLGDSVLGLVAARSLFRKYPKANEGELSRI
RNC_SPICI       ---ELKAFFKQYHVFIKERQYYLEALTHNSYANEHYQRMEFLGDAILAKEISLYLFLSFPDKNEGEITNL
RNC_BIFLO       --------------------LLVQALTHRSFSHENYERLEFLGDAVLELVSTETLFTIHPDMTEGQLAKM
RNC_STRT2       ------------GIVFSQKDLLETAFTHTSYANEHRERLEFLGDAALQLVISVYLYNRYPNKPEGEMSKM
RNC_STRT1       ------------GIVFSQKDLLETAFTHTSYANEHRERLEFLGDAALQLVISVYLYNRYPNKPEGEMSKM
RNC_STRTD       ------------GIVFSQKDLLETAFTHTSYANEHRERLEFLGDAALQLVISVYLYNRYPNKPEGEMSKM
RNC_TREPS       ------RLQETLGVKFRDPTALDQALSHRSSSKEDHERMEFXXXXXXXXXXXXCLYRALPDSHEGDLAKT
RNC_TREPA       ------RLQETLGVKFRDPTALDQALSHRSSSKEDHERMEFXXXXXXXXXXXXCLYRALPDSHEGDLAKT
RNC_STRPZ       ---------------FNDLTLLETAFTHTSYANEHRERLEFLGDAVLQLIISEYLFAKYPKKTEGDMSKL
RNC_STRPG       ---------------FNDLTLLETAFTHTSYANEHRERLEFLGDAVLQLIISEYLFAKYPKKTEGDMSKL
RNC_STRPD       ---------------FNDLTLLETAFTHTSYANEHRERLEFLGDAVLQLIISEYLFAKYPKKTEGDMSKL
RNC_STRP6       ---------------FNDLTLLETAFTHTSYANEHRERLEFLGDAVLQLIISEYLFAKYPKKTEGDMSKL
RNC_DEHE1       -----------LGVKFENLSLLEQALIHTSWVNENNERMEFLGDAVLGVIFADRLYHDFPDIQEGDLTXX
RNC_BACTN       ----YLCFYRILGFYPHNIQIYEQALLHKSSAVRNNERLEFLGDAILDAIVGDIVYKRFEGKREGFLTNT
RNC_BACFR       ----YSCFYRILGFYPRNIRLYEQALLHKSTAVRNNERLEFLGDAILDAIVGDIVYQHFEGKREGFLTNT
RNC_BACFN       ----YSCFYRILGFYPRNIRLYEQALLHKSTAVRNNERLEFLGDAILDAIVGDIVYQHFEGKREGFLTNT
RNC_STRPF       ---------------FNDLTLLETAFTHTSYANEHRERLEFLGDAVLQLIISEYLFAKYPKKTEGDMSKL
RNC_STRPC       ---------------FNDLTLLETAFTHTSYANEHRERLEFLGDAVLQLIISEYLFAKYPKKTEGDMSKL
RNC_STRPB       ---------------FNDLTLLETAFTHTSYANEHRERLEFLGDAVLQLIISEYLFAKYPKKTEGDMSKL
RNC_STRP8       ---------------FNDLTLLETAFTHTSYANEHRERLEFLGDAVLQLIISEYLFAKYPKKTEGDMSKL
RNC_STRP3       ---------------FNDLTLLETAFTHTSYANEHRERLEFLGDAVLQLIISEYLFAKYPKKTEGDMSKL
RNC_STRP1       ---------------FNDLTLLETAFTHTSYANEHRERLEFLGDAVLQLIISEYLFAKYPKKTEGDMSKL
RNC_LEUMM       --------------SFNDESLLTEALTQRNEKGRDYQRLEFLGDSVMQMIVAEYLFKRYPDWHEGQLTEM
RNC_MYXXD       -----------LGLSFSRMETALEALTHRDKELKDNQRLEFLGDSVVNLAVSHRLMARCPGLPEGDLTKM
RNC_MYCPA       -----------LGVELPD-ELLSLALTHRSYAYEHNERLEFLGDAVLGLTITDALYHRHPDRTEGDLAKL
RNC_LEIXX       -----------------DPELLELALTHRSYAYENNERLEFLGDSILGQAVTVKLFRENPGLDEGELAKR
RNC_STRPM       ---------------FNDLTLLETAFTHTSYANEHRERLEFLGDAVLQLIISEYLFAKYPKKTEGDMSKL
RNC_CHLAB       -----------LNFTFTQPKLLVTALTHRNETAEDSERLEFLGDAVLCLIVTEHLFLLFPSMDEGTLSTA
RNC_TROWT       --------------------LLRTAFVHKSFSFENNERLEFLGDAVLGLVVSHYLFETCPEYTEGQLSAA
RNC_TROW8       --------------------LLRTAFVHKSFSFENNERLEFLGDAVLGLVVSHYLFETCPEYTEGQLSAA
RNC_ONYPE       --------FQTLNITPQNLTLYKQALTHSSYSQEDNERLEFLGDAIVGLLMADYLYSQSKE-DEGIMTKK
RNC_MYCLE       --------------------LLSLALTHRSYAYEHNERLEFLGDAVLSLTITDELFHRHPDRSEGDLAKL
RNC_CHLTE       ------------------------ALTHRSVLHDHHQRLEFLGDAVLDLLISEHLFKQFPGSDEGHLSSN
RNC_CAEEL       ITPTLSTFHALLGIQFNNIRLLAKAFTRRNLTKGHNQRLEWLGDSVLQLIVSDFLYRRFPYHHEGHMSLL
A464_PBCV1      ----------LIGMPIIDFSYYKTAFSYNAEGEATYERMEFVGDSVLGFIIARYLYDNFPGKDEGFLSRL
RNC_CHLTB       -----------LNFTFSHPRLLITALTHSSSAEEDSERLEFLGDAVLGLVVTEHLFLLFPALNEGLLSTT
RNC_AYWBP       ----------------KNLVLYKQALTHSSYSQEDNERLEFLGDAIVGLLMADYLYSQSKE-DEGIMTKK
RNC_CHLT2       -----------LNFTFSHPRLLITALTHPSSAEEDSERLEFLGDAVLGLVVTEHLFLLFPALNEGLLSTT
RNC_CAUCR       -----------IGHRFEDRELLERALTHASKKVRDNEVLEFIGDRVLGLLAAEALAQRFPKAKEGELAPR
RNC_CAUCN       -----------IGHRFEDRELLERALTHASKKVRDNEVLEFIGDRVLGLLAAEALAQRFPKAKEGELAPR
RNC_MOUSE       VLQKLTEFEEAIGVIFTHVRLLARAFTLRTVTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLL
RNC_HUMAN       VLQKLTEFEEAIGVIFTHVRLLARAFTLRTVTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLL
RNC_CHLMU       -----------LKFTFSQPRLLVTALTHPSYRNEDSERLEFLGDAVLGLVVTEHLFLLFPSLNEGLLSTT
RNC_NITWN       -----------LGHTFADISLLTTAFTHVSALKSSYQRLEFLGDHVLGLVVSDMLYRAFPKADEGELSKR
RNC_CHLTR       -----------LNFTFSHPRLLITALTHPSSAEEDSERLEFLGDAVLGLVVTEHLFLLFPALNEGLLSTT
RNC_CHLTA       -----------LNFTFSHPRLLITALTHPSSAEEDSERLEFLGDAVLGLVVTEHLFLLFPALNEGLLSTT
RNC_STACT       ---------HMLKLNYDHLPLYQQAFSHSSFINDHNERLEFLGDAVLELTVSRYLFDKYPELPEGNLTKM
RNC_MYCS5       -IEELKAFLQKNNIEYKNIDLFIEATTHKTKNSKDYERLEFLGDSLVGFLISDYCVREFSSLEPGELSRL
RNC_CAEBR       ---DFHRLEQIIGIEFNNIRLLAKAFTRRNVTKGHNQRLEWLGDSVLQLIISDYLYRNFPLHHEGHMSLL
RNC_GEOMG       -----------IGYRFVNRQFLAEALTHRSWVNRDNERLEFLGDAVLGLLVGKMLFARFPQSREGVLARM
RNC_AZOC5       -----------LGHSFADRSHLVLALTHISSVKRSYQRLEFLGDHVLGSVVSHMLYAAFPKAEEGELSRR
RNC_SYNFM       ---------NLLGYRFGDEGLLHRALVHRSYLEKDNETLEFLGDAVLGLAISHFLLEQFPDYNEGELSRL
RNC_CHLFF       -----------LKFTFTQPQLLVTALTHRNETTEDSERLEFLGDAVLCLIVTEHLFLLFPSMDEGTLSTA
RNC_STRMU       ---------------FSDKELLETAFTHTSYANEHRERLEFLGDAVLQLTISHYLFDKYPQKAEGDLSKM
RNC_MOOTA       ------------------------ALTHPTYAFEHHQRLEFLGDAVLGLVVATYLYQHFPQLPEGDLTRM
DCL4_ORYSJ      ----------LIGYKFKHKGLLLQAFVHPSFSQHSYQRLEFLGDAVLEYVITSYLYSTYPDIKPGQITDL
RNC_CHLCV       -----------LNFTFTQPKLLVTALTHRNETTEDSERLEFLGDAVLCLIVTEHLFLLFPSMDEGTLSTA
PAC1_SCHPO      ------------------------------------ERLEFLGDSFFNLFTTRIIFSKFPQMDEGSLSKL
DCL1_ORYSJ      ----------VLGIEFQNKGLLVEAITHASRPSSGYQRLEFVGDAVLDHLITRHLFFTYTDLPPGRLTDL
RNC_UREPA       ----------------KNLSIYLEALTHKSKLTKNYQRLEFLGDACVEWVISNFIFEKMRSLDEGEMTRA
RNC_THEP1       -------FQKKTGINFKNEELLFRALCHSSKDVESNEKLEFLGDAVLELFVCEILYKKYPEAEVGDLARA
DICER_ARATH     -----------LKYEFKEKGLLVEAITHASRPSSGYQRLEFVGDAVLDHLITRHLFFTYTSLPPGRLTDL
Y346_SYNY3      -----------------DWNLVDLALTHASQSEQNYQQLEFVGDAVVRLASAEVLMKHYPQTSVGEMSAL
RNC_DESVM       ----FEKLQSDIHYAFNDAGLLATAMTHSSWANEQQERLEFLGDAVLELCVSEELFARFPGAREGDLTRM
RNC_NOCFA       --------------------LLRLALTHRSYAYENNERLEFLGDSVLGLSITERLYHEHPDKSEGELAKL
DCL3A_ORYSJ     -----------LGYSFSVKGLLVEALTHPSQAKYCYERLEFLGDAVLDILLTRYLFNSHKDTNEGELTDL
DCL2B_ORYSJ     ----------MLGYKFNDSLLLLEALTHGSYQTSGYQRLEFLGDAILDHLFTEYYYSKYPDCTPELLTDL
RNC_MYCMO       ---------------FKDIKYYIQALTHKTYANEHYDILEFIGDAILQMKSSIFIFQHFQNITEGEASLI
RNC_CHLPN       -----------LNFTFTQPKLLEIALTHPSYKNESAERLEFLGDAVLGLIVTEHLFLLFPSMDEGTLSTA
DCL2A_ORYSJ     ----------MLGYKFNDSLLLLEALTHGSYQTSGYQRLEFLGDAILDHLFTEYYYSKYPDCTPELLTDL
DCL3B_ORYSJ     -----------LKYNFSVKGLLLEAITHPSLQELGYQRLEFLGDSVLDLLLTRHLYATHTDVDPGELTDL
RTL3_ORYSJ      ---EVAAVESLLGYEFRDKALVEEALTHGSRPGVTYERLEYLGDAVLTCVVSREVFLTYGQLQPGPLTRL
RNC_MYCGE       -------------------------INEHEDVSESYDRLEFLGDALIDFVVAKKLFELYPKYNEGLLTRT
RNC_CAUSK       -----------IGHTFADRKLLELALTHASKKAGDNEVLEFIGDRVXXXXXXXXXXXRFPKAKEGELAPR
DCR1_DROME      -------------YKFRDRSYLLQAMTHASYTPNRYQRLEFLGDAVLDYLITRHLYEDPRQHSPGALTDL
RNC_MYCPN       ---KFVAFFKSLNIEPQNWQFYEDAFVHSSYVNENYDRLEFLGDALIDFIVAKKLFELYPNYNEGMLTRT
RNC_THENN       -----------LGVLFNDEELLFRALCHSSYANESNEKLEFLGDAVLELFVCEILYRKYPEAEVGDLARV
DCL2_NEOFI      ---------------FKSTDHIITAITPFAHALTNYQRYEFLGDSILKFSVSCQLFFQHPNWHEGYLSEG
DICER_BOVIN     LISGFENFEKKINYRFKNKAYLLQAFTHASYHYNTYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDL
DCR1_SCHPO      --PYSSYIEETIGYSFKNKKLLHLAFIHPSMMSQNYQQLEFLGDAVLDYIIVQYLYKKYPNATSGELTDY
DCR1_CAEEL      ---QFTQLEEKIGYRFKERAYLVQAFTHASYINNRYQRLEFLGDAVLDYMITRYLFEDSRQYSPGVLTDL
DICER_MOUSE     LISGFETFEKKINYRFKNKAYLLQAFTHASYHYNTYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDL
DICER_CRIGR     LISGFENFEKKINYRFKNKAYLLQAFTHASYHYNTYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDL
DCL2_MAGGR      --------------DFKDIDLVMMVITSSSAGRTNYERVEFLGDAVLKLGAAVTCATNNLHFPEGYLSLL
