[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30441.1

[Show Plain Result]


## Summary of Sequence Search
    1::334
    5::333     7e-97  53%  448 aa  SYW_PSEAE RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::332     5e-95  50%  336 aa  SYW_NEIMA RecName: Full=Tryptophanyl-tRNA synthetase;       
   15::333     5e-93  53%  449 aa  SYW_PSEPK RecName: Full=Tryptophanyl-tRNA synthetase;       
    8::335     5e-91  50%  432 aa  SYW_XANAC RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::332     8e-91  48%  336 aa  SYW_NEIMB RecName: Full=Tryptophanyl-tRNA synthetase;       
    7::306     4e-90  53%  431 aa  SYW_XANCP RecName: Full=Tryptophanyl-tRNA synthetase;       
   15::333     4e-90  53%  449 aa  SYW_PSESM RecName: Full=Tryptophanyl-tRNA synthetase;       
   15::332     1e-89  50%  451 aa  SYW_BORPE RecName: Full=Tryptophanyl-tRNA synthetase;       
   15::330     1e-88  50%  451 aa  SYW_BORPA RecName: Full=Tryptophanyl-tRNA synthetase;       
   15::330     1e-88  50%  451 aa  SYW_BORBR RecName: Full=Tryptophanyl-tRNA synthetase;       
    9::336     5e-85  48%  434 aa  SYW_XYLFA RecName: Full=Tryptophanyl-tRNA synthetase;       
    5::332     1e-84  48%  435 aa  SYW_XYLFT RecName: Full=Tryptophanyl-tRNA synthetase;       
    5::304     3e-73  48%  325 aa  SYW_FUSNN RecName: Full=Tryptophanyl-tRNA synthetase;       
    3::319     2e-72  45%  319 aa  SYW_CAMJR RecName: Full=Tryptophanyl-tRNA synthetase;       
    3::319     2e-72  45%  319 aa  SYW_CAMJE RecName: Full=Tryptophanyl-tRNA synthetase;       
    3::319     5e-66  42%  320 aa  SYW_RHOBA RecName: Full=Tryptophanyl-tRNA synthetase;       
    2::325     7e-49  39%  331 aa  SYW_LISMF RecName: Full=Tryptophanyl-tRNA synthetase;       
    2::325     1e-48  39%  331 aa  SYW_LISIN RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::329     1e-48  34%  334 aa  SYW_HAEIN RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::329     4e-48  35%  333 aa  SYW_PASMU RecName: Full=Tryptophanyl-tRNA synthetase;       
    2::325     4e-48  38%  331 aa  SYW_LISMO RecName: Full=Tryptophanyl-tRNA synthetase;       
    4::326     1e-47  34%  330 aa  SYW_DEIRA RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::327     2e-47  36%  328 aa  SYW_WOLSU RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::334     3e-47  36%  346 aa  SYW_CHLTR RecName: Full=Tryptophanyl-tRNA synthetase;       
    3::324     4e-47  36%  329 aa  SYW_BACAN RecName: Full=Tryptophanyl-tRNA synthetase;       
   10::337     7e-47  35%  342 aa  SYW_YERPE RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::334     7e-47  35%  346 aa  SYW_CHLMU RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::329     9e-47  35%  334 aa  SYW_SALTY RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::329     9e-47  35%  334 aa  SYW_SALTI RecName: Full=Tryptophanyl-tRNA synthetase;       
    3::334     3e-46  37%  353 aa  SYW_BORBU RecName: Full=Tryptophanyl-tRNA synthetase;       
    2::327     3e-46  38%  330 aa  SYW_RICFE RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::329     3e-46  35%  334 aa  SYW_KLEAE RecName: Full=Tryptophanyl-tRNA synthetase;       
    4::334     3e-46  37%  344 aa  SYW_CHLPN RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::339     8e-46  34%  342 aa  SYW_HAEDU RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::329     8e-46  35%  334 aa  SYW_ECOLI RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::329     1e-45  35%  334 aa  SYW_SHIFL RecName: Full=Tryptophanyl-tRNA synthetase;       
    2::327     1e-45  38%  330 aa  SYW_RICCN RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::325     1e-45  35%  326 aa  SYW_HELPY RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::329     1e-45  35%  334 aa  SYW_ECOL6 RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::329     1e-45  35%  334 aa  SYW_ECO57 RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::332     2e-45  36%  339 aa  SYW_PROMA RecName: Full=Tryptophanyl-tRNA synthetase;       
    6::331     2e-45  34%  332 aa  SYW_HELHP RecName: Full=Tryptophanyl-tRNA synthetase;       
    2::324     2e-45  34%  328 aa  SYW_BACST RecName: Full=Tryptophanyl-tRNA synthetase;       
    2::330     2e-45  38%  336 aa  SYW_ENTFA RecName: Full=Tryptophanyl-tRNA synthetase;       
    9::333     3e-45  34%  338 aa  SYW_CLOTE RecName: Full=Tryptophanyl-tRNA synthetase;       
    4::333     3e-45  34%  345 aa  SYW_CHLCV RecName: Full=Tryptophanyl-tRNA synthetase;       
    2::327     4e-45  38%  330 aa  SYW_RICTY RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::329     8e-45  36%  334 aa  SYW_BLOFL RecName: Full=Tryptophanyl-tRNA synthetase;       
    2::327     1e-44  38%  330 aa  SYW_RICPR RecName: Full=Tryptophanyl-tRNA synthetase;       
    3::332     2e-44  36%  338 aa  SYW_PROMP RecName: Full=Tryptophanyl-tRNA synthetase;       
    4::329     7e-44  35%  335 aa  SYW_CLOAB RecName: Full=Tryptophanyl-tRNA synthetase;       
    5::329     2e-43  35%  332 aa  SYW_CLOPE RecName: Full=Tryptophanyl-tRNA synthetase;       
    3::321     2e-43  32%  328 aa  SYW_THEMA RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::325     3e-43  33%  326 aa  SYW_HELPJ RecName: Full=Tryptophanyl-tRNA synthetase;       
    2::325     5e-43  36%  328 aa  SYW_RICBR RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::329     5e-43  37%  332 aa  SYW_MYCPU RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::331     6e-43  34%  337 aa  SYW_SYNY3 RecName: Full=Tryptophanyl-tRNA synthetase;       
    4::325     8e-43  34%  329 aa  SYW_STAAW RecName: Full=Tryptophanyl-tRNA synthetase;       
    4::325     8e-43  34%  329 aa  SYW_STAAS RecName: Full=Tryptophanyl-tRNA synthetase;       
    4::325     8e-43  34%  329 aa  SYW_STAAN RecName: Full=Tryptophanyl-tRNA synthetase;       
    4::325     8e-43  34%  329 aa  SYW_STAAM RecName: Full=Tryptophanyl-tRNA synthetase;       
    4::325     8e-43  34%  329 aa  SYW_STAAC RecName: Full=Tryptophanyl-tRNA synthetase;       