DCL2_ASPFU      -------------------TAISTPLAHRLT---NYQRYEFLGDSILKFSVSCQLFFQHPNWHEGYLSEG
RTL2_ORYSJ      -------------YQFRDGRLLEEALTHQSFADDSYQRLEFVGDSALGLAFSNFLYLTNPTLGPGPLSTL
DICER_XENTR     LISGFENFEKKINYPFKNKAYLLQAFTHASYHYNTYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDL
DICER_HUMAN     LISGFENFEKKINYRFKNKAYLLQAFTHASYHYNTYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDL
DICER_DANRE     LISGFLNFESKINYTFKNKAYLLQAFTHASYHYNTYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDL
DICER_CHICK     LISGFENFEKKINYSFKNKAYLLQAFTHASYHYNTYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDL
DCL2_EMENI      ---------NHIGYTFKDKTLLMEALTHPSTSIQSYQRLEFLGDAVLDMLIVDLIRAHHVECQQGEMTKI
RNT1_YEAST      ----------------QDLAIRARVFIHKSTIKDKVERLEFLGDSILNSVMTLIIYNKFPDYSEGQLSTL
DCL2_ASPCL      ----------------------------------NYQRYEFLGDSILKFSVSCQLFFKHPNWHEGYLSEG
DCL2_ASPTN      ----------------------ISAPTAQSPT--DYQRYEFFGDSVLKFTVSCQLYMQHPNWPEGYLSEG
DCL2_ASPOR      ----------------------------------NYQRYEFLGDSILKYIVSCQLFFQNLNWPEGFLTEG
DCL1_ASPFU      -----------LGYHFTYPRLLASAITHPSLPSTCYQRLEFLGDSLLDMVCVEDLFRRFPDRDPQWLSEH
DCL1_NEOFI      -----------LGYHFTYPRLLASAITHPSLPSTCYQRLEFLGDSLLDMVCVEDLFRRFPDRDPQWLTEH
DCL2_PHANO      ----------LIGYTFKKKPLLLEALTHASFSGPHYERLEFLGDAVLDYIISKRLHAHSPELSHQKMHAI
RNC_IIV3        ----------------------------------NYELFEQMGDSTIGKFIVWSSYEKFPQL-RGKVARM
DCL2_CRYPA      -------------------SMLVEAICAKSRTPENYERIEFLGDSILKTCITVNLAATKLHLPEGILSLM
DCL1_ASPNC      -----------LSYRFRYPTLLGSAFTHPSYPSACYQRLEFLGDSLIDMVCVEDLFARFPDLTEHKMAMV
DCL4_ARATH      ---------NQLDYKFLHKGLLVQAFIHPSYNRHGYQRLEFLGDAVLDYLMTSYFFTVFPKLKPGQLTDL
DCL21_ASPNC     ---------------FSSIRHIITAITAPSQSLTNYQRYEFFGDSVLKFTVSCQLFFQHPNWHEGYLSEG
DCL1_ASPCL      -----------LGYHFRYPRLLCSAVTHPSTPSTCYQRLEFLGDSLLDMVCVEDLFHRFPDRDPQWLTEH
DCL1_ASPOR      -----------LGYRFKYPRLLHSAFTHPSYPSTCYQRLEFLGDSLLDMVCVDDLFYRYPDKDPQWLTEH
DCL1_MAGGR      -----SQIKNKMGYRFKNPRLLRCAFMHPSYPRQSYQRLEFLGDSLLDMVCVDYLFKKHPDKDPQWLTEH
DCL2_NEUCR      --------YNRLGCLQLDNLPLITTISSGSRGPTNYERLEFIGDTILKFLTASALSAHHSIVPERLLSQW
DCL1_COCIM      -----------LGYDFKYPKLLRSAFTHPSYPSACYQRLEFLGDALLDMACVEHIYHKHPDKDPQWLTEH
RNC_IIV6        --------------------------------KNNYEMFEQLGDVSVNKFIVNYMYKRFPQLRNPNVAKL
DCL2_COCIM      -----SEIEGLVGYTFKKKPLLLAAVTHPSSSGHSYQRLEFVGDSILDIIVVQELFESPRCFHHFDMHLM
DCL_GIALA       -----------------------------------FQRLELLGDAVLGFIVTARLLCLFPDASVGTLVEL
DCL22_ASPNC     ----------LLGYTFTDKSLAVESMTHPSCTTTSYRRLSFLGASVLEWIVVSYLHRHAQVMNPQRMQSL
DCL1_ASPTN      -----------LGYHFRYPRLLHSAFTHPSYPSACYQSLEFLGDALLDMVCVEDLFRRFPDRDPQWLTEH
DCL1_CRYPA      ------KIHEATGYQFKHPRVLRSAFRHPSRPYPHYQRLEFLGDALFDMACVDYLFHIAPDEGPQWLTEH
DCL1_NEUCR      ----------------------------------NYERLEFLGDSFLKMATTIAIYTLIPDKGEFEYHVE
DCL1_CHAGB      -------------------------ISFQSGMGNNYERLEFLGDCFLKMATTISIFTLIPDKAEFEYHVE
TRBP2_XENLA     ----------------------------------------------------------------------
TRBP2_XENTR     ----------------------------------------------------------------------
TRBP2_TETNG     ----------------------------------------------------------------------
TRBP2_HUMAN     ----------------------------------------------------------------------
TRBP2_DANRE     ----------------------------------------------------------------------
TRBP2_BOVIN     ----------------------------------------------------------------------
TRBP2_RAT       ----------------------------------------------------------------------
TRBP2_MOUSE     ----------------------------------------------------------------------
PRKRA_DANRE     ----------------------------------------------------------------------
PRKRA_RAT       ----------------------------------------------------------------------
PRKRA_MOUSE     ----------------------------------------------------------------------
PRKRA_HUMAN     ----------------------------------------------------------------------
PRKRA_BOVIN     ----------------------------------------------------------------------
PRKAB_XENLA     ----------------------------------------------------------------------
PRKAA_XENLA     ----------------------------------------------------------------------
RTL1_ORYSJ      ----------------------------------------------------------------------
SYR_ARCFU       ----YERFINVLGADHKLYGAQLSKI------------LELLG-----LKPPEIIFFEFVSLPEGSMSTR
RELN_RAT        ---------------------------------------------------------QDLDLRGAKFLQY


                         .         .         *         .         .         .         .:140
query           RSKLVKGTTLAQLASSLKMDEYIILGASEQGGHKREKILEDVFEAVIGAIYLDSDFATVKKVILKWYQPI
RNC_FRATM       RSKLVKGTTLAQLASSLKMDEYIILGASEQGGHKREKILEDVFEAVIGAIYLDSDFATVKKVILKWYQPI
RNC_FRATH       RSKLVKGTTLAQLASSLKMDEYIILGASEQGGHKREKILEDVFEAVIGAIYLDSDFATVKKVILKWYQPI
RNC_FRATO       RSKLVKGTTLAQLASSLKMDEYIILGASEQGGHKREKILEDVFEAVIGAIYLDSDFATVKKVILKWYQPI
RNC_FRATF       RSKLVKGTTLAQLASSLKMDEYIILGASEQGGNKREKILEDVFEAVIGAIYLDSDFATVKKVILKWYQPI
RNC_FRATN       RSKLVKGTTLAQLASSLKMDEYIILGASEQGGHKREKILEDVFEAVIGAIYLDSDFATVKKVILKWYQPI
RNC_FRATW       RSKLVKGTTLAQLASSLKMDEYIILGASEQGGHKREKILEDVFEAVIGAIYLDSDFATVKKVILKWYQPI
RNC_FRATT       RSKLVKGATLAQLASSLKMDEYIILGASEQGGHKREKILEDVFEAVIGAIYLDSDFATVKKVILKWYQPI
RNC_FRAT1       RSKLVKGATLAQLASSLKMDEYIILGASEQGGHKREKILEDVFEAVIGAIYLDSDFATVKKVILKWYQPI
RNC_FRAP2       RSKLVKGVTLANLALNFKLDEYIILGASEQGGHKREKILEDVFEAIIGAIYLDSDFATVKKVIVNWYKPV
RNC_WIGBR       RSYLVRGNTLAEIAREFCLGDYLILGIGETGGKNRDSILSNAMEAIIGGIFLDSNINKTHEIVISWYKNR
RNC_SHEAM       RATLVRGDTLAVIAKEFKLGDYLNLGPGESGGFRRESILADAVEAIIGAVYLDADLETCRSLLLGWYETR
RNC_SHESR       RATLVRGDTLTLIAKAFKLGDYLFLGPGESGGFRRESILADAVEAIIGAIYLDSDLEVCRKLLLHWYAER
RNC_SHESM       RATLVRGDTLTLIAKAFKLGDYLFLGPGESGGFRRESILADAVEAIIGAIYLDSDLEVCRKLLLHWYAER
RNC_SHESA       RATLVRGDTLTLIAKAFKLGDYLFLGPGESGGFRRESILADAVEAIIGAIYLDSDLEVCRKLLLHWYAER
RNC_SHEON       RATLVRGDTLTLIAQAFKLGDYLFLGPGESGGFRRESILADAVEAIIGAIYLDSDLEVCRQLLLNWYAER
RNC_SHEB8       RATLVRGDTLTIIAQEFKLGDYLYLGPGESGGFRRESILADAVEAIIGAVYLDSDLEVCRALLLKWYAER
RNC_PASMU       RATLVREPTLASLARQFELGDYLSLGPGESGGFRRESILADCVEAIIGAISLDSDLATTTKIVQHWYQAQ
RNC_HAMD5       RATLVRGDTLTEIAREFDIGAYLQLGQGETGGAQRESILADSIEAIIGAIFLDSDIQTVEKTILRWYHKR
RNC_SHESW       RATLVRGDTLTIIAQEFKLGDYLYLGPGESGGFRRESILADAVEAIIGAIYLDSDLEVCRKLLLTWYAER
RNC_SHEPC       RATLVRGDTLTIIAQEFKLGDYLYLGPGESGGFRRESILADAVEAIIGAIYLDSDLEVCRKLLLTWYAER
RNC_SHEB9       RATLVRGDTLTIIAQEFKLGDYLYLGPGESGGFRRESILADAVEAIIGAVYLDSDLEVCRALLLKWYAER
RNC_SHEB5       RATLVRGDTLTIIAQEFKLGDYLYLGPGESGGFRRESILADAVEAIIGAVYLDSDLEVCRALLLKWYAER
RNC_SHEB2       RATLVRGDTLTIIAQEFKLGDYLYLGPGESGGFRRESILADAVEAIIGAVYLDSDLEVCRALLLKWYAER
RNC_BUCBP       RATLVRGHTLAKIAYEFDLGDYLQLGQGESGGFRRESILANTVEALIGSIFLDSNLKTIEKLILKWYKNR
RNC_VIBF1       RATLVRGHTLAELGREFQLGDYLYLGPGESGGFRRDSILADAVEAIIGAIYLDSDTETVRGIILSWYNTR
RNC_SHEPW       RATLVCGKMLAEIAIEFKLGDYLKLGPGESGGFRRESILADAVEAIIGAIYLDSDIEKCRKLVLNWYASR
RNC_SHEPA       RATLVCGKMLAEIAIEFKLGDYLKLGPGESGGFRRESILADAVEAIIGAIYLDSDIENCRQLVLNWYESR
RNC_VIBC3       RATLVRGNTLAELGREFDLGDYLKLGPGESGGFRRDSILADAVEAIIGAIYLDSDLETARRIVLEWYQCR
RNC_SALCH       RATLVRGNTLAELAREFDLGECLRLGPGESGGFRRESILADTMEALIGGVFLDSNIQTVEQLILNWYKTR
RNC_PHOLL       RATLVRGNTLAELAREFELGECLRLGPGESGGYRRESILADTVEALIGAIFLDSDIQSIERIILSWYETR
RNC_SHEHH       RATLVCGKMLAEIAIEFKLGDYLKLGPGESGGFRRESILADAVEAIIGAIYLDSEIEKCRSLVLKWYESR