   33::378     1e-42  33%  379 aa  SYWM_YEAST RecName: Full=Tryptophanyl-tRNA synthetase,
    4::325     1e-42  34%  329 aa  SYW_STAAR RecName: Full=Tryptophanyl-tRNA synthetase;       
   10::333     1e-42  36%  339 aa  SYW2_STRCO RecName: Full=Tryptophanyl-tRNA synthetase 2;       
    1::337     2e-42  37%  340 aa  SYW_STRP8 RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::337     2e-42  37%  340 aa  SYW_STRP6 RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::337     2e-42  37%  340 aa  SYW_STRP3 RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::337     2e-42  37%  340 aa  SYW_STRP1 RecName: Full=Tryptophanyl-tRNA synthetase;       
    4::328     2e-42  35%  337 aa  SYW_TREPA RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::337     2e-42  36%  340 aa  SYW_STRMU RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::332     3e-42  35%  337 aa  SYW_PROMM RecName: Full=Tryptophanyl-tRNA synthetase;       
    2::324     3e-42  35%  327 aa  SYW_OCEIH RecName: Full=Tryptophanyl-tRNA synthetase;       
   12::309     4e-42  36%  345 aa  SYW_PHOLL RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::337     5e-42  34%  341 aa  SYW_LACLA RecName: Full=Tryptophanyl-tRNA synthetase;       
    2::325     5e-42  32%  330 aa  SYW_BACHD RecName: Full=Tryptophanyl-tRNA synthetase;       
    4::325     7e-42  34%  329 aa  SYW_STAES RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::333     9e-42  34%  338 aa  SYW_VIBPA RecName: Full=Tryptophanyl-tRNA synthetase;       
    4::325     1e-41  34%  329 aa  SYW_STAEQ RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::337     2e-41  35%  341 aa  SYW_STRA5 RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::337     2e-41  35%  341 aa  SYW_STRA3 RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::333     3e-41  34%  338 aa  SYW_VIBF1 RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::330     3e-41  33%  332 aa  SYW_SHEON RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::337     3e-41  34%  341 aa  SYW_STRR6 RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::337     3e-41  34%  341 aa  SYW_STRPN RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::334     3e-41  37%  341 aa  SYW_CLOLO RecName: Full=Tryptophanyl-tRNA synthetase;       
    2::330     1e-40  36%  335 aa  SYW_MYCPE RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::333     1e-40  34%  338 aa  SYW_VIBVU RecName: Full=Tryptophanyl-tRNA synthetase;       
    4::287     1e-40  36%  327 aa  SYW_PORGI RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::333     2e-40  34%  338 aa  SYW_VIBVY RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::333     2e-40  33%  338 aa  SYW_VIBCH RecName: Full=Tryptophanyl-tRNA synthetase;       
   16::339     4e-40  36%  345 aa  SYW_CORGL RecName: Full=Tryptophanyl-tRNA synthetase;       
    7::351     5e-40  34%  355 aa  SYW_BRUSU RecName: Full=Tryptophanyl-tRNA synthetase;       
    7::351     5e-40  34%  355 aa  SYW_BRUME RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::332     1e-39  33%  337 aa  SYW_SYNPX RecName: Full=Tryptophanyl-tRNA synthetase;       
    4::329     2e-39  33%  336 aa  SYW_BUCAP RecName: Full=Tryptophanyl-tRNA synthetase;       
    3::331     5e-39  33%  335 aa  SYW_BUCAI RecName: Full=Tryptophanyl-tRNA synthetase;       
   15::340     9e-39  35%  344 aa  SYW_CAUCR RecName: Full=Tryptophanyl-tRNA synthetase;       
    9::332     2e-38  34%  336 aa  SYW_GLOVI RecName: Full=Tryptophanyl-tRNA synthetase;       
   16::358     3e-38  29%  361 aa  SYWM_SCHPO RecName: Full=Tryptophanyl-tRNA synthetase,
    1::326     3e-38  32%  330 aa  SYW_THEEB RecName: Full=Tryptophanyl-tRNA synthetase;       
    2::325     4e-38  33%  330 aa  SYW_BACSU RecName: Full=Tryptophanyl-tRNA synthetase;       
    6::332     8e-38  32%  333 aa  SYW_BUCBP RecName: Full=Tryptophanyl-tRNA synthetase;       
    7::345     1e-37  34%  350 aa  SYW_BRAJA RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::330     2e-37  33%  335 aa  SYW_ANASP RecName: Full=Tryptophanyl-tRNA synthetase;       
    7::351     2e-37  35%  354 aa  SYW_AGRT5 RecName: Full=Tryptophanyl-tRNA synthetase;       
    6::397     3e-37  31%  400 aa  SYW_RALSO RecName: Full=Tryptophanyl-tRNA synthetase;       
   16::339     6e-37  33%  346 aa  SYW_COREF RecName: Full=Tryptophanyl-tRNA synthetase;       
  322::648     1e-36  33%  650 aa  SYWM_CAEEL RecName: Full=Probable tryptophanyl-tRNA synthetase,
   35::358     2e-36  31%  360 aa  SYWM_BOVIN RecName: Full=Tryptophanyl-tRNA synthetase,
   10::337     4e-36  34%  343 aa  SYW_MYCLE RecName: Full=Tryptophanyl-tRNA synthetase;       
   16::355     7e-36  36%  377 aa  SYWM_DICDI RecName: Full=Tryptophanyl-tRNA synthetase,
   10::333     9e-36  32%  336 aa  SYW_MYCTU RecName: Full=Tryptophanyl-tRNA synthetase;       
   10::333     9e-36  32%  336 aa  SYW_MYCBO RecName: Full=Tryptophanyl-tRNA synthetase;       
    7::304     9e-36  35%  337 aa  SYW_LEIXX RecName: Full=Tryptophanyl-tRNA synthetase;       
    7::331     5e-35  33%  334 aa  SYW_WIGBR RecName: Full=Tryptophanyl-tRNA synthetase;       
    2::326     5e-34  33%  333 aa  SYW_UREPA RecName: Full=Tryptophanyl-tRNA synthetase;       
   33::358     5e-34  30%  360 aa  SYWM_HUMAN RecName: Full=Tryptophanyl-tRNA synthetase,
    2::323     1e-33  32%  327 aa  SYW_THETN RecName: Full=Tryptophanyl-tRNA synthetase;       
    7::352     3e-33  34%  355 aa  SYW_RHILO RecName: Full=Tryptophanyl-tRNA synthetase;       
    3::225     1e-32  37%  346 aa  SYW_MYCPN RecName: Full=Tryptophanyl-tRNA synthetase;       
    2::328     6e-32  31%  331 aa  SYW2_STRAW RecName: Full=Tryptophanyl-tRNA synthetase 2;       
   13::334     1e-31  30%  335 aa  SYW_TROW8 RecName: Full=Tryptophanyl-tRNA synthetase;       
   13::334     2e-31  30%  335 aa  SYW_TROWT RecName: Full=Tryptophanyl-tRNA synthetase;       
    7::331     2e-31  35%  354 aa  SYW_RHIME RecName: Full=Tryptophanyl-tRNA synthetase;       
   37::359     4e-31  28%  360 aa  SYWM_MOUSE RecName: Full=Tryptophanyl-tRNA synthetase,
    4::328     5e-31  30%  336 aa  SYW1_STRCO RecName: Full=Tryptophanyl-tRNA synthetase 1;       
   25::343     2e-30  32%  351 aa  SYW2_DEIRA RecName: Full=Tryptophanyl-tRNA synthetase 2;       
    8::331     3e-30  30%  337 aa  SYW1_STRAW RecName: Full=Tryptophanyl-tRNA synthetase 1;       
    3::394     2e-28  32%  395 aa  SYW_AQUAE RecName: Full=Tryptophanyl-tRNA synthetase;       
    4::348     3e-27  31%  350 aa  SYW_MYCGA RecName: Full=Tryptophanyl-tRNA synthetase;       
    3::232     4e-26  33%  347 aa  SYW_MYCGE RecName: Full=Tryptophanyl-tRNA synthetase;       
   69::354     7e-21  33%  370 aa  SYW_METJA RecName: Full=Tryptophanyl-tRNA synthetase;       
   73::357     2e-15  31%  372 aa  SYW_AERPE RecName: Full=Tryptophanyl-tRNA synthetase;       
   82::354     1e-12  28%  381 aa  SYW_SULTO RecName: Full=Tryptophanyl-tRNA synthetase;       
   82::354     1e-12  29%  381 aa  SYW_SULAC RecName: Full=Tryptophanyl-tRNA synthetase;       
   73::372     1e-12  31%  373 aa  SYW_HYPBU RecName: Full=Tryptophanyl-tRNA synthetase;       
   76::353     4e-12  27%  385 aa  SYW_PYRFU RecName: Full=Tryptophanyl-tRNA synthetase;       
   33::325     2e-11  30%  329 aa  SYY_PICTO RecName: Full=Tyrosyl-tRNA synthetase;       
   75::373     2e-11  31%  374 aa  SYW_PYRCJ RecName: Full=Tryptophanyl-tRNA synthetase;       
   75::348     4e-11  27%  384 aa  SYW_THESM RecName: Full=Tryptophanyl-tRNA synthetase;       
   75::356     4e-11  31%  375 aa  SYW_PYRAE RecName: Full=Tryptophanyl-tRNA synthetase;       
   75::356     6e-11  29%  374 aa  SYW_PYRAR RecName: Full=Tryptophanyl-tRNA synthetase;       
   76::353     1e-10  27%  386 aa  SYW_PYRHO RecName: Full=Tryptophanyl-tRNA synthetase;       
   76::353     1e-10  26%  385 aa  SYW_PYRAB RecName: Full=Tryptophanyl-tRNA synthetase;       
   65::335     1e-10  31%  374 aa  SYW_METKA RecName: Full=Tryptophanyl-tRNA synthetase;       
   81::347     3e-10  28%  380 aa  SYW_SULSO RecName: Full=Tryptophanyl-tRNA synthetase;       
   35::247     4e-10  31%  317 aa  SYY_METBF RecName: Full=Tyrosyl-tRNA synthetase;       
   35::273     7e-10  28%  317 aa  SYY_METMA RecName: Full=Tyrosyl-tRNA synthetase;       
   75::346     7e-10  27%  384 aa  SYW_PYRKO RecName: Full=Tryptophanyl-tRNA synthetase;       
   34::222     1e-09  30%  317 aa  SYY_METBU RecName: Full=Tyrosyl-tRNA synthetase;       
   75::346     1e-09  26%  384 aa  SYW_THEON RecName: Full=Tryptophanyl-tRNA synthetase;       
   38::318     2e-09  29%  323 aa  SYY_ARCFU RecName: Full=Tyrosyl-tRNA synthetase;       
   35::240     3e-09  31%  317 aa  SYY_METAC RecName: Full=Tyrosyl-tRNA synthetase;       
   60::226     6e-09  36%  426 aa  SYW_THEVO RecName: Full=Tryptophanyl-tRNA synthetase;       
   33::254     7e-09  29%  331 aa  SYY_THEVO RecName: Full=Tyrosyl-tRNA synthetase;       
  316::420     3e-08  35%  437 aa  SYW_METAC RecName: Full=Tryptophanyl-tRNA synthetase;       
   65::342     5e-08  30%  380 aa  SYW2_HALSA RecName: Full=Tryptophanyl-tRNA synthetase 2;       
   34::227     8e-08  30%  332 aa  SYY_THEAC RecName: Full=Tyrosyl-tRNA synthetase;       
   38::316     8e-08  30%  319 aa  SYY_METMP RecName: Full=Tyrosyl-tRNA synthetase;       
   60::218     8e-08  32%  426 aa  SYW_THEAC RecName: Full=Tryptophanyl-tRNA synthetase;       
   29::236     1e-07  27%  319 aa  SYY_METTH RecName: Full=Tyrosyl-tRNA synthetase;       
   31::243     1e-07  28%  315 aa  SYY_METMJ RecName: Full=Tyrosyl-tRNA synthetase;       
   31::269     1e-07  29%  313 aa  SYY_METHJ RecName: Full=Tyrosyl-tRNA synthetase;       
   34::239     1e-07  28%  324 aa  SYY_METKA RecName: Full=Tyrosyl-tRNA synthetase;       
   37::317     2e-07  29%  319 aa  SYY_METVS RecName: Full=Tyrosyl-tRNA synthetase;       
   29::317     3e-07  29%  317 aa  SYY_METLZ RecName: Full=Tyrosyl-tRNA synthetase;       
   66::409     3e-07  29%  420 aa  SYW_ARCFU RecName: Full=Tryptophanyl-tRNA synthetase;       
  140::288     9e-07  34%  404 aa  SYY_SYNY3 RecName: Full=Tyrosyl-tRNA synthetase;       
   81::236     9e-07  28%  513 aa  SYW1_HALSA RecName: Full=Tryptophanyl-tRNA synthetase 1;       
   28::228     1e-06  29%  306 aa  SYY_METJA RecName: Full=Tyrosyl-tRNA synthetase;       
  112::250     1e-06  34%  392 aa  SYY_AQUAE RecName: Full=Tyrosyl-tRNA synthetase;       
  128::289     2e-06  30%  413 aa  SYY2_BACSU RecName: Full=Tyrosyl-tRNA synthetase 2;       
   38::263     5e-06  29%  361 aa  SYY_SULAC RecName: Full=Tyrosyl-tRNA synthetase;       
  184::272     5e-06  42%  415 aa  SYY_PROMT RecName: Full=Tyrosyl-tRNA synthetase;       
   38::354     6e-06  29%  360 aa  SYY_SULTO RecName: Full=Tyrosyl-tRNA synthetase;       
  180::274     1e-05  39%  412 aa  SYY_PROMP RecName: Full=Tyrosyl-tRNA synthetase;       
  180::274     1e-05  40%  412 aa  SYY_PROM9 RecName: Full=Tyrosyl-tRNA synthetase;       
  112::251     1e-05  31%  395 aa  SYY_HAEI8 RecName: Full=Tyrosyl-tRNA synthetase;       
   30::250     1e-05  29%  327 aa  SYY_HALSA RecName: Full=Tyrosyl-tRNA synthetase;       
   30::250     1e-05  29%  327 aa  SYY_HALS3 RecName: Full=Tyrosyl-tRNA synthetase;       
  112::251     2e-05  31%  401 aa  SYY_HAEIN RecName: Full=Tyrosyl-tRNA synthetase;       
  163::290     2e-05  30%  417 aa  SYY2_BACLD RecName: Full=Tyrosyl-tRNA synthetase 2;       
   94::348     2e-05  26%  366 aa  SYY_SULSO RecName: Full=Tyrosyl-tRNA synthetase;       
  112::251     2e-05  34%  399 aa  SYY_COXBU RecName: Full=Tyrosyl-tRNA synthetase;       
  184::272     4e-05  38%  415 aa  SYY_SYNSC RecName: Full=Tyrosyl-tRNA synthetase;       
  184::272     4e-05  38%  415 aa  SYY_SYNPX RecName: Full=Tyrosyl-tRNA synthetase;       
  163::272     4e-05  38%  415 aa  SYY_PROMM RecName: Full=Tyrosyl-tRNA synthetase;       
  105::251     4e-05  30%  395 aa  SYY_PASMU RecName: Full=Tyrosyl-tRNA synthetase;       
  172::255     4e-05  42%  402 aa  SYY_GLOVI RecName: Full=Tyrosyl-tRNA synthetase;       