RNC_PROMH       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGAIFLDSDIQNIENIILKWYENR
RNC_IDILO       RAAIVCGRSLAKLGKKMGLGDFLSLGQGESGGYRRESILADAVEAIIGAIYLDSDMDTIRQVILNWFEPQ
RNC_BUCAT       RATLVRGNTLAEIAYEFDLGEYLKLGQGESGGFRRESILANTVEALIGSIYLDSNIKTVEELILKWYEKR
RNC_BUCAI       RATLVRGNTLAEIAYEFDLGEYLKLGQGESGGFRRESILANTVEALIGSIYLDSNIKTVEELILKWYEKR
RNC_BUCA5       RATLVRGNTLAEIAYEFDLGEYLKLGQGESGGFRRESILANTVEALIGSIYLDSNIKTVEELILKWYEKR
RNC_VIBCM       RATLVRGNTLAELGREFDLGDYLKLGPGESGGFRRDSILADAVEAIIGAIYLDSDLETARSIVLEWYHGR
RNC_VIBCH       RATLVRGNTLAELGREFDLGDYLKLGPGESGGFRRDSILADAVEAIIGAIYLDSDLETARSIVLEWYHGR
RNC_PHOPR       RATLVRGKTLAELGREFELGDYLLLGPGESGGFRRDSILADCVEAIIGAIYLDSDTEQVRKVILSWYQSR
RNC_SHELP       RATLVCGKMLAEIAKEFKLGDYLKLGPGESGGFRRESILADAMEAIIGAIYLDADIETCRTLVLNWYKSR
RNC_HAHCH       RARMVKGVTLAEIAREFDLGEYLRLGSGESGGFRRESILADALESIIGAIYLDAGFEVCADRVLNWFEAR
RNC_PECCP       RATLVRGNTLAEIAREFELGECLRLGPGESGGFRRESILADTVEALIGGIFLDSDIQTIERLILNWYQTR
RNC_BUCCC       RATLVRGNTLAEIATEFSLGKYLQLGQGEKGGFKRESILANAIEAIIASIFLDSNIYTVERIILYWYKNR
RNC_MANSM       RATLVREPTLAILARQFKLGEYMALGHGESGGFRRESILADCVEAIIGAISLDSSLVSATQITLHWYEKL
RNC_VIBSL       RATLVRGHTLAELGREFELGDYLKLGPGESGGFRRDSILADAVEAIIGAVYLDSDTEVVRRIILSWYQSR
RNC_SHEDO       RATLVKGETLTLIAKEFKLGDYLFLGPGESGGFRRESILADAVEAIIGAVYLDANMQACETLLLSWYKVR
RNC_PSYIN       RATLVCGKMLAEIGREFQLGDCLILGPGESGGFRRDSIIADGVEAIIGAAFLDSDIDTVKKLILKWFDSR
RNC_ENT38       RATLVRGNTLAEIAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEQLILNWYQTR
RNC_COLP3       RSSLVKGVTLAEVARDFNLGECLILGPGESGGHHRESILEDAIEAIIGAVYLDSNIECCKALILSWFERR
RNC_VIBPA       RATLVRGHTLAELGREFDLGDYLKLGPGESGGFRRDSILADAVEAIIGAIYLDSDIEKVRSIVLSWYNSR
RNC_SODGM       RATLVRGNTLAEMAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIRTVEKLILDWYRSR
RNC_SHEFN       RATLVKGDTLTIIAKEFKLGDYLYLGPGESGGFRRESILADAVEAIIGAVYLDADIEVCRKLLLSWYQER
RNC_ERWCT       RATLVRGNTLAEIAREFELGECLRLGPGESGGFRRESILADTVEALIGGIFLDSDILNIERLILNWYQTR
RNC_VIBVY       RATLVRGNTLAELGREFGLGDYLKLGPGESGGFRRDSILADAVEAIIGAVYLDSDLEVVRGIVLNWYASR
RNC_VIBVU       RATLVRGNTLAELGREFGLGDYLKLGPGESGGFRRDSILADAVEAIIGAVYLDSDLEVVRGIVLNWYTSR
RNC_VIBHB       RATLVRGHTLAELGREFDLGDYLKLGPGESGGFRRDSILADAVEAIIGAIYLDSDIEAVRGIVLSWYNSR
RNC_EDWI9       RATLVRGNTLAEMAREFDLGECLRLGPGESGGFRRESILADTVEALIGGIFLDSDIQTIERLILDWYRSR
RNC_YERPS       RATLVRGNTLAEMAREFDLGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIHTIERLILEWYHSR
RNC_YERPP       RATLVRGNTLAEMAREFDLGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIHTIERLILEWYHSR
RNC_YERPN       RATLVRGNTLAEMAREFDLGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIHTIERLILEWYHSR
RNC_YERPG       RATLVRGNTLAEMAREFDLGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIHTIERLILEWYHSR
RNC_YERPE       RATLVRGNTLAEMAREFDLGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIHTIERLILEWYHSR
RNC_YERPA       RATLVRGNTLAEMAREFDLGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIHTIERLILEWYHSR
RNC_YERP3       RATLVRGNTLAEMAREFDLGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIHTIERLILEWYHSR
RNC_YERE8       RATLVRGNTLAEMAREFDLGECLRLGPGESGGFRRESILADTVEALIGGIFLDSDIHTIERLILAWYHSR
RNC_HAEIN       RATLVREPTLAILARQFELGDYMSLGSGENGGFRRESILADCVEAIIGAMSLDQGLAVTTQVIRNWYQQL
RNC_SHISS       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_SHIFL       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_SHIF8       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_SHIDS       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_SHIBS       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_SHIB3       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_ESCF3       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_ECOUT       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_ECOSM       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_ECOSE       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_ECOLU       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_ECOLI       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_ECOLC       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_ECOL6       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_ECOL5       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_ECOK1       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_ECOHS       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_ECODH       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_ECOBW       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_ECO8A       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_ECO81       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_ECO7I       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_ECO5E       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_ECO57       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_ECO55       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_ECO45       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_ECO27       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_ECO24       RATLVRGNTLAELAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTR
RNC_BUCAP       RATLVRGNTLAEIAYEFXXXXXXXXXXXKSGGFRRESILANTVEALIGSIYLDSNIKTVEELILKWYEKR
RNC_SERP5       RATLVRGNTLAEMGREFDLGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQTVERLILDWYRSR
RNC_HAEIG       RATLVREPTLAILARQFELGDYMSLGSGENGGFRRESILADCVEAIIGAMSLDQGLAVTTQVIRNWYQQL
RNC_PSEPG       RARLVKGETLARLARGFDLGEYLRLGSGESGGFRRESILADALEALIGAIYLDADMDTARERVLAWLADE
RNC_BLOPB       RANLVRENTLATLAREFNLGDYLQLGQGESGGYQRESILANTIEALIGGIFLDSNIQTIEILIINWYKIR
RNC_HAEIE       RATLVREPTLAILARQFELGDYMSLGSGENGGFRRESILADCVEAIIGAMSLDQGLAVTTQVIRNWYQQL
RNC_HAEI8       RATLVREPTLAILARQFELGDYMSLGSGENGGFRRESILADCVEAIIGAMSLDQGLAVTTQVIRNWYQQL
RNC_BLOFL       RSSLVCSRTLVELAKEFKLGNCLKLGQGENKGYNRESILADTVEAIIGGIFLDSNIKTIEMLIAFWYQFR
RNC_ACIAD       RATLVRQEALGKIANDLKLSRCLILSTGESGGHHRESILADTVEAIIGAIYVDSDLNLLKNIVLKWYIPY
RNC_METCA       RATLVNETSLARIARELELGEYLILGSGESGGYRRDSILSDALEAILGAVLRDQGIDACRALILTLFERP
RNC_PSEPW       RARLVKGETLARLARGFDLGEYLRLGSGESGGFRRESILADALEALIGAIYLDADMQTARERVLAWLTDE
RNC_PSEF5       RARLVKGETLAVLARGFDLGEYLRLGSGESGGFRRESILADALEALIGAIYLDAGMETARDRVLSWLASE
RNC_KLEP7       RATLVRGNTLAEIAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQNVERLILSWYQTR
RNC_KLEP3       RATLVRGNTLAEIAREFELGECLRLGPGESGGFRRESILADTVEALIGGVFLDSDIQNVERLILSWYQTR
RNC_HAEPS       RAALVKEQTLAVVARQFELGEYMKLGAGESGGYRRESILSDCVEAIIAAVYLDAGIDRAMERVHCWYQQL
RNC_PSESM       RARLVKGETLALLARGFDLGEYLRLGSGESGGFRRESILADALEALIGAIYLDAGMEAARERVLAWLTTE
RNC_PSEPK       RARLVKGETLARLARGFDLGDYLRLGSGESGGFRRESILADALEALIGAIYLDADMDTARERILAWLADE
RNC_PSEP1       RARLVKGETLARLARGFDLGDYLRLGSGESGGFRRESILADALEALIGAIYLDADMDTARERILAWLADE
RNC_PSEMY       RARLVKGETLAVLARGFELGEYLRLGSGESGGFRRESILADALEALIGAIYLDAGMDAARERVLDWLSGE
RNC_HAES2       RATLVKEQTLAVVARQVELGDYLKLGAGESGGFRRESILSDCVEALIAAIYLDAGIDVALARVYQWYQEL
RNC_XYLFT       RSELVRETSLASIARTMQLGEQLILGPGESGGHRRDSILADAVEAVIAAIYLDADLATCRTVVLPWFETA
RNC_XYLF2       RSELVRETSLASIARTMQLGEQLILGPGESGGHRRDSILADAVEAVIAAIYLDADLATCRTVVLPWFETA
RNC_PSEU2       RARLVKGETLALLARGFDLGEYLRLGSGESGGFRRESILADALEALIGAIYLDAGMEAARERVLAWLTTE
RNC_SALTI       RATLVRGNTLAELAREFDLGECLRLGPGESGGFRRESILADTVEALIGGVFLDSNIQTVEQLILNWYKTR
RNC_PSE14       RARLVKGETLALLARGFDLGEYLRLGSGESGGFRRESILADALEALIGAIYLDAGMEAARERVLAWLTTE
RNC_SALTY       RATLVRGNTLAELAREFDLGECLRLGPGESGGFRRESILADTVEALIGGVFLDSNIQTVEQLILNWYKTR