  184::333     5e-05  33%  415 aa  SYY_SYNS9 RecName: Full=Tyrosyl-tRNA synthetase;       
   89::343     5e-05  25%  361 aa  SYY_SULIY RecName: Full=Tyrosyl-tRNA synthetase;       
   89::343     5e-05  25%  361 aa  SYY_SULIN RecName: Full=Tyrosyl-tRNA synthetase;       
   89::343     5e-05  25%  361 aa  SYY_SULIM RecName: Full=Tyrosyl-tRNA synthetase;       
   89::343     5e-05  25%  361 aa  SYY_SULIL RecName: Full=Tyrosyl-tRNA synthetase;       
   89::343     5e-05  25%  361 aa  SYY_SULIK RecName: Full=Tyrosyl-tRNA synthetase;       
   89::343     5e-05  25%  361 aa  SYY_SULIA RecName: Full=Tyrosyl-tRNA synthetase;       
  105::251     5e-05  31%  395 aa  SYY_MANSM RecName: Full=Tyrosyl-tRNA synthetase;       
  112::251     7e-05  32%  401 aa  SYY_LEGPL RecName: Full=Tyrosyl-tRNA synthetase;       
   37::222     7e-05  29%  346 aa  SYY_HALMA RecName: Full=Tyrosyl-tRNA synthetase;       
  238::390     7e-05  28%  400 aa  SYWC_DICDI RecName: Full=Tryptophanyl-tRNA synthetase, cytoplasmic;
  112::251     9e-05  32%  401 aa  SYY_LEGPH RecName: Full=Tyrosyl-tRNA synthetase;       
  112::251     9e-05  32%  401 aa  SYY_LEGPA RecName: Full=Tyrosyl-tRNA synthetase;       
  112::251     9e-05  31%  399 aa  SYY_AZOSE RecName: Full=Tyrosyl-tRNA synthetase;       
  104::252     9e-05  26%  364 aa  SYY_AERPE RecName: Full=Tyrosyl-tRNA synthetase;       
  185::273     1e-04  38%  416 aa  SYY_PROMA RecName: Full=Tyrosyl-tRNA synthetase;       
  168::252     1e-04  35%  396 aa  SYY_HAEDU RecName: Full=Tyrosyl-tRNA synthetase;       
  143::307     1e-04  29%  409 aa  SYY_BORPE RecName: Full=Tyrosyl-tRNA synthetase;       
  143::307     1e-04  29%  409 aa  SYY_BORPA RecName: Full=Tyrosyl-tRNA synthetase;       
  143::307     1e-04  29%  409 aa  SYY_BORBR RecName: Full=Tyrosyl-tRNA synthetase;       
  163::257     1e-04  33%  432 aa  SYY_THET8 RecName: Full=Tyrosyl-tRNA synthetase;       
  163::257     1e-04  33%  432 aa  SYY_THET2 RecName: Full=Tyrosyl-tRNA synthetase;       
  161::269     1e-04  35%  401 aa  SYY_THEMA RecName: Full=Tyrosyl-tRNA synthetase;       
  129::257     1e-04  25%  402 aa  SYY_HELPY RecName: Full=Tyrosyl-tRNA synthetase;       
  118::302     1e-04  29%  405 aa  SYY_DESPS RecName: Full=Tyrosyl-tRNA synthetase;       
  177::327     1e-04  32%  414 aa  SYY_BACSK RecName: Full=Tyrosyl-tRNA synthetase;       
   64::350     1e-04  25%  364 aa  SYW_METTH RecName: Full=Tryptophanyl-tRNA synthetase;       
  124::251     2e-04  27%  395 aa  SYY_PHOPR RecName: Full=Tyrosyl-tRNA synthetase;       
  137::309     2e-04  29%  401 aa  SYY_CAMJE RecName: Full=Tyrosyl-tRNA synthetase;       
  172::256     2e-04  35%  407 aa  SYY_THIFE RecName: Full=Tyrosyl-tRNA synthetase;       
   39::204     2e-04  26%  372 aa  SYY_PYRIL RecName: Full=Tyrosyl-tRNA synthetase;       
   35::325     2e-04  24%  328 aa  SYY_HALLT RecName: Full=Tyrosyl-tRNA synthetase;       
  502::622     2e-04  32%  933 aa  SYI_PEDPA RecName: Full=Isoleucyl-tRNA synthetase;       
  105::241     3e-04  30%  316 aa  SYY2_PYRAE RecName: Full=Tyrosyl-tRNA synthetase 2;       
  370::474     3e-04  32%  491 aa  SYW_METMA RecName: Full=Tryptophanyl-tRNA synthetase;       
  112::251     4e-04  31%  407 aa  SYY_NITOC RecName: Full=Tyrosyl-tRNA synthetase;       
  176::297     4e-04  32%  398 aa  SYY_ANASP RecName: Full=Tyrosyl-tRNA synthetase;       
  112::251     6e-04  32%  396 aa  SYY_FRATT RecName: Full=Tyrosyl-tRNA synthetase;       
   39::363     7e-04  29%  375 aa  SYY_THEON RecName: Full=Tyrosyl-tRNA synthetase;       
  171::255     7e-04  36%  408 aa  SYY_PELCD RecName: Full=Tyrosyl-tRNA synthetase;       
  162::255     7e-04  27%  400 aa  SYY_HELHP RecName: Full=Tyrosyl-tRNA synthetase;       
  176::246     7e-04  36%  398 aa  SYY_ANAVT RecName: Full=Tyrosyl-tRNA synthetase;       
  164::325     0.001  28%  399 aa  SYY_SULDN RecName: Full=Tyrosyl-tRNA synthetase;       
  160::251     0.001  33%  398 aa  SYY_SHEON RecName: Full=Tyrosyl-tRNA synthetase;       
  159::248     0.001  31%  392 aa  SYY_RALSO RecName: Full=Tyrosyl-tRNA synthetase;       
  161::275     0.001  32%  405 aa  SYY_LEPIN RecName: Full=Tyrosyl-tRNA synthetase;       
  161::275     0.001  32%  405 aa  SYY_LEPIC RecName: Full=Tyrosyl-tRNA synthetase;       
  137::255     0.001  31%  401 aa  SYY_CAMJR RecName: Full=Tyrosyl-tRNA synthetase;       
  167::251     0.001  32%  395 aa  SYY2_VIBVY RecName: Full=Tyrosyl-tRNA synthetase 2;       
  167::251     0.001  32%  396 aa  SYY2_VIBVU RecName: Full=Tyrosyl-tRNA synthetase 2;       
   36::255     0.001  31%  400 aa  SYY2_CLOAB RecName: Full=Tyrosyl-tRNA synthetase 2;       
    1::334

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSQKIILTGVTPSGTPHLGNYIGAIKPAIEMIKNDQYKCMYFIADQHSLIKLWDKKLRQQYIYEIAASWL
SYW_PSEAE       -----ILTGITPTGTPHLGNYAGAIRPAILASRRSDVDSFYFLADYHALIKCDDPARIQRSRLEIAATWL
SYW_NEIMA       MSKKRVLTGVTTTGIPHLGNYVGAIRPAVRAAQNPDTESFLFLADYHGIIKCHEPEMIHQSTQAVAATWL
SYW_PSEPK       ---------------PHLGNYAGAIRPAIRASQQPGVDSFYFLADYHALIKCDDPLRIQRSRLEIAATWL
SYW_XANAC       -----VLTGITTSGTPHLGNYVGAIRPAIQASAGADAESFYFLADLHSLIKAQDPARTQRSTLEIAATWL
SYW_NEIMB       MSKKRVLTGVTTTGIPHLGNYVGAIRPAVRAAQNLDTESFLFLADYHGIIKCHEPEMIHQSTQAVAATWL
SYW_XANCP       -----VLTGITPSGTPHLGNYVGAIRPAIQASTATDAESFYFLADLHSLIKAQDPARTQRSTLEIAASWL
SYW_PSESM       ---------------PHLGNYAGAIRPAIVASRQSDVDSFYFLADYHALIKCDDPLRIQRSRLEIAATWL
SYW_BORPE       ---------------PHLGNYAGAIRPAIQASTQPGVDAFFFLADYHALIKCDDPARVARSRLELAATWL
SYW_BORPA       ---------------PHLGNYAGAIRPAIQASTQPGVDAFFFLADYHALIKCDDPARVARSRLELAATWL
SYW_BORBR       ---------------PHLGNYAGAIRPAIQASTQPGVDAFFFLADYHALIKCDDPARVARSRLELAATWL
SYW_XYLFA       -----VLTGITTSGTPHLGNYVXXXXXXXXXXXXXXTESFYFLADLHSLIKVQDPERTQRSTLEIAATWL
SYW_XYLFT       -----VLTGITTSGTPHLGNYVXXXXXXXXXXXXXXTESFYFLADLHSLIKVQDPERTQRSTLEIAATWL
SYW_FUSNN       ------LSGIQPSGILHIGNYFGAMKQFVDL--QDSYDGFYFIADYHSLTSLTKAETLKENTYNIVLDYL
SYW_CAMJR       -----VLTGLQPSGDLHIGNYFGAIKQMVDAQEKSQM--FMFIANYHAMTSSQDGEKLKQNSLKAAAAFL
SYW_CAMJE       -----VLTGLQPSGDLHIGNYFGAIKQMVDAQEKSQM--FMFIANYHAMTSSQDGEKLKQNSLKAAAAFL
SYW_RHOBA       -----VLSGIQPTGRPHWGNYFGAIRQYIDLQEDNEG--FYFIADLHALTTVREPEVLRENVMNXXXXXX
SYW_LISMF       --KKVIFSGIQPSGQLTLGNYIGALKQFGQF--QDEYECFYCIVDEHAITVPQDRKLREQ-TRSLAALYL
SYW_LISIN       --KKVIFSGIQPSGQLTLGNYIGALKQFGQF--QDEYECFYCIVDEHAITVPQDRKLREQ-TRSLAALYL
SYW_HAEIN       MAKPIVFSGVQPSGELTIGNYLGALRNWVKM--QEDYECIFCVVDLHAITVRQDPVALRKATLDVLALYL
SYW_PASMU       MSKPVVLSGVQPSGELTIGNYLGALRQWVKM--QDDYECLFCIVDLHAITVRQDPESLRKATLDVLALYL
SYW_LISMO       --KKVIFSGIQPSGQLTLGNYIGALKQFGQF--QDEYECFYCIVDEHAITVPQDRKLREQ-TRSLAALYL
SYW_DEIRA       -----VFSGIQPTGDPHIGNYFGAMQNYVRLGEQYGKQSLYCVVDLHAITNAFDPQTLAQKTFDMAVANF
SYW_WOLSU       MIKKRVFSGIQPTGNIHLGNYLGAVKNWVD--SQDEFDNIFCIVNSHAITIKQDPALLRAKTYELAAVLL
SYW_CHLTR       MKKKRVLTGDRPTGKLHLGHWIGSIMNRLQLQNDSRYDCFFIIADLHTLTTKTRKEEILQHIYDVLADWL
SYW_BACAN       ----VIFSGIQPSGTITLGNYLGAMKQFTEL--QNEHDCYFCIVNQHAITVPQDPVQLRKNIRSLAALYV
SYW_YERPE       -SKPIVFSGAQPSGELTIGNYMGALRQWVQM--QDDYDCIYCIVDLHAITARQDPALLRKRTLDTLALYL
SYW_CHLMU       MNKKRVLTGDRPTGKLHLGHWIGSIMNRLQLQNDPRYDCFFIIADLHTLTTKTRKEEVDSHIYDVLADWL
SYW_SALTY       MTKPIVFSGAQPSGELTIGNYMGALRQWVNM--QDDYHCIYCIVDQHAITVRQDAQQLRKATLDTLALYL
SYW_SALTI       MTKPIVFSGAQPSGELTIGNYMGALRQWVNM--QDDYHCIYCIVDQHAITVRQDAQQLRKATLDTLALYL
SYW_BORBU       LKRKVMLTGDRPTGALHLGHYVGSVVNRLKF--QEEYETYFIIADLHTLTTKPDLKSINTIVREMVLDYL
SYW_RICFE       --KKTVLSGVQATGSLHLGNYLGSIRNWVKM--QEEYNCFFFLADLHAITVDIKPSELNNSIMGVLAVYL
SYW_KLEAE       MTKPIVFSGAQPSGELTIGNYMGALRQWVNM--QDDYHCIYCIVDQHAITVRQDPQQLRKATLDTLALYL
SYW_CHLPN       --KKRVLTGDRPTGKLHLGHWVGSIKNRLELQNSPEYDCFFIIADLHTLTT----KIRKEHIYEVLADWL
SYW_HAEDU       MTKSIVFSGVQPSGELTIGNYLGALRNWVTL--QDDYDCLFCIVDLHAITVRQDPIALRKSTLDVLALYL
SYW_ECOLI       MTKPIVFSGAQPSGELTIGNYMGALRQWVNM--QDDYHCIYCIVDQHAITVRQDAQKLRKATLDTLALYL
SYW_SHIFL       MTKPIVFSGAQPSGELTIGNYMGALRQWVNM--QDDYHCIYCIVDQHAITVRQDAQKLRKATLDTLALYL
SYW_RICCN       --KKTVLSGVQATGSLHLGNYLGAIKNWVKM--QEEYNCFFFLADLHAITVDIKPSELNNSIMEVLAVYL
SYW_HELPY       MHKKRVFSGIQPTGQIHLGNYLGAIKHWVEM--QDEYENLFCVVNSHAITLPIDPAFLKSQSYELVKLLL
SYW_ECOL6       MTKPIVFSGAQPSGELTIGNYMGALRQWVNM--QDDYHCIYCIVDQHAITVRQDAQKLRKATLDTLALYL
SYW_ECO57       MTKPIVFSGAQPSGELTIGNYMGALRQWVNM--QDDYHCIYCIVDQHAITVRQDAQKLRKATLDTLALYL
SYW_PROMA       MTKKRVLSGVQPTGAIHIGNWLGAIRNWVSL--QNEYDTYVCVVDLHAITVPHDPQQLKENTLRTAALYV
SYW_HELHP       -SKKRIFSGIQPTGNIHLGNYLGAVRHWVD--SQEQYENIFCVVNSHAITIRQDPQELQNKTYELAGILL
SYW_BACST       ---KTIFSGIQPSGVITIGNYIGALRQFVEL--QHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAAKYL
SYW_ENTFA       ---KTIFSGIQPSGTPTIGNYIGAMKQFIEL--QNEYNCYFCIVDEHAIVPQEPQKLRQQ-IRSLAALYL
SYW_CLOTE       -NKKTIFSGIQPSGNLTIGNYFGALKNWVKL--QDEYNCFYCIVDLHAIVRQVPQELRKRTL-EVLAVYI
SYW_CHLCV       --KKRVLTGDRPTGKLHLGHWVGSIKNRLDLQNNPAYDCFFIIADLHTLTTRVRKEQVDNHIYEVLADWL
SYW_RICTY       --KKTVLSGVQTTGALHLGNYLGSIKNWVKM--QEEYNCFFFLADLHAIIDIKTSELNNS-IMEVLAIYL
SYW_BLOFL       MNKSIVFSGAQPTGKLTIGNYIGSIRHWVEMQKH--YQCIYCIVDLHSITVRNNLCSLHTRSLDTLALYL
SYW_RICPR       --KKTVLSGVQTTGALHLGNYLGSIRNWIKM--QEEYNCFFFLADLHAIIDIKTSELNDA-IMEVLAIYL
SYW_PROMP       -NKKRILSGVQPTGDLHIGNWLGAINNWVEL--QEKHETFLCVVDLHAITTEYDTKQLSKNTLSTAALYI
SYW_CLOAB       -NKKVIFSGIQPSGELTIGNYFGAIKNWVKL--QDEYDCYYCIVDLHAIVKQEAKDLRRRTL-QLIATYI
SYW_CLOPE       --KKIIFSGIKPSGDLTLGNYLGAIKNWTKL--QEEYDCYFCVVDLHAIVKQLPADLRRRTL-EVLAIYI
SYW_THEMA       -----ILSGMRPTGKLHIGHLVGALENWVKL-QEEGNECFYFVADWHALTTHYDDVSKKEYTRDLVRGFL
SYW_HELPJ       MQKKRVFSGIQPTGQIHLGNYLGAIKHWVEL--QDEYENLFCIVNSHAITLPIEPIFLKSQTYELVKLLL
SYW_RICBR       --KKTVLSGVQATGSLHLGNYLGSIRNWVKM--QEEYNCFFFLADLHSIVDIAPSELKRSVI-ETLAIYL
SYW_MYCPU       MNKKTLVSGITSTGKLTLGNYIGAIRNFVKL--QDEFNMFIFVADLHSLTNEIVPSVLRKNIKEIAALYL
SYW_SYNY3       MDKPRILSGVQPTGNLHLGNYLGAIRSWVE--QQQHYDNFFCVVDLHAITVPHNPQTLAQDTLTIAALYL
SYW_STAAW       -----LFSGIQPSGIPTIGNYIGALKQFVD-VQND-YDCYFCIVDQHAITMPQDRKLRKQ-TRQLAAIYL
SYW_STAAS       -----LFSGIQPSGIPTIGNYIGALKQFVD-VQND-YDCYFCIVDQHAITMPQDRKLRKQ-TRQLAAIYL
SYW_STAAN       -----LFSGIQPSGIPTIGNYIGALKQFVD-VQND-YDCYFCIVDQHAITMPQDRKLRKQ-TRQLAAIYL
SYW_STAAM       -----LFSGIQPSGIPTIGNYIGALKQFVD-VQND-YDCYFCIVDQHAITMPQDRKLRKQ-TRQLAAIYL
SYW_STAAC       -----LFSGIQPSGIPTIGNYIGALKQFVD-VQND-YDCYFCIVDQHAITMPQDRKLRKQ-TRQLAAIYL
SYWM_YEAST      -SNATVFSMIQPTGCFHLGNYLGATRVWTDLLKQPGQELIFGVADLHAIVPKPDGEMFRKFRHEAVASIL
SYW_STAAR       -----LFSGIQPSGIPTIGNYIGALKQFVD-VQND-YDCYFCIVDQHAITMPQDRKLRKQ-TRQLAAIYL
SYW2_STRCO      -----VLSGIQPSGSFHLGNYLGAVRQWVDM--QDTHDAFYMVVDLHAITVPQDPKELRENTRVAAAQLL
SYW_STRP8       MTKPIILTGDRPTGKLHLGHYVGSLKNRVFLQNENKYKMFVFLADQQALTDAKESELIQESIGNVALDYL
SYW_STRP6       MTKPIILTGDRPTGKLHLGHYVGSLKNRVFLQNENKYKMFVFLADQQALTDAKESELIQESIGNVALDYL
SYW_STRP3       MTKPIILTGDRPTGKLHLGHYVGSLKNRVFLQNENKYKMFVFLADQQALTDAKESELIQESIGNVALDYL
SYW_STRP1       MTKPIILTGDRPTGKLHLGHYVGSLKNRVFLQNENKYKMFVFLADQQALTDAKESELIQESIGNVALDYL
SYW_TREPA       -----VLTGDRPTGRLHLGHYAGSLGTRLRI--QSEHECFFIIADLHTLTTRHGRAQLAELVRELVLDYL
SYW_STRMU       MSKPIILTGDRPTGKLHLGHYVGSLKNRVLLQNENKYEMFVFLADQQALTDAKESEIIKDSIANVALDYL
SYW_PROMM       MQRPRVLSGVQPTGALHLGNWLGAIRNWVDLSSHDTYVC---VVDLHAITVPHDPERLAEESLSTAALYL
SYW_OCEIH       ---KTIFSGIQPSGTLTLGNYLGAIQQFVEL-QND-YNCYFCIVDEHAITVPQDRLELRKNIKSLAALYI
SYW_PHOLL       -SQKIVFSGAQPSGELTIGNYMGALRQWVKM--QDDYDCIYCIVDQHAITVRQDPKELRKRTLDTLALYL
SYW_LACLA       MTKPTILTGDRPTGKLHIGHYVGSLQNRVKMQNEDKYNMFVFLADQQALTDAKEPELIRQSVGDVALDYL
SYW_BACHD       --KKTVFSGIQPSGTLTLGNYLGAMKHFVSL--QEDYNCYFCIVDQHAITVPQDRLKLRENIRSLAALYL
SYW_STAES       -----LFSGIQPSGIPTIGNYIGALKQFVDV--QDDYECFFCIVDQHAITVPQDRKLRKQ-IRQLAAIYL
SYW_VIBPA       MSKPIVLSGVQPSGELSIGNYLGALRXXXXXXXXXXXXXX--VVDLHAVTVRQDPKALHEATLDALAICL
SYW_STAEQ       -----LFSGIQPSGIPTIGNYIGALKQFVDV--QDDYECFFCIVDQHAITVPQDRKLRKQ-IRQLAAIYL
SYW_STRA5       MTKPIILTGDRPTGKLHIGHYVGSLKNRVLLQNEGSYTLFVFLADQQALTDAKDPQTIVESIGNVALDYL
SYW_STRA3       MTKPIILTGDRPTGKLHIGHYVGSLKNRVLLQNEGSYTLFVFLADQQALTDAKDPQTIVESIGNVALDYL
SYW_VIBF1       MSKPIVLSGVQPSGELSIGNYLGALRXXXXXXXXXXXXXX--VVDLHAITVRQDPKALHEATLDALAICL
SYW_SHEON       MTKPIVLSGAQPSGELTIGNYMGALRQWVAM--QDSHDCLYCVVDLHAITVRQDPQALREACLDTLALYL
SYW_STRR6       MTKPIILTGDRPTGKLHIGHYVGSLKNRVLLQEEDKYDMFVFLADQQALTDAKDPQTIVESIGNVALDYL