RNC_SALPK       RATLVRGNTLAELAREFDLGECLRLGPGESGGFRRESILADTVEALIGGVFLDSNIQTVEQLILNWYKTR
RNC_SALPA       RATLVRGNTLAELAREFDLGECLRLGPGESGGFRRESILADTVEALIGGVFLDSNIQTVEQLILNWYKTR
RNC_SALG2       RATLVRGNTLAELAREFDLGECLRLGPGESGGFRRESILADTVEALIGGVFLDSNIQTVEQLILNWYKTR
RNC_SALEP       RATLVRGNTLAELAREFDLGECLRLGPGESGGFRRESILADTVEALIGGVFLDSNIQTVEQLILNWYKTR
RNC_NITOC       RATLVKGETLAELARELEIGDHLILGLGESGGYRRTSILADAFEAVIGAVYLDGGLEACRKLVSSLYRDX
RNC_COXBN       RASMVNGDELAQMSTKLGINEYLQLGVGEQGGKRRRSILADALEAIVGAIYIDAGLETCRRCVLNWYGER
RNC_HAEDU       RATLVREQTLAILARQFDLGEYMKLGAGESGGYRRESILSDCVEAIIAAIYLDAGMDKASERIYAWYQTL
RNC_AZOVD       RARLVKGETLALLARGFDLGDHLRLGSGESGGFRRESILADALEALIGAIYLDAGLNTVRERVLGWLAGE
RNC_ACTSZ       RATLVREKTLAELAHQFDLGNYMALGAGESGGFRRASILADCVEAIIGAMSLDSNLPKTMEIVRRWYEVL
RNC_PSEFS       RARLVKGETLAVLARGFGLGEYLRLGSGESGGFRRESILADALEALIGAIYLDAGMEAAKERVTAWLTSE
RNC_ERWT9       RATLVRGNTLAEMAREFDLGECLRLGPGESGGYRRESILADTVEALIGGVFLDSDIQAVEQLILSWYASR
RNC_COXB2       RASMVNGDELAQMSTKLGINEYLQLGVGEQGGKRRRSILADALEAIVGSIYIDAGLETCRRCVLNWYGER
RNC_COXB1       RASMVNGDELAQMSIKLGINEYLQLGVGEQGGKRRRSILADALEAIVGAIYIDAGLETCRRCVLNWYGER
RNC_XYLFA       RSELVRETSLASIARTMQLGEQLILGPGESGGHRRDSILADAVEAVIAAIYLDADLATCRTVVLPWFETA
RNC_PSEE4       RARLVKGETLARLARGFDLGDYLRLGSGESGGFRRESILADALEALIGAIYQDADMQTARERILAWLTDE
RNC_ALHEH       RATLVNGRTLAEIGKGLDVGTALRLGGGESGGQRRKSILADAVEALFGAIYLDGGFDPSRETILRLYRDR
RNC_ACIBY       RATLVRQEALGKIATDLQLSRCLILSTGESGGHHRESILADTVEAIIGAIYLDSDLNLLKDIVLKWYTPY
RNC_ACIBT       RATLVRQEALGKIATDLQLSRCLILSTGESGGHHRESILADTVEAIIGAIYLDSDLNLLKDIVLKWYTPY
RNC_ACTPJ       RATLVREQTLAILARKFGLGEYMKLGAGESGGYRRESILSDCVEAIIAAIYLDAGMDKAIAQVHLWYQDL
RNC_XYLFM       RSELVRETSLASIARTMQLGEQLILGPGESGGHRRDSILADAVEAVIAAIYLDADLATCRTVVLPWFETA
RNC_BORPD       RANLVKQASLADIGQRLELSQYLRLGEGESGGFRRPSILADAVEAIFGAAFLDGGFDTARKVIVRQYQPV
RNC_PSEA7       RARLVKGETLALLARGFEVGDYLRLGSGESGGFRRESILADAMEALIGAIYLDTGMDSARERIIAWLGPQ
RNC_COXBU       RASMVNGDELAQMSTKLGINEYLQLGVGEQGGKRRRSILADALEAIVGAIYIDAGLETCRRCVLNWYGER
RNC_COXBR       RASMVNGDELAQMSTKLGINEYLQLGVGEQGGKRRRSILADALEAIVGAIYIDAGLETCRRCVLNWYGER
RNC_PSEAE       RARLVKGETLALLARGFEVGDYLRLGSGESGGFRRESILADAMEALIGAIYLDTGMDSARERIIAWLGPQ
RNC_PSEAB       RARLVKGETLALLARGFEVGDYLRLGSGESGGFRRESILADAMEALIGAIYLDTGMDSARERIIAWLGPQ
RNC_PSEA8       RARLVKGETLALLARGFEVGDYLRLGSGESGGFRRESILADAMEALIGAIYLDTGMDSARERIIAWLGPQ
RNC_BORPE       RANLVKQASLADIAQRLDLSQYLRLGEGESGGFRRPSILADTVEALFGAVFLDAGFEAARRVIVRQYQPV
RNC_BORPA       RANLVKQASLADIAQRLDLSQYLRLGEGESGGFRRPSILADTVEALFGAVFLDAGFEAARRVIVRQYQPV
RNC_BORBR       RANLVKQASLADIAQRLDLSQYLRLGEGESGGFRRPSILADTVEALFGAVFLDAGFEAARRVIVRQYQPV
RNC_BORA1       RANLVKQASLADIAQRLELSPYLRLGEGESGGFRRPSILADAVEALFGAVFLDAGFDAARKVIEQQYVPV
RNC_ACTP2       RATLVREQTLAILARQFGLGEYMRLGAGESGGYRRESILSDCVEAIIAAIYLDAGMDKAIEQVHLWYQDL
RNC_MARMS       RASLVKGDTLAELAREFELGDYLKLGAGESGGFRRDSILADTVEGIIGAMYLDAGMDVCRQHILAWYKER
RNC_PSEPF       RARLVKGETLAVLARGFDLGDYLRLGSGESGGFRRESILADALEALIGAIYLDAGMEVARERVLAWLAGE
RNC_XANCP       RAELVREGALAVIGRTLNLGERLTLGPGESGGHRRDSILADAVEAIVAAIYLDCGFERCRAVVLPWFEPS
RNC_XANC8       RAELVREGALAVIGRTLNLGERLTLGPGESGGHRRDSILADAVEAIVAAIYLDCGFERCRAVVLPWFEPS
RNC_RALSO       RANLVKQQALYEIAQMLLLPDELRLGEGESGGFRRPSILADALEAIFGAVFLDGGFDAARTLIRKLYIPI
RNC_RALPJ       RANLVKQQALYEIAQMLQLPDALRLGEGESGGFRRPSILADALEAIFGAVFLDGGFDAARTLIRKLYIPI
RNC_PSEHT       RSTLVRGQTLAEFGLEFGLGDYLRLGPGESGGFRRESTLADAVEAIIGAVFLDSDIERCGELILSWYEER
RNC_PSYA2       RATLVRQESLVIIAQNLELSNQLILGVGERGGRNRASILADAVESLIGAIYLDSDMNITRECVLSWYGDL
RNC_XANOR       RAELVREGALAVIGRTLNLGERLTLGPGESGGHRRDSILADAVEAIVAAIYLDCGFERCRAVVLPWFEAS
RNC_NITEU       RANFVNQQALHRLASAXXXXXXXXXXXRKSGGHHRPSILANAVEAIIGAIYLESGFAVVEQVIVALYEPL
RNC_XANAC       RAELVREGALAVIGRTLNLGERLTLGPGESGGHRRDSILADAVEAIVAAIYLDCGFERCRAVVLPWFEAS
RNC_ACIBS       RATLVRQEALGKIATDLQLSRCLILSTGESGGHHRESILADTVEAIIGAIYLDSDLNLLKDIVLKWYTPY
RNC_ALCBS       RASLVRGQTLALVAXXXXXXXXXXXXXXKSGGFRRDSILADALESIIGAMLLDGGEPRCREVVLAWFAPR
RNC_SHEWM       RATLVCGKMLAEIGFEFKLGDYLKLGPGESGGFRRESIIADAVEAIIGAVYLDSDLEVTRSLVLGWYKTR
RNC_ARCB4       RASLVNETGFTRLANEIKLGEYIFISTAEEKGRTKASILSDAFEAIMGAIYLESGLNTLKPIILRILEES
RNC_THIDA       RANLVRQETLAEIAGALRLGDSLRLGEGESGGFRRPSILADALESLFGAVFLDAGFDEAQRVVRRLFDPL
RNC_DECAR       RANLVRQETLHRLALELNIGAFLRLGEGESGGAQRPSILADALEALFGAIYLDAGFEASRAVIEKLFAPL
RNC_RALEJ       RANLVKQQALYEIAQMLQLSEVLRLGEGESGGFRRPSILADALEAIVGAVFLDAGFEAARTLIRKLYIPI
RNC_WOLWR       KTDLVCGNTIANVAKEIKLGSFIIMNNSERGGRCNLKNLENSLEALIGAIYIDGGLENVEKFIIQYWEKL
RNC_WOLPM       KTDLVCGNTIANVAKEIKLGSFIIMNNSERGGRCNLKNLENSLEALIGAIYIDGGLENVEKFIIQYWEKL
RNC_RALEH       RANLVKQQALYEIAQMLQLSDTLRLGEGESGGFRRPSILADALEAIVGAVFLDAGFDAARALIRKLYIPI
RNC_CUPTR       RANLVKQQALYEIAQMLQLSDTLRLGEGESGGFRRPSILADALEAIVGAVFLDAGFDAARALIRKLYIPI
RNC_RALME       RANLVKQQALYEIAQMLQLSDALRLGEGESGGFRRPSILADALEAIVGAVFLDAGFDAARALIRKLYIPI
RNC_CAMFF       RAALVNEKSFASISSQIRLGDFLYLSAAEDNNNGRNKLVSDALEALMGAIYLESGLEAVKKIFINLLESQ
RNC_RHOFD       RANLVKQDTLHHLALGLGLPEVIRLGEGESGGHKRPSILADALEAVIGAVYLDAGFAVAQGLVRRLFQAV
RNC_DELAS       RANLVKEGTLHQIAXXXXXXXXXXXGESKSGGKQRPSILADAVEALIGAVYLDAGYAAGEKVVHHLFEGV
RNC_LEGPH       RSFLVKGEMLAEIAREIDLGDYLFLGQGESGGFRRTSXXXXXXXXXXXXXYLDGGMIAAKQIILMLYSSR
RNC_LEGPC       RSFLVKGEMLAEIAREIGLGDYLFLGQGESGGFRRTSXXXXXXXXXXXXXYLDGGMTAAKQIILMLYSSR
RNC_LEGPA       RSFLVKGEMLAEIAREIGLGDYLFLGQGESGGFRRTSXXXXXXXXXXXXXYLDGGMTAAKQIILMLYSSR
RNC_VARPS       RANLVKQDTLHRLALELQLSPLLRLGEGESGGPNRPSILADALEALIGAVYLDAGFSAAEALVRRLYESV
RNC_SHESH       RATLVCGKMLAEIGFEFKLGDYLNLGPGESGGFRRESIIADAVEAIIGAVYIDSGVEKCRCLVLSWYESR
RNC_LEGPL       RSFLVKGEMLAEIAREIGLGDYLFLGQGESGGFRRTSXXXXXXXXXXXXXYLDGGMTAAKQIILMLYSSR
RNC_NITEC       RANFVNQDALHQLASAXXXXXXXXXXXRKSGGHQRPSILANAMEAIIGAIYLESGFEKVDQVIVALYDPL
RNC_WOLPP       KTDLVCGSTIANVAKEIELGNFIIMNNSERGGKCNLKNLENSLEALIGAIYIDGGLESVEKFIIRHWEKL
RNC_HYDS0       KSFLISEEFLASLAKSLNFEKYILISKGEEGSNKNPSILCDVFEAFWAAIYIDSGYCKLTKSLFEHHSQI
RNC_AZOSE       RASLVCQDGLHRVALELDLGEYLRLGEGESGGFRRPSILADALEAVFAATFLDQGFAAAKAVIDRLYDPM
RNC_CAMJD       RAALVNEKSFAKIANSLNLGDFIFMSVAEEGGKEKPSILSDALEAIIGAIHLEAGFEFAKTIALRLMEKN
RNC_CAMJE       RAALVNEKSFAKIANSLNLGDFILMSVAEEGGKEKPSILSDALEAIIGAIHLEAGFEFAKTIALRLIEKN
RNC_CAMJR       RAALVNEKSFAKIANSLNLGDFIFMSVAEEGGREKPSILSDALEAIIGAIHLEAGFEFTKTIALRLIEKN
RNC_NEIMA       RASLVNEGVLAEMAAEMNVGDGLYLGAGESGGFRRPSILADAMEAMFAAVSFDADFNTAEKVVRHLFAER
RNC_NEIG2       RASLVNEGVLAEMAAEMNVGDGLYLGAGESGGFRRPSILADAMEAMFAAVSFDADFNTAEKVVRHLFAER
RNC_CAMJ8       RAALVNEKSFAKIANSLNLGDFIFMSVAEEGGKEKPSILSDALEAIIGAIHLEAGFEFAKTIALRLIEKN
RNC_TREDE       KASAVSEDALSKTASKLNISNYLVLGRGEEGGREKKAILADALEAVIGAYYIDSGFKAAQKFVLRLLEST
RNC_THETN       RAEIVCEPSLARCARKIELGSFLRMGKGEEGGRDRDSILADAMEALLAAVYLDGGLEAVRRVILDLFKEI
RNC_NEIMB       RASLVNEGVLAEMAAEMNVGDGLYLGAGESGGFRRPSILADAMEAMFAAVSFDADFNTAEKVVRHLFADR
RNC_HELPS       RASIVSAHGFTKLAKVIALQDYLHISSSEEISNGREKILSSAFEALMAGVYLEAGLAKVQKIIQNLLNRA
RNC_HELP2       RASIVSAHGFTKLAKAIALQDYLRVSSSEEISNGREKILSSAFEALMAGVYLEAGLAKVRKIIQNLLNRA
RNC_NEIG1       RASLVNEGVLAEMAAEMNVGDGLYLGAGESSGFRRPSILADAMEAMFAAVSFDADFNTAEKVVRHLFAER
RNC_HELPY       RASIVSAHGFTKLAKAIALQDYLRVSSSEEISNGREKILSSAFEALMAGVYLEAGLAKVQKIMQNLLNRA
RNC_HELPJ       RASIVSAHGFTKLAKAIALQDYLRVSSSEEISKGREKILSSAFEALMAGVYLEAGLAKVRKIIQNLLNRA
RNC_XANC5       RAELVREGALAVIGRTLNLGERLTLGPGESGGHRRDSILADAVEAIVAAIYLDCGFERCRAVVLPWFEAS
RNC_HELPG       RAAIVSAHGFTKLAKAIALQDYLRVSSSEEISKGREKILSSAFEALMAGVYLEAGLAKVRKIIQNLLNRA