SYW_STRPN       MTKPIILTGDRPTGKLHIGHYVGSLKNRVLLQEEDKYDMFVFLADQQALTDAKDPQTIVESIGNVALDYL
SYW_CLOLO       MAKEIILTGDRPTGKLHIGHYVGSLKNRVQLQNSGDYRSFIMIADQQALTDNAPEKIRNSLI-EVALDYL
SYW_MYCPE       ---KTIVSGIQSTNSLTLGNYLGALKNFINL-QNDN-KMFIFIADMHSITVDFNPKELESNRKSVASIYA
SYW_VIBVU       MSKPIVLSGVQPSGELSIGNYLGALRXXXXXXXXXXXXXX--VVDLHAITVRQDPKALHEATLDALAICL
SYW_PORGI       -----VVSGIRPTGNLHLGNYFGAIRSFLDM--QHRYNCFFFIADWHSLTTHPHPDNIVRNVRTILAEYL
SYW_VIBVY       MSKPIVLSGVQPSGELSIGNYLGALRXXXXXXXXXXXXXX--VVDLHAITVRQDPKALHEATLDALAICL
SYW_VIBCH       MSKPIVLSGVQPSGELSIGNYLGALRXXXXXXXXXXXXXX--VVDLHAITVRQDPQALHEATLDALAICL
SYW_CORGL       -----VLSGIQPTADSHLGNYLGAVKQWIDL--QDSYDAFYFIPDLHAIVDQEPEELRNRTISG-AAQLL
SYW_BRUSU       ----LVFSGVQPTGNLHLGNYLGAIKRWVEVQKTEE--CIYCVVDMHALTVSPDPVELMQSTREVTAAFL
SYW_BRUME       ----LVFSGVQPTGNLHLGNYLGAIKRWVEVQKTEE--CIYCVVDMHALTVSPDPVELMQSTREVTAAFL
SYW_SYNPX       MGRPRVLSGVQPTGALHLGNWLGAIRNWVDL--QDTHDTFVCVVDLHAITVPHDPARLADDTLNTAALYL
SYW_BUCAP       -SKPILFSAIQPSGNLTIGNYIGTMRYWSSF--QDDYECLYCIADLHSLTTLNKNFSLKKSILDTLALYL
SYW_BUCAI       LSKPILLSAVQPSGNLTIGNYIGTMRHWSKMQNN--YECLYCIADLHALTIQKNKIHLNKSILDTISFYL
SYW_CAUCR       -----VLSGVQPSGALHLGNYLGALVKFTRL--QHEIDTFIFVADLHAITVWQDPAALAQQTREIAAAYI
SYW_GLOVI       ---KRILSGAQPTGQLHLGNYLGAVRNWVS--EQRQYDSYFCVVDLHALTVPQXXXXXXXXXXXXXXXXX
SYWM_SCHPO      -----VVSGIQPTGIPHIGNYLGSLKQWVQLARTPFSKCFFFVADLHALTVPQDPLKFRQARLDMLAALL
SYW_THEEB       -----MLSGVQPTGSLHLGNYLGAIRNWVA--GQAEYENYFCVVDLHAITVPHDPAELAANTYTVAALYL
SYW_BACSU       --KQTIFSGIQPSGSVTLGNYIGAMKQFVEL--QHDYNSYFCIVDQHAITVPQDRLELRKNIRNLAALYL
SYW_BUCBP       ---KNVFSAVQPSGQLTIGNYIGVLREWILM--QHDFTCFFCIADLHSLTVRRSSAILKNSVLDVVATYL
SYW_BRAJA       -----VFSGVQPTGNLHLGNYLGAIVNFVKM--QETHNCIYCVVDMHAIVDVWGGPVEARNTREVTAAFI
SYW_ANASP       MGKQRVLSGVQPTGNLHLGNYLGAIRNWVEI--QDQYDNFFCVVDLHAITVPHNPXXXXXXXXXXXXXXX
SYW_AGRT5       ----LVFSGVQPTGNLHLGNYLGAIRKFVALQEDND--CIYCVVDMHAITQLVHSDLKAQ-TRSIAAAFI
SYW_RALSO       -----VLSGMRPTGALHLGHYHGVLKNWVRL--QAEYPCFFFVADWHALTTHYESEVIEESVWEMLIDWL
SYW_COREF       -----VLSGIQPTADSHLGNYLGAVKQWIDL--QNSYDAFYFIPDLHAITVDQNPEELRARTVSGAAQLL
SYWM_CAEEL      ----IYFTGIQPTGIPHLGNFFGSIEPWTELQNSKNILMMLSVVDQHSLGPLPANELRQN-THQMTASLI
SYWM_BOVIN      ---KRIFSGIQPTGIPHLGNYLGAIESWVRL-QDEHDSVLYSIVDLHSITVPQDPTILRQSILDMTAALL
SYW_MYCLE       -----IFSGVQPSDSLHLGNALGAITQALQYDHPDEYEAFFCVVDLHAITIAQDPETLWRRTLVTAAQYL
SYWM_DICDI      -----VFSGMQPTSSAHLGNYLGAMGNWLKIQDNEKHKLIFSIVDLHSLTKSLSPKELQSNTISVAINYL
SYW_MYCTU       -----IFSGVQPSDSLHLGNALGAVAQWVGL--QDDHDAFFCVVDLHAITIPQDPEALRRRTLITAAQYL
SYW_MYCBO       -----IFSGVQPSDSLHLGNALGAVAQWVGL--QDDHDAFFCVVDLHAITIPQDPEALRRRTLITAAQYL
SYW_LEIXX       -----LYSGMQPSADSHLGNYVGALLQWKEL--QAAHDAFFSVVDLHAITVAQDPHDLREKTRRTAAQYI
SYW_WIGBR       -----IFSGMQPSGIPTLGNYIGVLRQW--KILQKIYNSIYCIADLHYLTNNKENKILFKRSLDLLAIYL
SYW_UREPA       ---KRLISGIQPTNNLTLGNYLGAIKNFVDL--QDDYEVFLFVADLHSLTNIFDNTDFSTTKRQIIATYL
SYWM_HUMAN      -SKKRVFSGIQPTGILHLGNYLGAIESWVRL--QDEYSVLYSIVDLHSITVPQDPAVLRQSILDMTAVLL
SYW_THETN       ---KRVFSGVQPSGDIHIGNYLGAMRQFVAL--QDDYDCFFCVVDLHALTVPQDPVELKKNTIELAALYM
SYW_RHILO       ----LVFSGVQPTGNLHLGNYLGAIKKFVALQETSD--CIYCVVDLHSLTQLVHEDLADQ-TRSITAAFL
SYW_MYCPN       ---KRALTGIQASGKQHLGNYLGVMQSLIEL--QEQCQLFVFVADLHSITVDFQPQALKQNNFDLVRTLL
SYW2_STRAW      ---KRIFSGVKPTGHLTLGNYLGAVRRWVDV---DQHDALFCVVDLHALTVDHDPARVRRLSRQAATLML
SYW_TROW8       ----VVLSGIQPSGMLHLGNYLGALKSFGRM--QDDYTTYFMLANLHSMTFPQNPEVLRENTIRIAAQCI
SYW_TROWT       ----VVLSGIQPSGMLHLGNYLGALKSFGRM--QDDYTTYFMLANLHSMTFPQNPEVLRENTIRIAAQCI
SYW_RHIME       ----LVFSGVQPTGNLHLGNYLGAIRKFVALQENND--CIYCVVDLHSITAQLVHEDLPGQIRSIAAAFI
SYWM_MOUSE      -----VFSGIQPTGILHLGNYLGAIESWVNL-QEEYDTVIYSIVDLHSITVPQDPTVLQQSILDMTAVLL
SYW1_STRCO      -----VFSGVKPTGHLTLGNYLGAMRAAVDQHRSDALFC---VVDLHALTVDHDPXXXXXXXXXXXXXXX
SYW2_DEIRA      -----VLTGDRPTXXXXXXXXXXSLQNRVRL--QDEAELFVLLADVQALTDHFDRPEQRENVLAVALDYL
SYW1_STRAW      -----VLSGIQPTGSFHLGNYLGAVRQWVAL--QESHDAFYMVVDLHAITVPQDPADXXXXXXXXXXXXX
SYW_AQUAE       -----IVSGMRPTGKLHLGHYFGVIRNWVKL--QEEHECFFFIADWHALTTAYKKELRQSLVKEHAELFL
SYW_MYCGA       -----IISGIQSTGSLHIGNYLGSISKNINL--QNKYQLNLFVANLHTITVDFDPTQARQNIIELVKIYL
SYW_MYCGE       ---KRAITGIQASGRQHLGNFLGVMQGLKQL--QSQYQLFLFVADLHAITVDFEPTMLKDNNLQLVKTLL
SYW_METJA       -----VVSGMMPSGKMHFGH-----KMVVDLLKFYQKYTDNINIPIADLEAYWARNMSFETTKELATNYI
SYW_AERPE       -----VLTGFMPSGKFHFGHKL-TVDQLIYLQKNG-FKVFVAIADAEAFARIGREEAVRIAVEEYIANMI
SYW_SULTO       ---------------PSLGMHIGHLIPFIKWLQDKFNVNLYIITDDEKFMRNPEYTLDQQWAYDNILDII
SYW_SULAC       ---------------PSLGMHIGHLIPFITKWLQEKFKVNVYITDDEKFLRNVDYTLDQEWSYENILDII
SYW_HYPBU       -----LVTGFMPSGKFHFGHKM--VADQIIYYQKLGFEIFVVIADAYAVRRLDRRKIIEIGLYEYVANLI
SYW_PYRFU       -----LYTGRGPSGPMHIGHIIPFFATKWLQEKFDVNLYIQITDDEKFLFKFEDTKY---WAYQNILDII
SYY_PICTO       --------GFEPSGNPHLGTCLLLANKINDMV-NAGIKMTVLLADWHAMV---NDKLNGD-LNEIRKSWL
SYW_PYRCJ       -----LYTGRGPSGPVHIGHMVPWI--LLKWLSDKFGVEVYFMTDDEKFYDDPEMRLEEKWAYENALDVI
SYW_THESM       -----LYTGRGPSGPMHIGHIIPFF--ATKWLQENFGVNLYVITDDEKF--LFKPQLTKRWAYENILDII
SYW_PYRAE       -----LYTGRGPSGPVHIGHMVPWI-----LLKSDKFGLVYFITDDEKFYDDPEMKLEENWAYENALDVI
SYW_PYRAR       -----LYTGRGPSGPVHIGHMVPWI-----LLKSDKFGVVYFMTDDEKFFDDPEMKLEEAWAYENALDVI
SYW_PYRHO       -----LYTGRGPSGPMHIGHIIPFFATKWLQEKFGVNLYIQITDDEKFLFKTFDDTKR--WAYDNILDII
SYW_PYRAB       -----LYTGRGPSGPMHIGHIIPFFATKWLQEKFGVNLYIQITDDEKFLFKFEDTK---HWAYENILDII
SYW_METKA       -----VLSGMMPSGRMHLGHKT-VVDQLVFYQQEMDVKVYVPIADHHARNMDLDRAHREEYVLNYAA--L
SYW_SULSO       ---------------PSLGMHIGHLIPFIKWLQEKFNANLYIITDDEKYMRNPEFTLDQSWAYDNILDII
SYY_METBF       --------GYEPSGKIHMGHVL-TVNKLIDLQKAG-FEITVLLADVHAYL---NRKGTLEEVRKIARCFI
SYY_METMA       --------GYEPSGKIHMGHVL-TVNKLIDLQKAG-FKITVLLADVHAYL---NRKGTLEEVRKIARCFI
SYW_PYRKO       -----LYTGRGPSGPMHIGHIIPFF--ATKWLQENFDVNLYIITDDEKF--LFKEKLSKRWAYENILDII
SYY_METBU       -------TGYEPSGKIHMGHVLTVNK--LLDLQKAGFEITVLLADVHAYLKGTMDEVRKTADYN-KKCFL
SYW_THEON       -----LYTGRGPSGPMHIGHIIPFFATKWLQEKFGVNLYIQITDDEKFLFK--DKLTFEDWAYQNILDII
SYY_ARCFU       --------GYEPSGEIHLGHMMTVQK--LMDLQEAGFEIIVLLADIHAYL---NEKGTFEEIAEVAKVFI
SYY_METAC       --------GYEPSGKIHMGHVL-TVNKLIDLQKAG-FKITVLLADVHAYL---NKKGTLEEVRKIARCFI
SYW_THEVO       -----VMTGLMPSGEMHLGN-----KSAIDQVIYFQKSVSIAVADSYSTRGIPLDKAREIAIEKYILNYI
SYY_THEVO       --------GIEPSGIPHVATAVMWPRKLAEL--QDDIKIYVLLADWHAMIKLHDLDLIRKGGELLKRSFM
SYW_METAC       ----------------------------------------------------------------------
SYW2_HALSA      --EQSIVTGVGPSGPMHLGH---AMVFYFARRLQDEFGARVYVPDEKYWFKDQTPAETGDYLRANLRDLL
SYY_THEAC       --------GIEPSGIPHIATAVMWPRKLAEI--QDDIKVTVLLADWHAMIKLHDLDLIRKGGEILRKTFQ
SYY_METMP       ----IAYIGFEPSGRIHMGHYL-QIRKMIDLQKAG-FKIVILLADLHAYL---NQKGTMDEVRALGEEFE
SYW_THEAC       -----VMTGLMPSGEMHLGN-----KSAIDQVIFFQKRVSIAVADSYSTRGISLERAREVAIEKYILNYI
SYY_METTH       --EPVVYTGYEPSGRIHLGHALTVRK--LRELQDAGFRVKILLADYHAYL---NGKGSMERIRELAKCFL
SYY_METMJ       -----VYTGYEPSGEIHLGHMVTVNK--LMDLQQAGFEVTVLIADLHAFL---NRKGTMEEIRETAEYNR
SYY_METHJ       -----VYAGYEPSGEIHLGHLV-TINKLIDL-RDAGFEVTVLLADLHAFL---NRKGTMEEVKKLAECFE
SYY_METKA       ----VAYVGFEPSGKVHLGHKL-VIDKMIDL-QEAGFHVIILLADLHAYL---NEKGTLEEVRELARCFL
SYY_METVS       --EKIAYIGFEPSGKIHLGHYL-QIKKMIDLQKAG-FKIIILLADLHAYL---NQKGTMEEIEENKKAFE
SYY_METLZ       ---KRVYTGYEPSGEIHLGHLV-TINKLMDM-KAAGFDVVVLIANLHAYL---NRKGTFEQIKELAACIE
SYW_ARCFU       -----VMSGFMPSGLPHFGHKM--TMDEIVWHQSAGGKAFVAIADMHSVRGLWEKTRELGMLY--IKSII
SYY_SYNY3       ----------------------------------------------------------------------
SYW1_HALSA      ------LSGFMPTGDPHIGHKMVFDELIWHQQQGGDAYALIADLEAHSARGL-DWAEIDEHAEDYLLSLL
SYY_METJA       --EKSAYIGFEPSGKIHLGHYL-QIKKMID-LQNAGFDIIILLADLHAYL---NQKGELDEIRKIGKVFE
SYY_AQUAE       ----------------------------------------------------------------------
SYY2_BACSU      ----------------------------------------------------------------------
SYY_SULAC       --------GFEPSGLFHIGWLIWAIKAGVDM--------SILVATWHAMINLEKIKLAGKYALEVLEGF-
SYY_PROMT       ----------------------------------------------------------------------
SYY_SULTO       --------GFEPSGLFHIGWLIWAQKLK-DLVDVGVDMMSILVATWHAWIN--DKKLAGQYAIEVLNAY-
SYY_PROMP       ----------------------------------------------------------------------
SYY_PROM9       ----------------------------------------------------------------------
SYY_HAEI8       ----------------------------------------------------------------------
SYY_HALSA       ---KRVYVGYEPSGVLHLGHLLTANK--LMDLQDAGMEVVVLLADVHAYLN--DKGSFEEIADQMKAQFL
SYY_HALS3       ---KRVYVGYEPSGVLHLGHLLTANK--LMDLQDAGMEVVVLLADVHAYLN--DKGSFEEIADQMKAQFL
SYY_HAEIN       ----------------------------------------------------------------------
SYY2_BACLD      ----------------------------------------------------------------------
SYY_SULSO       -------------------------------------------------------KMAADYAVEVIKNY-
SYY_COXBU       ----------------------------------------------------------------------
SYY_SYNSC       ----------------------------------------------------------------------
SYY_SYNPX       ----------------------------------------------------------------------
SYY_PROMM       ----------------------------------------------------------------------
SYY_PASMU       ----------------------------------------------------------KQQIYKI-----
SYY_GLOVI       ----------------------------------------------------------------------
SYY_SYNS9       ----------------------------------------------------------------------
SYY_SULIY       -------------------------------------------------------KMAADYTVEVIKNY-
SYY_SULIN       -------------------------------------------------------KMAADYTVEVIKNY-
SYY_SULIM       -------------------------------------------------------KMAADYTVEVIKNY-
SYY_SULIL       -------------------------------------------------------KMAADYTVEVIKNY-
SYY_SULIK       -------------------------------------------------------KMAADYTVEVIKNY-
SYY_SULIA       -------------------------------------------------------KMAADYTVEVIKNY-
SYY_MANSM       ----------------------------------------------------------KQQIYKI-----
SYY_LEGPL       ----------------------------------------------------------------------
SYY_HALMA       --------GYAPTGEMHIGHFTTMRKLADFLRAGVDVTVL--IADLHAHLSPFDLLDARSAYYETAIEGM
SYWC_DICDI      ----------------------------------------------------------------------
SYY_LEGPH       ----------------------------------------------------------------------
SYY_LEGPA       ----------------------------------------------------------------------
SYY_AZOSE       ----------------------------------------------------------------------
SYY_AERPE       ----------------------------------------------------------------------
SYY_PROMA       ----------------------------------------------------------------------
SYY_HAEDU       ----------------------------------------------------------------------
SYY_BORPE       ----------------------------------------------------------------------
SYY_BORPA       ----------------------------------------------------------------------
SYY_BORBR       ----------------------------------------------------------------------
SYY_THET8       ----------------------------------------------------------------------
SYY_THET2       ----------------------------------------------------------------------
SYY_THEMA       ----------------------------------------------------------------------
SYY_HELPY       ----------------------------------------------------------------------
SYY_DESPS       ----------------------------------------------------------------------
SYY_BACSK       ----------------------------------------------------------------------
SYW_METTH       -----VVTGMMPSGRMHIGH-----KMIVDQLRYDRMGAEIFIADMEAYVDFEDSRRXXXXXXXXXXXXL
SYY_PHOPR       ----------------------------------------------------------------------
SYY_CAMJE       ----------------------------------------------------------------------
SYY_THIFE       ----------------------------------------------------------------------
SYY_PYRIL       --------GFEISGFIHIGTGVVSMSKVVDLQKAG-VKTQVFLADIHSWLKLGGRKVAVTYYVETFKKII
SYY_HALLT       --------GYEPSGVLHIGHMLTANK--LIDLQEAGFEVTVLLADVHAYLN--DKGSFEEIRHRMRDQFI