RNC_HELHP       RACIVNEKGFMKLAQSLDLGAYLYISQSEENNNGRQKILSNAFEALIGAIYLESSLTYVQSIIYDLLEYN
RNC_WOLTR       KTDLVCGNTIANVAKEIKLGNFIIMNNSERGGKRXXXXXXXXXXXXIGAIYIDGGFANVKKFVTKWEERA
RNC_WOLSU       RASLVNEKGFAKLAERVSLGRHIFISNAEENNKGREKLLSNAFEATMGAIYLETGLSVVREVVHRLLDEV
RNC_RICFE       RSYLVCKETICVVGTKLTLKDYIIMTHGEEGGRDNPNNIENATEALIAAIYLDSNIETTRNIIGKLWAEF
RNC_DESPS       RAALVNEGHLATMARKINLGYFLCLGKGEDNSKGREKILSCAYEAVIGAIFQDGGYDAVAALVERFFLPV
RNC_HELAH       RASIVSAQGFTKLARAISLQDYLRVSSSEETSKGREKILSSAFEALMAGVYLEAGLDKVRKIMQNLLNRA
RNC_CAMC5       RAALVNEKSFANMARHLQIGEFIHLSTAENGGREKASLLSDAFEAVMGAVYLEAGLDKVREIAVRLLEIC
RNC_STRU0       RSMIVREESLASFSRHCAFEPYIKLGKGEEGGRNRDTILGDLFEAFLGALLLDKGVEEVRRFLNQVMIPQ
RNC_RICAH       RSYLVCKETICVVGTKLTLKDYIIMTYGEEGGRDNPNNIENAMEALIAAIYLDSNIETTRNIIGKLWEEF
RNC_DESDG       RARLVSKPSLAELARELKLDTYLLLGKGEQGGRTRSSVLSDAFEAILGAIFLDGGYAAAGKTVLRWPQ--
RNC_CAMC1       RAALVNEKSFANMARRLKMGEFLRLSQAEEGGREKDSILSDAFEAVMGAIYLEAGLLKVREILLELCYPQ
RNC_ANAMF       RTALVRGSEVVEIARSIGLGELILMSGGERGGSDNPGTLENALEALIGAMYMDGGPEAYRSFIHKHW--L
RNC_NITSB       RASLVNEEGFAKLAQKLDIGKYIFISQAEENNQGRTKLLSNAFEAVMGAIYLEKGLEKVRELSLKLLEEA
RNC_BDEBA       RASIVNEEVLSELALEMGLNKLMQLGKGETGGAQKPRLIASSFEAIVGALYLDGGFEVARSFIRQEFVPL
RNC_RICPR       RSYLVCKETICIVGTKLALKDYIIMTHGEEGGRDNPNNIENATEALIAAIYLDSNIEITHNIIEKLWAEF
RNC_ANAMM       RTALVRGSEVVEIARSIGLGELILMSGGERGGSDNPGTLENALEALIGAMYMDGGPEAYRSFIHKHW--L
RNC_SULNB       RASLVNESGFTLLARKIDLGSYIYLSLAEENNNGRDKLLSNAFEAIIGAVYLEAGLDTAKEISIKLLEEC
RNC_EHRCR       KTALVCGNKLVEVAQSINLGQFIMMSDGERGGINNFRNLENALEALIGAIYLDGGFTAAQDFIYLFWEHS
RNC_NATTJ       RAELVCELSLVKIAEKLDLGKYLRLGKGEDGGRDRRSTLADTVEALIGAVYLQTNYDQTKQLILDLFKDQ
RNC_RICTY       RSYLVCKETICIVGTKLALKDYIIMTHGEEGGRDNPNNIENVTEALIAAIYLDSNIEITHNIIEKLWAEF
RNC_LACLS       RSSIVRTESLANFSRSCGFGEFLRLGHGEEGGRDRETTLENLFEAFLGALFIDQGMDEVRKFIQHVVIPH
RNC_AQUAE       KAYLISEEFFNLLAQKLELHKFIRI----KRGKINETIIGDVFEALWAAVYIDSDANFTRELFYKLFEDI
RNC_LACLA       RSSIVRTESLANFSRSCGFGEFLRLGHGEEGGRDRETTLENLFEAFLGALFIDQGMDEVRKFIQHVVIPH
RNC_LACLM       RSSIVRTESLANFSRSCGFGEFLRLGHGEEGGRDRETTLENLFEAFLGALFIDQGMDEVRKFIQHVVIPH
RNC_RICRS       RSYLVCKETICMVGAKLTLKNYIIMTHGEEGGRDNLNNIENATEALIAAIYLDSNIETTHDIIEKLWAEF
RNC_RICRO       RSYLVCKETICMVGAKLTLKNYIIMTHGEEGGRDNLNNIENATEALIAAIYLDSNIETTHDIIEKLWAEF
RNC_RICAE       RSYLVCKETICMVGAKLTLKNYIIMTHGEEGGRDNLNNIENATEALIAAIYLDSNIETTHDIIEKLWAEF
RNC_RICPU       RSYLVCKETICMVGAKLTLKNYIIMTHGEEGGRDNLNNIENATEALIAAIYLDSNIETTHDIIEKLWAEF
RNC_BORBU       RSYIVSEDSLSNIAREINLGSYILLGRGEESGRNKKGILADAIEAFVGAIYLDSGFSRATEFVVGLFDMY
RNC_RICCK       RSYLVCKETICMVGAKLALKDYIIMTYGEEGGRDNPNNIENATEALIAAIYLDSNIETTHNIIGQLWAEF
RNC_RICM5       RSYLVCKETICMVGAKLTLKNYIIMTHGEEGGRDNLNNIENATEALIAAIYLDSNIETTYDIIEKLWAEF
RNC_RICCN       RSYLVCKETICMVGAKLTLKNYIIMTHGEEGGRDNLNNIENATEALIAAIYLDSNIETTHDIIENLWAEF
RNC_PARUW       RSRLVEASSCVHYIQSLDLSGYLLLGKGERDGRGRESILADLFEAIIGAIYLDGGLQAAKDFLFKNFHQH
RNC_BORGA       RSYIVSEDSLSSIAREIDLGSYILLGRGEESGRNKKGILADAIEAFVGAIYLDSGFSMATEFVVGLFDMY
RNC_FUSNN       KAMIVSEPILAKISRQIGVGKFLMLSRGESGGRNRESILADSFEAILGAVYIDSNLDEARVFALSHIKQY
RNC_BORAP       RSYIVSEDSLSSIAREIDLGSYILLGRGEESGRNKKGILADAIEAFVGAIYLDSGFLIATEFVVGLFDMY
RNC_ENTFA       RAAIVREDSLAKFAKECHFDNYILLGKGEEGGRTRASLLCDLFEAFLGALYLDQKVGAAKKFIEDVIFPK
RNC_CLOTE       RALIVCENSLFSIAKNLELGEYIKMSKGEEGGRERISILADAVEALIASIYLDKGIDVVREFILKNFYNI
RNC_ANAPZ       RIALVRGSKVVEIAQSLNLGNILLMSKGESGGXXXXXXXXXXXXXXXGAIYVDGGLESVRHFILQHWKPL
RNC_STRSV       RSMIVREESLAGFARDCQFDQFIKLGRGEEGGRNRDTILGDLFEAFLGALLLDKGVEAVKSFL---YQVM
RNC_RICBR       RSYLVCKETICVVGAKLGLKNYIIMTHGEEGGRDNPNNIENVTEALIAAIYLDSDITTIHNIIGKLWAEF
RNC_RICB8       RSYLVCKETICVVGAKLGLKNYIIMTHGEEGGRDNPNNIENVTEALIAAIYLDSDITTIHNIIGKLWAEF
RNC_LISMH       RAAIVCEPSLVEFAEAVHFSKYVRLGKGEEGGRTRPALLADVFESFIGALYLDNG---IDKVVTFLERVI
RNC_LISMF       RAAIVCEPSLVEFAEAVHFSKYVRLGKGEEGGRTRPALLADVFESFIGALYLDNG---IDKVVTFLERVI
RNC_LISMC       RAAIVCEPSLVEFAEAVHFSKYVRLGKGEEGGRTRPALLADVFESFIGALYLDNG---IDKVVTFLERVI
RNC_STRS7       RSTIVREESLAGFSRYCSFDAYIKLGKGEEGGRHRDTILGDLFEAFLGALLLDKGIEEVRRFL---NQVM
RNC_MAGSM       RAMLVNTRSLSEVAKDLELGRYLRMGRGESGGREKYSILGNALEALLGAIYLDGGFEAAERVVDRLFAHQ
RNC_LISW6       RAAIVCEPSLVEFAEAIHFSKYIRLGKGEEGGRTRPALLADVFESFIGALYLDNG---IDKVVTFLERVI
RNC_SYMTH       RAAVVCEPSLAERARVLGIGRHMRFGRGEASGRDRDSTLSDAFEAVVGALYLDGGLEAAQRFVLRELGQL
RNC_PELTS       RASVVCEPSLARVARELELGTCLYMGKGEEGGRDRPSILADAFEALLGAVYLDQGLEKAAGLAIKYLAPL
RNC_THELT       KAAIASEEALAQIARDINLGRYMFLGRGEESGRERDSLLADMLEAVVAAVYIDGGLTAVKKVFLSYFAKY
RNC_STRE4       RSTIVREESLAGFSRYCSFDAYIKLGRGEEGGRHRDTILGDLFEAFLGALLLDKGIEEVRRFL---NQVM
RNC_STRCO       RAAVVNSRALAEVGRGLELGSFIRLXXXXXXXXXXDKILADTLEAVIGAVYLDQGLDAASELVHRLFDPL
RNC_LISIN       RAAIVCEPSLVEFAEAVHFSKYVRLGKGEEGGRTRPALLADVFESFIGALYLDNGIDKVVKFLERVIFPI
RNC_STRAW       RAAVVNSRALAEVGRGLELGSFIRLXXXXXXXXXXDKILADTLEAVIGAVYLDQGLEAAGELVHRLFDPL
RNC_LISMO       RAAIVCEPSLVEFAEAVHFSKYVRLGKGEEGGRTRPALLADVFESFIGALYLDNG---IDKVVTFLERVI
RNC_STRZT       RAMIVREESLAGFARDCQFDQFIKLGKGEEGGRNRDTILGDAFEAFLGALLLDKDVAKVKEFI---YQVM
RNC_STRPJ       RAMIVREESLAGFARDCQFDQFIKLGKGEEGGRNRDTILGDAFEAFLGALLLDKDVAKVKEFI---YQVM
RNC_STRPI       RAMIVREESLAGFARDCQFDQFIKLGKGEEGGRNRDTILGDAFEAFLGALLLDKDVAKVKEFI---YQVM
RNC_LACPL       RAAMVCEESFASFARECDFPQYIRLGKGEQKAHERDSLLCDIFESFVGALYLDQGREPVLKFVHQVIFPK
RNC_THEFY       RAAVVNMRALADVARELGIGRYVRLGRGEEGGRDKSSILADTLEALIGAVYLDRGLDEASELVHRLFDPL
RNC_STRZJ       RAMIVREESLAGFARDCQFDQFIKLGKGEEGGRNRDTILGDAFEAFLGALLLDKDVAKVKEFI---YQVM
RNC_STRPS       RAMIVREESLAGFARDCQFDQFIKLGKGEEGGRNRDTILGDAFEAFLGALLLDKDVAKVKEFI---YQVM
RNC_STRPN       RAMIVREESLAGFARDCQFDQFIKLGKGEEGGRNRDTILGDAFEAFLGALLLDKDVAKVKEFI---YQVM
RNC_STRP7       RAMIVREESLAGFARDCQFDQFIKLGKGEEGGRNRDTILGDAFEAFLGALLLDKDVAKVKEFI---YQVM
RNC_CORDI       RASIVSRYGLADIAREINLGQHILLGKGEQDGRSKDSILADTTEALLGAIYLAHGFEIARDTVLRLFKHK
RNC_BACHD       RASIVCEPSLAQLAEELHFGELVLLGKGEEGGRKRPALLADVFESFVGALYLDQGMDAVYLFLERTIYPK
RNC_STRZP       RAMIVREESLAGFARDCQFNQFIKLGKGEEGGRNRDTILGDAFEAFLGALLLDKDVAKVKEFI---YQVI
RNC_RHILW       LNQLVSAETCAAVADELNLHLYIRTGAKKLTGKRMMNVRADVVESLIAAIYLDGGLEVARRFILRYWQG-
RNC_MESFL       RSDIVRQETLSEIAKMIDLGKIIRLGQGESKGYEKPSILSDVYEAVTAAIYLDQ----TEEVLISWIKTI
RNC_CLOBB       RSLIVCENSLYEIAKKLSLGEYIRMSKGEEGGRERMSIQADAVEAVIAAVYLDKGIGFVNDFILLHFEEM
RNC_CHLSY       RAALVSTKGLAECAAQFNLGQYAYLGEDNPGGRSRQKLLADLFEALVGAIYLDQGLETARAFIVPFWQAR
RNC_CHLAA       RAALVSTKGLAECAAQFNLGQYAYLGEDNPGGRSRQKLLADLFEALVGAIYLDQGLETARAFIVPFWQAR
RNC_STRR6       RAMIVREESLAGFARDCQFDQFIKLGKGEEGGRNRDTILGDAFEAFLGALLLDKDVAKVKEFI---YQVM
RNC_STRP4       RAMIVREESLAGFARDCQFDQFIKLGKGEEGGRNRDTILGDAFEAFLGALLLDKDVAKVKEFI---YQVM
RNC_STRP2       RAMIVREESLAGFARDCQFDQFIKLGKGEEGGRNRDTILGDAFEAFLGALLLDKDVAKVKEFI---YQVM
RNC_CORJK       RSGVVNMYALADVARRLGMGDYILLGRGEMGGKDKHSILADSVESMLGAIYLHHGFEVARATVLRLFAEK
RNC_CLOBA       RSLIVCENSLYEIAKKLSLGEYIRMSKGEEGGRERMSIQADAVEAVIAAVYLDKGIGFVNDFILLHFEEM
RNC_CHRVO       RANLVNQNTLAEIAXXXXXXXXXXXXXXXSGGFNRPSILADALEXXXXXXXXXXXXXXXEQVVRRLYNQR
RNC_ANOFW       RAAIVCEPSLVTFAHALSFGDLVLLGKGEEGGRMRPSLLADVFEAFIGALYLDQGIEAVVQFLGKTIFPK
RNC_RHIE6       LNQLVSAETCAAVADELNLHLYIRTGAKKLTGKRMMNVRADVVESLIAAIYLDGGLEVARRFILRYWQG-
RNC_RHIL3       LNQLVSAETCAAVADELNLHLYIRTGAKKLTGKRMMNVRADVVESLIAAIYLDGGLEVARRFILRYWQG-
RNC_CLOAB       RALVVCGMSLHSIGERWQLGKYIRMSHGEEGGRTRVSIIADCVEAVIAAIYLDKGFDTAKNFILREFEGT
RNC_BART1       LNHLVNAQTCADIAREMRLPDMIQVGFEMRNGRRLINMHADVVEALIAVMYLDGGLESVRPFIQKYWQSR
RNC_ROSCS       RAALIRTETLASFARRYDLGSHTLLARGEEGARQRPSLLADTFEAVVAAIFIDQGLDAVRKFLLPLFEET
RNC_SYNWW       RAKVVCEDALAIFARNINLGQYLLLGRGEEGGRKRKSILADAVEAVIGAIYLDQGLETVQRFIIRQLEEL
RNC_SOLUE       KAHLVSAAHLHGVARRLDLGSYLELGRSEEGGRTKKTLLVDGLEAIMAAIYLDGGVDAARAFVATHVAPF
RNC_JANSC       FNALVRKEACADVARQIDLGAAMRLGKSEMGGRRRMALLGDAMEAVIAAVYLDGGFASARDLVLRLWSER
RNC_CARHZ       RSRLVCAESLYELAFKINLDKFLRLGKGEAGGNQRMSNLANAVEAVIGAVYFDCGIEAAFSFITRLYGEK
RNC_AGRT5       LNQLVSAESCAAIGDEMGLHNFIRTGSKKLTGKAMLNVRADVVESLIATLYLDGGLEASRKFILKYWQGR
RNC_RHIEC       LNQLVSAETCAAVADELNLHLYIRTGAKKLTGKRMMNVRADVVESLIAAIYLDGGLEVARRFILRYWQG-
RNC_CLOPE       RALVVCENSLHKVSKNLSLGKYIRMSKGEEGGRERTSIQADALEAVIAAVYLDKGIEVANDFILRNFKDV
RNC_SILPO       FNALVRKETCAEVAREADLGAVLKLGRSESGGRRKLALLGDAMEAVIAAVYRDGGFAAAEAVILRLWGAR
RNC_BACCR       RAAIVCEPSLVRFANELSFGSLVLLGKGEEGGRERPALLADVFEAFIGALYLDQGLETVWEFLKEIVYPK
RNC_BACC4       RAAIVCEPSLVRFANELSFGSLVLLGKGEEGGRERPALLADVFEAFIGALYLDQGLETVWEFLKEIVYPK
RNC_BACC2       RAAIVCEPSLVRFANELSFGSLVLLGKGEEGGRERPALLADVFEAFIGALYLDQGLETVWEFLKEIVYPK
RNC_LACS1       RAAMVRADSFSKFAIECHFNEYIRLGKGEEKGNARQRLLCDIFESFIGALYLDQGKDEVVRFISKVIFPK
RNC_ZYMMO       LNSLVSGASCASIARIVGLPQWLRLGARDDGAAASDNVLGDVMEAMIGAIFLESGIEAAGKLIHKYWAPL
RNC_PEDPA       RAAMVCEASFSDFAKECHFDQYIRLGKGEEGARQRSSLLCDIFESFIGALYLDQGRAAVERFVRIVIFPK
RNC_BACHK       RAAIVCEPSLVRFANELSFGSLVLLGKGEEGGRERPALLADVFEAFIGALYLDQGLETVWGFLKEIVYPK
RNC_BACC3       RAAIVCEPSLVRFANELSFGSLVLLGKGEEGGRERPALLADVFEAFIGALYLDQGLETVWGFLKEIVYPK
RNC_BACC0       RAAIVCEPSLVRFANELSFGSLVLLGKGEEGGRERPALLADVFEAFIGALYLDQGLETVWGFLKEIVYPK
RNC_BACAN       RAAIVCEPSLVRFANELSFGSLVLLGKGEEGGRERPALLADVFEAFIGALYLDQGLETVWGFLKEIVYPK
RNC_BACAC       RAAIVCEPSLVRFANELSFGSLVLLGKGEEGGRERPALLADVFEAFIGALYLDQGLETVWGFLKEIVYPK
RNC_BACAA       RAAIVCEPSLVRFANELSFGSLVLLGKGEEGGRERPALLADVFEAFIGALYLDQGLETVWGFLKEIVYPK
RNC_LACRJ       RAAMVCEDSFSKFAKECHFDQYIRLGHGEEGARERPGLLCDIFESFIGALYLDQGRPAVEKFVQRVIFPK
RNC_LACRD       RAAMVCEDSFSKFAKECHFDQYIRLGHGEEGARERPGLLCDIFESFIGALYLDQGRPAVEKFVQRVIFPK
RNC_BACCQ       RAAIVCEPSLVRFANELSFGSLVLLGKGEEGGRERPALLADVFEAFIGALYLDQGLETVWGFLKEIVYPK
RNC_BACC7       RAAIVCEPSLVRFANELSFGSLVLLGKGEEGGRERPALLADVFEAFIGALYLDQGLETVWGFLKEIVYPK
RNC_BACC1       RAAIVCEPSLVRFANELSFGSLVLLGKGEEGGRERPALLADVFEAFIGALYLDQGLETVWGFLKEIVYPK
RNC_STRA5       RSMIVREESLAGFSRLCGFDHYIKLGKGEEGGRNRDTILGDLFEAFLGALLLDKGVEVVHAFVNKVMIPH
RNC_STRA3       RSMIVREESLAGFSRLCGFDHYIKLGKGEEGGRNRDTILGDLFEAFLGALLLDKGVEVVHAFVNKVMIPH
RNC_STRA1       RSMIVREESLAGFSRLCGFDHYIKLGKGEEGGRNRDTILGDLFEAFLGALLLDKGVEVVHAFVNKVMIPH
RNC_BACWK       RAAIVCEPSLVRFANEMSFGSLVLLGKGEEGGRERPALLADVFEAFIGALYLDQGLETVWGYLKEVVYPK
RNC_STRGC       RSTIVREESLAGFSRDCQFDRFIKLXXXXXXXXXXXTILGDLFEAFLGALLLDKGLEVVKNFI---YQVM
RNC_PHEZH       LASLVNYHACARAAKRAGLQEALRLSASKVGARKSDAVLGDACEALIAALYIDGGLETARAFFLKFWDEE
RNC_OCEIH       RAAIVCEPSLKNFAEELEFGKFLRLGKGEQGGRERPAILADAFEAFLGALYLDQGFDNVLDFLNIHVFPK
RNC_DINSH       YNALVRKETCAEVAREIGLGDVLRLGRSEMGGRRKDALLGDGMEAVIAAVYRDAGFEAAKALILRLWGKR
RNC_CORGL       RASIVSRYGLADIAREIDLGNHILLGKGETEGRSKDSILADTTEALFGAIFRQHGFETARDVILRLFAYK
RNC_BACCZ       RAAIVCEPSLVRFANELSFGGLVLLGKGEEGGRERPALLADVFEAFIGALYLDQGLETVWGFLKEIVYPK
RNC_RHILO       LNALVNAEALSEIAEHIGLPDLIRAGSDVRGGRKRVNLRADALESLIAVLYLDGGLEAARAFIHKYWQPR
RNC_CLOK5       RSLIVCENSLYEVAKKWNIGKYIKMSKGEEGGRERTSILANCVEAIIAAIYIDSGYKKTKQFIIDNFKDI
RNC_CLOK1       RSLIVCENSLYEVAKKWNIGKYIKMSKGEEGGRERTSILANCVEAIIAAIYIDSGYKKTKQFIIDNFKDI
RNC_BACCN       RAAIVCEPSLVRFANELSFGSLVLLGKGEEGGRERPALLADVFEAFIGALYLDQGLDTVWGFLKEIVYPK
RNC_COREF       RASIVSRYGLADIAREINLGEFILLGKGETEGRSKDSILADTTEALLGAIFRQHGYEVARDVVLTLFHHK
RNC_ROSS1       RTALIRTETLAGFAQRYNLGAYVLLARGEEGARQRQALLADTFEAVIAALFLDQGLNAVRTFLLPLFEAE
RNC_PELCD       RSEVVSEKGLTVIGKAICLGDYMRLGKGEEGGRQKSSLLANTMEALLGAVFCDGGFDSVRRVIEALFIPH
RNC_METSB       LADLVRKESCAEVALEWGVEAYVRVGESEQNASVNRAILGDVCESIIGAVFLDGGFAPAQRVVTQAFEPR
RNC_CHLAD       RAALVSTKGLAECAATLNLGQYAFLSRGEDKGRQRSKLLADLFEAVIGAIYLDQGLEAARAFIEPFLHER
RNC_BACLD       RAAIVCEPSLVSLAHELSFGELVLLGKGEEGGRKRPALLADVFEAFIGALYLDQGLEAVVTFLKAYVFPK
RNC_LEUCK       RIAMVQTRSFAHFSRVAHLNEGIRLGKGEEGARDRDSLLEDIWEAFIGALYLDQGFEAVRKFL---DQTL
RNC_PELLD       RAKIVNGKSLAGFARNLDLGIHLIIGADQQRIRTSTSTLADAFEALTGAIYLDRGLDAVREFI---EEQI
RNC_RHOPA       LADLVRKETCADVARSLDLVEGIKLGGAGAGAKLRKSVLGDICEAVIGAIYLDGGYEAASDFVRRWTE--
RNC_BACSU       RAAIVCEPSLVSLAHELSFGDLVLLGKGEEGGRKRPALLADVFEAFIGALYLDQGLEPVESFLKVYVFPK
RNC_PELUB       FASLVNKKKCLEIAKKIELEKYIVLNPKNKKIEIEDKIVADCLEALIGAIYLDKGLNFTERFILNWSEHI
RNC_GEOKA       RAAIVCEPSLVKFANALSFXXXXXXXXXXXXXXXRTRLLADVFEAFIGALYLDQGMDAVIRFLEKTMFPK
RNC_BACA2       RAAIVCEPSLVSLAHELSFGDLVLLGKGEEGGRKRPALLADVFEAFIGALYLDQGLDPVQQFLKVYVFPK
RNC_SYNY3       RSQLVNQNQLAYLARFLHIAPEIRLSQSRDDGQSSPSILADVFESLLGAALLDRGLTAVEDFIQELFVPI
RNC_STAEQ       RATIVCEPSLVIFANKIKLNELILLGKGEEGGRTRPSLISDAFEAFVGALYLDQGLDTVWTFAEKVIFPY
RNC_RHOBA       KSAVVSRRSCGKVACKLGLDQCLIVGRGVTRNRSYPKLVSDVFEAVIAALYIDGGPEIVRDRLKLWLAEE
RNC_RHISN       LNQLVSAESCARVADELSLHEYIRTGSDVKTGKHMMNVRADVVESLIAAIYLDGGLEAARRFVLRHW---
RNC_PHYMT       RAQSVCEDSLVIYAKSIQLQNYILLGKGEKNKNINNSILANAFEALFGAIYLDLGYYIAKKVFILIVIPR
RNC_BARQU       LNGLVNAQTCADIALEMGLPDMIHVGFEMRNGRRLTNMHADVIEALIAVMYLDGGLKSVRPFIRRYWQSR
RNC_DESRM       RASSVCEPSLAKVARGLDLGRCLRMXXXXXXXXXXPSILADAFEALLGAIYLDQGLEISRHFVLNCLSSI
RNC_BRUSU       LNALVNAETCAAIADEIGLADLIHTGSDIKSLNDKRNVRADVVEALIATIYLDGGLEAARSFIQRYWKK-
RNC_BRUSI       LNALVNAETCAAIADEIGLADLIHTGSDIKSLNDKRNVRADVVEALIATIYLDGGLEAARSFIQRYWKK-
RNC_BRUME       LNALVNAETCAAIADEIGLADLIHTGSDIKSLNDKRNVRADVVEALIATIYLDGGLEAARSFIQRYWKK-
RNC_BRUMB       LNALVNAETCAAIADEIGLADLIHTGSDIKSLNDKRNVRADVVEALIATIYLDGGLEAARSFIQRYWKK-
RNC_BRUC2       LNALVNAETCAAIADEIGLADLIHTGSDIKSLNDKRNVRADVVEALIATIYLDGGLEAARSFIQRYWKK-
RNC_BRUAB       LNALVNAETCAAIADEIGLADLIHTGSDIKSLNDKRNVRADVVEALIATIYLDGGLEAARSFIQRYWKK-
RNC_BRUA2       LNALVNAETCAAIADEIGLADLIHTGSDIKSLNDKRNVRADVVEALIATIYLDGGLEAARSFIQRYWKK-
RNC_BRUA1       LNALVNAETCAAIADEIGLADLIHTGSDIKSLNDKRNVRADVVEALIATIYLDGGLEAARSFIQRYWKK-
RNC_THEMA       KSAAASEEVLAMVSRKMNLGKFLFLGKGEEGGRDRDSILADAFEALLAAIYLDQGYEKIKELFEQEFEFY
RNC_THESQ       KSAAASEEVLALVSRKMNLGKFLFLGKGEEGGRDRDSILADAFEALLAAIYLDQGYEKIKELFEQEFEFY
RNC_STAES       RATIVCEPSLVIFANKIKLNELILLGKGEEGGRTRPSLISDAFEAFVGALYLDQGLDSVWTFAEKVIFPY
RNC_RHIME       LNQLVSAESCAKVADELSLHEFIRTGSDVKTGKHMMNVRADVVESLIAAIYLDGGLDAARRFVLEHW---
RNC_CLOB8       RSLIVCENSLYEIAKKINLGSYIRMSKGEEGGRERISIQADAVEAIIAAVYLDKGIGFVRDFILLHF-XX
RNC_STAAB       RATIVCEPSLVIFANKIGLNEMILLGKGEEGGRTRPSLISDVFEAFIGALYLDQGLDIVWKFAEKVIFPH
RNC_SINMW       LNQLVSAESCAKVADELSLHEFIRTGSDVKTGKHMMNVRADVVESLIAAIYLDGGLEAARRFVLEHW---
RNC_GEOSW       RAAIVCEPSLVKFANALSFXXXXXXXXXXXXXXXRTRLLADVFEAFIGALYLDQGMDAVMQFLGQTIFPK
RNC_ANASP       RSALVDEKQLAKFAIEVGLDFKMRLGAIRDGGYQNPNLLSSTFEAVIGAYYLDSNIEAVRAII----EPL
RNC_MYCTU       RASVVNTQALADVARRLGLGVHVLLGRGETGGADKSSILADGMESLLGAIYLQHGMEKAREVILRLFGPL
RNC_MYCBO       RASVVNTQALADVARRLGLGVHVLLGRGETGGADKSSILADGMESLLGAIYLQHGMEKAREVILRLFGPL
RNC_DESVH       RSRLVSKPSLEGVARELRLDMSLRLXXXXXXXXXXXXLLSDALEAMLGAVFLDAGYIAAKGVVMRILGPH
RNC_BARHE       LNSLVNAQTCADIALEMELPVMIHVGFEMKNGRRLTNMYADVIEALIAVIYLDGGLESVRPFIQRYWQSR
RNC_BACSK       RASIVCEPSLARFAEELQFGKLVLLGKGEEGGRTRPALLADVFEAFIGALYMDQGLEPVFMFLARFMYPK
RNC_RHOCA       FNALVRKETCAAVARDIDLGAVLKLGRSESGGRRKDALLGDAMEAVIAAVYLDAGFEXXXXXXXXXXXXX
RNC_EHRCJ       KTALVCGNQLVKVAQSINLGQFIIMSDGERXXXXXXXXXXXXXXXXXXXXYLDGGLTAAQNFIHSFWKH-
RNC_STAHJ       RATIVCEPSLVIFANKIELNQLILLGKGEEGGRTRPSLVSDAFEAFVGALYLDQGLDVVWQFAEKVIFPY
RNC_STAAW       RATIVCEPSLVIFANKIGLNEMILLGKGEEGGRTRPSLISDAFEAFIGALYLDQGLDIVWKFAEKVIFPH
RNC_STAAT       RATIVCEPSLVIFANKIGLNEMILLGKGEEGGRTRPSLISDAFEAFIGALYLDQGLDIVWKFAEKVIFPH
RNC_STAAS       RATIVCEPSLVIFANKIGLNEMILLGKGEEGGRTRPSLISDAFEAFIGALYLDQGLDIVWKFAEKVIFPH
RNC_STAAR       RATIVCEPSLVIFANKIGLNEMILLGKGEEGGRTRPSLISDAFEAFIGALYLDQGLDIVWKFAEKVIFPH
RNC_STAAN       RATIVCEPSLVIFANKIGLNEMILLGKGEEGGRTRPSLISDAFEAFIGALYLDQGLDIVWKFAEKVIFPH
RNC_STAAE       RATIVCEPSLVIFANKIGLNEMILLGKGEEGGRTRPSLISDAFEAFIGALYLDQGLDIVWKFAEKVIFPH
RNC_STAAC       RATIVCEPSLVIFANKIGLNEMILLGKGEEGGRTRPSLISDAFEAFIGALYLDQGLDIVWKFAEKVIFPH
RNC_STAA9       RATIVCEPSLVIFANKIGLNEMILLGKGEEGGRTRPSLISDAFEAFIGALYLDQGLDIVWKFAEKVIFPH
RNC_STAA8       RATIVCEPSLVIFANKIGLNEMILLGKGEEGGRTRPSLISDAFEAFIGALYLDQGLDIVWKFAEKVIFPH
RNC_STAA3       RATIVCEPSLVIFANKIGLNEMILLGKGEEGGRTRPSLISDAFEAFIGALYLDQGLDIVWKFAEKVIFPH
RNC_STAA2       RATIVCEPSLVIFANKIGLNEMILLGKGEEGGRTRPSLISDAFEAFIGALYLDQGLDIVWKFAEKVIFPH
RNC_RHOSK       FNALVRKETCAAVAREVALGDVLKLGRSESGGRRKEALLGDALEAVIAAVYLDAGFEAARQLVLRLWGAR
RNC_RHOS4       FNALVRKETCAAVAREVALGDVLKLGRSESGGRRKEALLGDALEAVIAAVYLDAGFEAARQLVLRLWGAR
RNC_RHOS1       FNALVRKETCAAVAREVALGDVLKLGRSESGGRRKEALLGDALEAVIAAVYLDAGFEAARQLVLRLWGAR
RNC_ROSDO       FNALVRKETCADVAREIDLGAVLRLGRSESGGRRKQALLGDAIEAVIAAVYQDAGFDAARALILRLWGDR
RNC_GEOTN       RAAIVCEPSLVKFANALSFXXXXXXXXXXXXXXXRTRLLADVFEAFIGALYLDQGMDVVLRFLGQTMFPK
RNC_SPHAL       LHVLASGATCAAIAQRLDLPALIRFGAQSDGGRHSDNIAADAIEALIGALFLERGIEAARTFILAQWGAL
RNC_HELMI       RAAVVCEANLADGARRLQLGAWLKLGRGEEGGREKPSILADALEAVIGAIFLSGGIEAARRFIVDLFGDA
RNC_BRAJA       LAELVRKESCADVAKSLGLLDDIKLGSPSADARLRKSVLGDICEAVIGAIFLDGGHAAAAEFVKRWTE--
RNC_AGRVS       LNQLVSAETCAAVADEIQLHRYIRTGADVKKLTDKNNVRADVVESLIAAIYLDAGLEAARAFVLKFWAER
RNC_STAAM       RATIVCEPSLVIFANKIGLNEMILLGKGEEGGRTRPSLISDAFEAFIGALYLDQGLDIVWKFAEKVIFPH
RNC_STAA1       RATIVCEPSLVIFANKIGLNEMILLGKGEEGGRTRPSLISDAFEAFIGALYLDQGLDIVWKFAEKVIFPH
RNC_RHOS5       FNALVRKETCAAVAREVGLGDVLKLGRSEMGGRRKEALLGDALEAVIAAVYLDAGFEAARRLVLRLWGER
RNC_MIMIV       RCKLENSESLFFLAKQSDISSYLLISQNIEVLHGRENIIGGGLEAFVGALYLNIGLGTVKQFLLE-----
RNC_LACF3       RAAMVCEDSFSKFAKECHFDQYIRLGKGEEGARNRASLLCDIFESFIGALYLDQGRQAVEQFIQTVIFPK
RNC_AGRRK       LNQLVSAETCAAVADEMQLHLFIRTGAKKLTGKRMLNVRADVVESLIAALYLDGGLEVARKFILRYWEG-
RNC_DEHSC       XXXXXXXXXXXXXALGINLGKYLYLGRGESKGRFKPANLAGAFEAVLAAIYIDKGMDVTREVIFRLFKTE
RNC_BACV8       RSKIVQRETLNRLAIEIGLDK-LIKYTARQSSH-NSYMCGNAFEALVGAIYLDRGYRACK--YFMEHRII
RNC_GEOSL       KSALVGEETLADLAAAVELGSYXXXXXXXXXXXXXXXXXXXXXXXXXXXMYLDGGMAPVERLVDAWFGPR
RNC_STAS1       RATIVCEPSLVIFANKIQLNDLILLGKGEEGGRTRPSLVSDAFEAFVGALYLDQGLEAVWQFSEQIIFPY
RNC_BARBK       LNGLVNAQTCADIAREIGLPDMVHVGCEMKNGRRLANMHADVVEALIAVIYLDGGLKSVRPFIQRYWQDR
RNC_AZOPC       RSKIVKRDTLDKIAYQLGINHLIMISAKVK-NHKH--IMGNTLEAFIGAIYLDKGYLKTKEFVEK--RII
RNC_LACSS       RAAIVCTKSFSSFSKEAHFDRYIRLGKGEEGARARATLLEDLFEAFNGALFLDQGRDAVVDFVSQVIFPK
RNC_LACAC       RSNIVRTEGFSEFAIECGFQKEIHLGNGEEGARNRKTLLEDVFEAFNGALFLDQGMPAVERFLHLTVYPL
RNC_MYCCT       RSSTVREESLSRIAKDINLGQLIRLGHGETKGYEKQSILADIFEALTAAVYIDQN----EDGLLIWLEQT
RNC_LACJO       RSNIVRTEGFSEFAIECGFPEEINLGKGEEGARKRKTLLEDVFEAFNGALFLDQGMPAVQHFLHLTVYPL
RNC_EHRRW       KTALVCGTKLVEIAQSINLGIFIIMSDGERSXXXXXXXXXXXXXXXXXXXYLDGGLKAAKDFIFLFWK--
RNC_EHRRG       KTALVCGTKLVEIAQSINLGIFIIMSDGERSXXXXXXXXXXXXXXXXXXXYLDGGLKAAKDFIFLFWK--
RNC_VEREI       RANLVRGESLSXCADELQPDE------AGSGGLQHPSILADALEALIGAVYLDAGYASAQALVQRLFQDV
RNC_MYCMS       RASTVREETLFRVAKDINLGALVKLGHGETKGYEKPSILADVFEALTAAIYLDQK----EDGLVTWLGQT
RNC_LEPBL       KSKIVSTPILNSIAXXXXXXXXXXXXXXXSQGKGRRKIAANLFESLVGAIYLDRGFEVAEKFIVQHLLEF
RNC_CHLCH       RAKIVNSKSLACFARSIGLGEHLLLGESAAHYNIRESALADAFESLIGAIYLDAAYGFVDKHIIHH----
RNC_OENOB       RIAMVQSKSFSHFARLAGFNRYIRLGKGEEGARNRDSLLEDIWEAFIGALYKDQGAKAVFTFLNKAFFPA
RNC_LEPBJ       KSKIVSTPILNSIAXXXXXXXXXXXXXXXSQGKGRRKIAANLFESLVGAIYLDRGFEVAEKFIVQHLLEF
RNC_LEPIN       KSRIVSTPILNSIXXXXXXXXXXXXXXXXXNGKGRRKLSANLFESLVGAIYLDQGFEIAEKFILRHLSEF
RNC_LEPIC       KSRIVSTPILNSIXXXXXXXXXXXXXXXXXNGKGRRKLSANLFESLVGAIYLDQGFEIAEKFILRHLSEF
RNC_SPICI       RSKIVREGTLAELVRRMNWAPFLLLGKGETKGYEKNRILADIYESMIAALYLDLGEDVVRTFINNTLIRM
RNC_BIFLO       RAKAVSEDALSAIATKLKVGPYILLGEAEQGGAEKNSILCDIVESLIGATFLEHGIDEARKVIHRLIDDT
RNC_STRT2       RSTIVREESLAGFTKACGFEQYIRLXXXXXXXXXXATILGDLWEAFLGALYLDQGLPAVEKFLNQVMIPQ
RNC_STRT1       RSTIVREESLAGFTKACGFEQYIRLXXXXXXXXXXATILGDLWEAFLGALYLDQGLPAVEKFLNQVMIPQ
RNC_STRTD       RSTIVREESLAGFTKACGFEQYIRLXXXXXXXXXXATILGDLWEAFLGALYLDQGLPAVEKFLNQVMIPQ
RNC_TREPS       KAVLVSTDTLSDIALSLRIDHYXXXXXXXXXXXXRHKILADATEAVIGALFLDSGFKAAEXXXXXXXXXX
RNC_TREPA       KAVLVSTDTLSDIALSLRIDHYXXXXXXXXXXXXRHKILADATEAVIGALFLDSGFKAAEXXXXXXXXXX
RNC_STRPZ       RSMIVREESLAGFSRFCSFDAYIKLXXXXXXXXXXDTILGDLFEAFLGALLLDKGIDAVRRFLKQVMIPQ
RNC_STRPG       RSMIVREESLAGFSRFCSFDAYIKLXXXXXXXXXXDTILGDLFEAFLGALLLDKGIDAVRRFLKQVMIPQ
RNC_STRPD       RSMIVREESLAGFSRFCSFDAYIKLXXXXXXXXXXDTILGDLFEAFLGALLLDKGIDAVRRFLKQVMIPQ
RNC_STRP6       RSMIVREESLAGFSRFCSFDAYIKLXXXXXXXXXXDTILGDLFEAFLGALLLDKGIDAVRRFLKQVMIPQ
RNC_DEHE1       XXXXXXXXXXXXXALGINLGKYLYLGRGEDASKGRFKNLAGAFEAVLAAIYLDKGIDATREVIFRLFKTE
RNC_BACTN       RSKIVQRETLNKLAVEIGLDK--LIKYSTRSSSHNSYMYGNAFEAFIGAIYLDQGYERCKQFM---EQRI
RNC_BACFR       RSKIVQRETLNKLAVEIGLDK--LIKYSTRSSSHNSYMYGNAFEAFIGAIYLDRGYECCKQFMER--RII
RNC_BACFN       RSKIVQRETLNKLAVEIGLDK--LIKYSTRSSSHNSYMYGNAFEAFIGAIYLDRGYECCKQFMER--RII
RNC_STRPF       RSMIVREESLAGFSRFCSFDAYIKLXXXXXXXXXXDTILGDLFEAFLGALLLDKGIDAVRRFLKQVMIPQ
RNC_STRPC       RSMIVREESLAGFSRFCSFDAYIKLXXXXXXXXXXDTILGDLFEAFLGALLLDKGIDAVRRFLKQVMIPQ
RNC_STRPB       RSMIVREESLAGFSRFCSFDAYIKLXXXXXXXXXXDTILGDLFEAFLGALLLDKGIDAVRRFLKQVMIPQ
RNC_STRP8       RSMIVREESLAGFSRFCSFDAYIKLXXXXXXXXXXDTILGDLFEAFLGALLLDKGIDAVRRFLKQVMIPQ
RNC_STRP3       RSMIVREESLAGFSRFCSFDAYIKLXXXXXXXXXXDTILGDLFEAFLGALLLDKGIDAVRRFLKQVMIPQ
RNC_STRP1       RSMIVREESLAGFSRFCSFDAYIKLXXXXXXXXXXDTILGDLFEAFLGALLLDKGIDAVRRFLKQVMIPQ
RNC_LEUMM       RIAMVQTRSFAHFSRMVHLNEGIRLGKGEEGARDRDSLLEDIWEAFIGALYLDQGADVVRQFL-------
RNC_MYXXD       RARVVNEDGLARVARTIPXXXXXXXXXXXXXXXXREKVLADALEAVFGAVFLTSGLDAAVTLVDRYFADL
RNC_MYCPA       RASVVNTQALADVARKXXXXXXXXXXEANTGGADKSSILADGMESLLGAIYLQHGIDTAREVILRLFGAL
RNC_LEIXX       RASLVSSVALAEVAXXXXXXXXXXXXXNQSGGREKASILADTVEAVIGAVYLDAGGDEATALVLRLIGPL
RNC_STRPM       RSMIVREESLAGFSRFCSFDAYIKLXXXXXXXXXXDTILGDLFEAFLGALLLDKGIDAVRRFLKQVMIPQ
RNC_CHLAB       RAALINAVSCCQYTDALGLGEYLLIGKGERIQNERGKAYANLFEAILGAVYLDGGLAPARQITV----PL
RNC_TROWT       RSYIVSGTSIAQIAKELNLGQFMLLGKGEKGGMDKTSLLADLLESLIGAVMVDQGFESARDFVLALVGEK
RNC_TROW8       RSYIVSGTSIAQIAKELNLGQFMLLGKGEKGGMDKTSLLADLLESLIGAVMVDQGFESARDFVLALVGEK
RNC_ONYPE       RAQAVCERSLTIYAHNIELQNYLLLGKGEKNKDFNAKIIADTFEALFGAIYLDLGYLTAKKVFHNIVLPH
RNC_MYCLE       RASVVNTQALAYVARNXXXXXXXXXXETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTL
RNC_CHLTE       RAKIVNRKSLAAFALELQLGEHLIIGADKQKIRTXXXXXXXXXXXXVGAIYLDQGLAGAERFIT---NHV
RNC_CAEEL       RTSLVSNQTQAVVCDDLGFTEFVI-KAPYKTPELKLKDKADLVEAFIGALYVDRGIEHCRAFIRIVFCPR
A464_PBCV1      RTKFVSGKFLSSIALRMGLHNYVIMHQKYRGWNTNPRILEDVFEALMGAIYFDLGINAAKQFFMTTLAKY
RNC_CHLTB       RAALVNAEACFEYTQKLSLGEHLLIGRGEKMQSHRGKIYANLFEAILGAVYLDGGLSPARQIIV----PL
RNC_AYWBP       RAQAVCEKSLTIYAQKIELQNYLLLGKGEKNKDFNAKIMADTFEALFGAIYLDLGYLTAKKVFHNIVLPH
RNC_CHLT2       RAALVNAEACFEYTQKLSLGEHLLIGRGEKMQSHRGKIYANLFEAILGAVYLDGGLSPARQIIV----PL
RNC_CAUCR       LNALVSRETCARVARKAELGPALRLSASSSGGRETDSILAGATEALMAALYQDGGLEAARKVFLDLWNDE
RNC_CAUCN       LNALVSRETCARVARKAELGPALRLSASSSGGRETDSILAGATEALMAALYQDGGLEAARKVFLDLWNDE
RNC_MOUSE       RSSLVNNRTQAKVAEELGMQEYAITNKTKRPVALRTKTLADLLESFIAALYIDKDLEYVHTFMNVCFFPR
RNC_HUMAN       RSSLVNNRTQAKVAEELGMQEYAITNKTKRPVALRTKTLADLLESFIAALYIDKDLEYVHTFMNVCFFPR
RNC_CHLMU       RSALVNAEACFNYTQKLSLGEHLLIGRGEKMQSHRGKIYANLFEAILGAVYLDGGLAPARQIIV----PL
RNC_NITWN       LADLVRKETCIDVAKSLDLQEXXXXXXXXXXXXXXXXXXXDICEAVIGAVYLDGGYAAAAAFVERWLERM
RNC_CHLTR       RAALVNAEACFEYTQKLSLGEHLLIGRGEKMQSHRGKIYANLLEAILGAVYLDGGLSPARQIIV----PL
RNC_CHLTA       RAALVNAEACFEYTQKLSLGEHLLIGRGEKMQSHRGKIYANLLEAILGAVYLDGGLSPARQIIV----PL
RNC_STACT       RATIVCEPSLVIFANKIQLNELILLGKGEEGGRTRPSLVSDAFEAFVGALYLDQGLDAVWQFSEEVIFPH
RNC_MYCS5       RSKLVDKLALFKIAQKLKVEQIIKTGKARXXXXXXXXXXXXXXXALIAAIYLDQGMQSAKDFIKSHFYEI
RNC_CAEBR       RTSLVSNQTQSVVCDDLGFQEFVI-KAPHRKNDLKMKDKADLVEAFIGALYVDKGLEYCRSFIRTVFCPR
RNC_GEOMG       KASLVGEETXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTYEALLAAVYLDGGLGPVERIVEQDFSPL
RNC_AZOC5       LAELVREEACAEVAQDMGLGPYLRLGPGESGARQRRXXXXXXXXXXXXXXYLDGGYEAASALVERFWR--
RNC_SYNFM       RSAIVNERELTRIAXXXXXXXXXXXXXXMTGGRRKXXXXXXXXXXXXXXIYLDGGLDAVLGVIKKLFDVY
RNC_CHLFF       RAALINAVSCCQYTDALGLGEYLLIGKGEQNERGRTSAYANLFEAILGAVYLDGGLAPARQI--------
RNC_STRMU       RSMIVREESLAGFSRNCHFDRYIKLGKGEEGGRQRDTIXXXXXXXXXXXXXXXXXXKAVEAFLNQVVIPK
RNC_MOOTA       RAAVVCEASLVKVAXXXXXXXXXXXXXXEEGGRERPSNLADAMEAIIGSVYLSGGYELARDFVLQIFTPA
DCL4_ORYSJ      RSLAVGNDSLAHLTSAIKFEMYVKLSNSEKDLLEEPKALGDIVESCIGAVLLDSGFNLVWKVMLMLLKPV
RNC_CHLCV       RAALINAVSCCQYTDALGLGEHLLIGKGEQNERGRTSAYANLFEAVLGAVYLDGGLAPARQI--------
PAC1_SCHPO      RAKFVGNESADKFARLYGFDKTLVLSYSAEKDRKSQKVIADTFEAYLGALILDGQEETAFQWVSRLLQPK
DCL1_ORYSJ      RAAAVNNENFARVAVKHKLHVHLRHGSSALGDCKAPKVLGDIVESIAGAIFLDSGYDT--SVVWKVFQPL
RNC_UREPA       RSNMVRSEILSYAAKDLGLTDFLMIGVEQDQSARMEKIYEDIFEAFIGAVAQDQGIKKVEKTLIKYFRE-
RNC_THEP1       KSAAASEEVLAMVSRELNXXXXXXXXXXXTGGRDRDSILADAFEALLAAIYLDQGYHXXXXXXXXXXXXX
DICER_ARATH     RAAAVNNENFARVAVKHKLHLYLRHGSSALGDCKAPKVLGDIVESIAGAIFLDSDTTAAWKVFQPLLQPM
Y346_SYNY3      RAILVSDRTLAGWGELYGLDRFLITPAVLADKNGRVSLMADSFEALLGALYLSGDLSLIRPWLSEHLLAK
RNC_DESVM       RARLVSKPALAXXXXXXXXXXXXXXXXXXXXXXXXXXXLSDALEAMLGAVFLDGGY-EXXXXXXXXXXXX
RNC_NOCFA       RASVVNXXXXXXXXXXXXXXXXXXXXXXXXXXRDKPSILADGMESLLGAVHLQHGIDVARGVVLRLFADL
DCL3A_ORYSJ     RSASVNNENFAQVASGLLLDEYVLEGSSSDGLPKGPKVLGDIVESIAGAILLDTDLDVVWGIFEPLLSPI
DCL2B_ORYSJ     RSASVNNNCYAHAAVKSGLNKHILHSSSEEAGIGLPKVLGDVIESIAGAIYLDSDKEVVWRSMKRLLEPL
RNC_MYCMO       RAKNVCXXXXXXXXXXXXXXXXXXXXXXXEHLRENVKINADLFESFVAAIYLDLGDEKLEEFLKEIFYPY
RNC_CHLPN       RASLVNAKACCRYTTMLGIGDYLLIGKGEQSERGRLSAYANLFESILGAVYLDGGLSPARKL--------
DCL2A_ORYSJ     RSASVNNNCYAHAAVKSGLNKHILHSSSEEAGIGLPKVLGDVIESIAGAIYLDSDKEVVWRSMKRLLEPL
DCL3B_ORYSJ     RSALVSNENFAQIHSHLQITEYVRSNLECQGKEKVPKVLGDIMESIAGAVFIDTDFNV--DMVWEIFEPL
RTL3_ORYSJ      RAANVDKEKLARVAVVHGLHHFLRHKAPNLDGQITDKVLCDVVESLIGAIYCDSNFEIVWQVFQKLADPL
RNC_MYCGE       KIEIVKGENLNRIGMELKLGDFVKL---SNGAELTENTVGDVLEALVGAIYEDMGMKKATEFVEKY----
RNC_CAUSK       LNALVSRETCARVARGAEMGPALRLSASSSGGRETDSIXXXXXXXXXXXXYRDGGLELARRVFLDLWAGE
DCR1_DROME      RSALVNNTIFASLAVRHGFHKFFFVRIQQENGHXXPKALGDVFESIAGAIFLDSNMSL--DVVWHVYSNM
RNC_MYCPN       KIEIVKGENLNRIGKELNFGNFIKLG---KGMPYTETLFGDVLEALVAAIYED-----------------
RNC_THENN       KSAVASEEVLARVSRRLELGKYLFLXXXXXXXXXXDSIXXXXXXXXXXXXXXDQGYQKIKDLFEDEFESY
DCL2_NEOFI      RAMIVQNPRLAKAALDTGLDAYIISEKLERVPAKRQKVLADVVEALIGAAYMDGGHATAQACIRR----L
DICER_BOVIN     RSALVNNTIFASLAVKYDYHKYFQLEKNEMQGMXXPKAMGDIFESLAGAIYMDSGMSTVWQVYYPMMRPL
DCR1_SCHPO      KSFYVCNKSLSYIGFVLNLHKYILIEAFRETASENPKFISDTLEAMICAIFLDSGFS-------------
DCR1_CAEEL      RSALVNNTIFASLAVKFEFQKHFIAMCSERNFDTNPKAMGDIFESVAGAIYLDS----------------
DICER_MOUSE     RSALVNNTIFASLAVKYDYHKYFQLEKNEMQGMXXPKAMGDIFESLAGAIYMDSGMSL--EVVWQVYYPM
DICER_CRIGR     RSALVNNTIFASLAVKYDYHKYFQLEKNEMQGMXXPKAMGDIFESLAGAIYMDSGMSL--EVVWQVYYPM
DCL2_MAGGR      KDRLVSNSRLCKAATALGLDQFIILTAPEPPTNTRKKTLADVTEALIGAAYIEGGMSKALRCILDESRAV
DCL2_ASPFU      RDMIVQNPRLAKAALDTGLDAYIVLGRVPAKRQMSTKVLADVVEALIGAAYVDGGHSTAQACIRRF----
RTL2_ORYSJ      RAANISTEKLARVAETVKQEPEDDLSTVPYGGSKAPKVLADIVEAIAAAVYVDCKFDLEKKVTRWLFEPI
DICER_XENTR     RSALVNNTIFASLAVKYDYHKYFQLEKNEMQGMXXPKAMGDIFESLAGAIYMDSGMSTVWHVYYPMMQPL
DICER_HUMAN     RSALVNNTIFASLAVKYDYHKYFQLEKNEMQGMXXPKAMGDIFESLAGAIYMDSGMSTVWQVYYPMMRPL
DICER_DANRE     RSALVNNTIFASLAVKYDYHKYFQLEKNEMQGMXXPKAMGDIFESLAGAIYMDSGMSTVWQVYYPMMRPL
DICER_CHICK     RSALVNNTIFASLAVKYDYHKYFKAVSPEQGXXXVPKAMGDIFESLAGAIYMDSGMSL--EMVWQVYYPM
DCL2_EMENI      KHAIVNGHLLAFLCMQFK----------------------------------------------------
RNT1_YEAST      RMNLVSNEQIKQWSIMYNFHEFDLKDENSNFQNGKLKLYADVFEAYIGGLMEDNNLPKIRKWLRKLAKPV
DCL2_ASPCL      RDEIVQNPRLTKAALDTGLDAFVITERLERVAGKRQKVLADVVEALIGAAYMDGGHAAAQACIRR-FLPE
DCL2_ASPTN      RDEIVQNNRLARAALDVGLDAFILTKAVEVAGKRSSKVLADVVESLIGAAYMD-----------------
DCL2_ASPOR      RTTIVQNPRLTRAALDAGLDSFIIVGAAPVKRQMSAKVLADVIEALIGAAYLD-----------------
DCL1_ASPFU      KMAMVSNKFLGALSVKLYVEEIETAQAESQGAKDPPKCLPDMVEAYLGAIFVDSDFQVIEAFFERQIKPF
DCL1_NEOFI      KMAMVSNKFLGALSVKLGFHRRIMAFSNAQITHYVEEILPDMVEAYLGAIFVDSDFQVIEVFFERQIKPF
DCL2_PHANO      RTATVNASFLAFRLFETTIDEETI----------------------------------------------
RNC_IIV3        KINLGSKDNLSQIAEDLGM--WTFISATEEARHRKKKLLEDVFEALIGVIYEFTDYQLVYSLLLKLFDPY
DCL2_CRYPA      KDRLVSNARLCRAACDAELDQFLVLAKQDQEPESKRKTLADVVEALIGVSFVD-----------------
DCL1_ASPNC      SNKFLGASQITQYAEEIQTAEGESEGAVDYWTVTKDKCLPDMVEAYVGAVFVDSDFEVIERFFRDYIKPF
DCL4_ARATH      RSLSVNNEALANVAVSFSLKRFL-----------------------------------------------
DCL21_ASPNC     RDEIVQNSXXXXXXXXXXXXXFIMISLTPKQRTMSTKVLADVVEALIGASYIDGGFAAAHACIHR-FLPE
DCL1_ASPCL      KMAMVSNKFLGALAVKLGFHKHIKAFSNPLQAQDPPKCLPDMVEAYLGAIFVDSDFS-------------
DCL1_ASPOR      KMAMVSNKFLGALAVKLGLHEEIQAAENESQGKDPPKCLPDMVEAYLGAAFVDSDFQF--RVVEDFFQRH
DCL1_MAGGR      KMAMVSNQFFGCVAVGLGFHRHLIHMQPALGGHHPPKCLPDILEAYVGALFVDTDYSAVVGFFDRHIKPY
DCL2_NEUCR      KDKLVNNVRLCRASRDFGLDEYIINSASAETRQMSSKMVADVVESLIGAAYMCGGMSTPKSSQFKWQEIE
DCL1_COCIM      KMAMVSNKFLGSVAVRLGLHSHLIEAAELESGDPPDKCLPDMVEAYIGAIFIDSGFS-------------
RNC_IIV6        KIKYASKNQLQMLSESLDMWRFITATYDER-TNKKKPLLEDTFESFFGATWLIDSF--IEDIALKXXXXI
DCL2_COCIM      RTALVNADFLAFLCMNAYREE-------------------------------------------------
DCL_GIALA       KMELVRNEALNYLVQTLGLPQ---LAEFSNNLVAKSKTWADMYEEIVGSIF-------------------
DCL22_ASPNC     KSAFTNNTFLTFIA--------------------------------------------------------
DCL1_ASPTN      KMAMVSNKFLGALAVKLGLHSYFSSALQSQITHXXKVCLPDMVEAYLGAVFVDSNF--------------
DCL1_CRYPA      KMAMVSNQFLGCLAVSLGFHKFILHHHASIGSQIHEKCIPDVLEAYVGAIFVDSDYSVVQQFFHAHVLPF
DCL1_NEUCR      RMLLICNKNLFNNALEIGLEEYIILGKSKDARQRHDKSIADVCEALIGAAYL------------------
DCL1_CHAGB      RMLLICNRNLFNNALEVKLEEHIRSGLTLKKGKRKDKTIADVCEALIGAAYLTAQEQTPPNFDL------
TRBP2_XENLA     ----------------------------------------------------------------------
TRBP2_XENTR     ----------------------------------------------------------------------
TRBP2_TETNG     ----------------------------------------------------------------------
TRBP2_HUMAN     ----------------------------------------------------------------------
TRBP2_DANRE     ----------------------------------------------------------------------
TRBP2_BOVIN     ----------------------------------------------------------------------
TRBP2_RAT       ----------------------------------------------------------------------
TRBP2_MOUSE     -------------------