SYI_PEDPA       ----------------------------------------------------------------------
SYY2_PYRAE      ----------------------------------------------------------------------
SYW_METMA       ----------------------------------------------------------------------
SYY_NITOC       ----------------------------------------------------------------------
SYY_ANASP       ----------------------------------------------------------------------
SYY_FRATT       ----------------------------------------------------------------------
SYY_THEON       --------GFEISGYIHLGTGLMAGAKIADLQKAG-IKTRIFLADWHSWIN--DKKVALTYFKEMKQSIK
SYY_PELCD       ----------------------------------------------------------------------
SYY_HELHP       ----------------------------------------------------------------------
SYY_ANAVT       ----------------------------------------------------------------------
SYY_SULDN       ----------------------------------------------------------------------
SYY_SHEON       ----------------------------------------------------------------------
SYY_RALSO       ----------------------------------------------------------------------
SYY_LEPIN       ----------------------------------------------------------------------
SYY_LEPIC       ----------------------------------------------------------------------
SYY_CAMJR       ----------------------------------------------------------------------
SYY2_VIBVY      ----------------------------------------------------------------------
SYY2_VIBVU      ----------------------------------------------------------------------
SYY2_CLOAB      -TQLVVKLGLDPSAPDHLGHAVVLRK--LKQLQDLGHKIVIIIGDFTGMISKTRKQLSSQQVMKNAETYI


                         .         .         *         .         .         .         .:140
query           ALGLDPDKAYFYRQSDIPEIMELTWIISTTTAKGLLNRAHAYKALVDQNLQEENADPDKGITMGLFNYPV
SYW_PSEAE       AGGLDVERATFYRQSDIPEIPELTWLLTCVSAKGLLNRAHAYKAAVDRNV-EAGEDPDAGVTMGLYSYPV
SYW_NEIMA       ACGLDPERTTFYRQSDIPEVMELNWILTCITAKGLMNRAHAYKAAVQANAENGQEDPDFGVEMGLYSYPI
SYW_PSEPK       AGGLDPDKVTFYRQSDIPEIPELTWLLTCVAAKGLLNRAHAYKASVDKNV-ENGEDPDAGVTMGLFSYPV
SYW_XANAC       ACGLDPDKVWFYRQSDVPETTELMWLLTCVAGKGILNRAHAYKAAVDRN-RADGEDEDAGVTAGLFMYPV
SYW_NEIMB       ACGLDPERTTFYRQSDTPEVMELNWILTCITAKGLMNRAHAYKAAVQANAENGQEDPDFGVEMGLFSYPI
SYW_XANCP       ACGLDPDKVWFYRQSDVPETTELMWLLTCVAGKGILNRAHAYKAAMDKN-RAEGEDEDAGVTAGLFMYPV
SYW_PSESM       AAGLDVDRVTFYRQSDIPEIPELTWLLTCVAAKGLLNRAHAYKASVDKNV-ESCEDPDAGITMGLYSYPV
SYW_BORPE       AAGLDPERVTFYRQSDIPEITELCWLLTCVTPKGLMNRAHAYKASVDQNAAK-GVEPDDGVTMGLFSYPV
SYW_BORPA       AAGLDPERVTFYRQSDIPEITELCWLLTCVTPKGLMNRAHAYKASVDQNAAK-GVEPDDGVTMGLFSYPV
SYW_BORBR       AAGLDPERVTFYRQSDIPEITELCWLLTCVTPKGLMNRAHAYKASVDQNAAK-GVEPDDGVTMGLFSYPV
SYW_XYLFA       ACGLDPEKVWLYRQSDVPEITELMWLLTCVAGKGILNRAHAYKAVVDKN-RSEGGDDDAGITAGLFMYPV
SYW_XYLFT       ACGLDPEKVWLYRQSDVPEITELMWLLTCVAGKGILNRAHAYKAVVDKN-RSHGDDDDAGITAGLFMYPV
SYW_FUSNN       AVGLDPSKSTIFLQSNVPEHTELTWLLSNITPVGLLERGHSYKDKIAKGIPSNT---------GLLTYPV
SYW_CAMJR       SLGIDPQKSVFWLQSDVKEVMELYWILSQFTPMGLLERAHSYKDKVAKGLSASH---------GLFSYPV
SYW_CAMJE       SLGIDPQKSVFWLQSDVKEVMELYWILSQFTPMGLLERAHSYKDKVAKGLSASH---------GLFSYPV
SYW_RHOBA       XXXXXPSKANLFVQSDIPEVTELTWLLMTGTPMGLLERCHAFK--------EKKA---KGLTAGLFTYPV
SYW_LISMF       AVGLDPEKATLFIQSEVAAHAQAAWILQCNVYIGELERMTQFK---------DKSDGKAGVSAGLLTYPP
SYW_LISIN       AVGLDPEKATLFIQSEVAAHAQAAWILQCNVYIGELERMTQFK---------DKSDGKAGVSAGLLTYPP
SYW_HAEIN       ACGIDPNKSTIFVQSHVPEHTQLSWVLNCYTYFGEMSRMTQFK--------DKSARYAENINVGLFDYPV
SYW_PASMU       ACGIDPEKSTIFIQSHVPEHTQLAWVLNCYTYFGEMGRMTQFK--------DKSARHAENINVGLFTYPV
SYW_LISMO       AVGLDPEKSTLFIQSEVAAHAQAAWILQCNVYIGELERMTQFK---------DKSAGKAGVSAGLLTYPP
SYW_DEIRA       AIGLDPSKVVFFVQSHVPEHQELSWIFTCVTPVGELERMTQYK---DKSAQFES------VPSGLLMYPA
SYW_WOLSU       ACGIDMKKSKLFIQSEVDEHAALAWILDCNIPMGDMSRMTQFKDKSQKN--------PKNINIGLFNYPA
SYW_CHLTR       SVGIDPEKSAIYLQSAIPEIYELNLIFSMLTPLNHIMGIPSIKEMANASLNEES------LSHGLIGYPV
SYW_BACAN       ACGIDPEKATLFVQSEVPAHAQLGWIMQSVAYVGELERMTQYK---------DKASGRDSVPAGLLTYPP
SYW_YERPE       ACGIDPKKSTIFVQSHVPEHSQLSWALNCYTYFGELSRMTQFK--------DKSARYAENINAGLFDYPV
SYW_CHLMU       SVGIDPEKSAIYLQSAIPEIYELNLLFSMLTPLNHIMGIPSIKEMANASINEES------LSHGLIGYPV
SYW_SALTY       ACGIDPEKSTIFVQSHVPEHAQLGWALNCYTYFGELSRMTQFK--------DKSARYAENINAGLFDYPV
SYW_SALTI       ACGIDPEKSTIFVQSHVPEHAQLGWALNCYTYFGELSRMTQFK--------DKSARYAENINAGLFDYPV
SYW_BORBU       ACGINPDKVSIYLQSAIPELFELHLIFSMIVTVARLQRIPSIKDMIAAGLKE--------IPYGLLGYPV
SYW_RICFE       AAGLNPDKVTIFAQSMVKEHAELAWLLNCVTPLGWLKRMTQFK-------DKAGSDQEKAC-LGLFSYPV
SYW_KLEAE       ACGIDPQKSTIFVQSHVPEHAQLGWALNCYTYFGELSRMTQFK--------DKSARYAENINAGLFDYPV
SYW_CHLPN       SVGIDPTKSIIYLQSAIPEIYELHLLFSMLIS---INRVMGIPSLKDM---ARNASIEEGLSYGLIGYPI
SYW_HAEDU       ACGIDPNKSTIFIQSQVPEHSQLAWVLNCYTYFGEMGRMTQFK--------DKSARYEENVNVGLFTYPV
SYW_ECOLI       ACGIDPEKSTIFVQSHVPEHAQLGWALNCYTYFGELSRMTQFK--------DKSARYAENINAGLFDYPV
SYW_SHIFL       ACGIDPEKSTIFVQSHVPEHAQLGWALNCYTYFGELSRMTQFK--------DKSARYAENINAGLFGYPV
SYW_RICCN       AAGLNPDKVTIFAQSMVKEHTELAWLLNCVTPLGWLKRMTQFK-------DKAGSDQEKAC-LGLFSYPV
SYW_HELPY       ACGIDPKQSGLFIQSEVDEHPALAWLLNCQVSMGEMQRMTQFK---DKSLKNP-----KSVNVGLFNYPI
SYW_ECOL6       ACGIDPEKSTIFVQSHVPEHAQLGWALNCYTYFGELSRMTQFK--------DKSARYAENINAGLFDYPV
SYW_ECO57       ACGIDPEKSTIFVQSHVPEHAQLGWALNCYTYFGELSRMTQFK--------DKSARYAENINAGLFDYPV
SYW_PROMA       ACGMDPKKCSIFVQSHISAHSELCWLLNCVTPLNWMERMIQFK--------EKAIKQGDNVSIGLLDYPV
SYW_HELHP       ACGIDTKKSHLFIQSQIDEHAALAWILDCNIPMGDMSRMTQFK-------DKSNKNP-KNINVGLFNYPA
SYW_BACST       AVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFK---------EKSAGKEAVSAGLLTYPP
SYW_ENTFA       AVGLDPQKATIFIQSEVSAHAEAGWIIQCNTSIGELERMTQFK---DKSQKNGRA----GVSAGLLTYPP
SYW_CLOTE       ASGLDPEKNTLFIQSHVPAHTEAAWLLNCFTYLGELNRMTQFK--------DKSQNAGESISAGLLNYPV
SYW_CHLCV       SVGIDPNKSSIYLQSAIPEIYELHLLFSMLISVNRIMGIPSLKEMAKNASIEEG-----GLSLGLMGYPV
SYW_RICTY       AAGLNPDKVTIFAQSMVKEHAELSWLLNCVTPLGWLKRMTQFK-------DKAGSDQCKAC-LGLFAYPI
SYW_BLOFL       ACGINPDISTIFIQSHVPEHSQLNWILNCYTYYGELNRMVQFK--------EKSSRYKNNINVGLFNYPI
SYW_RICPR       AAGLNPDKVTIFAQSMVKEHVELSWLLNCVTPLGWLKRMTQFK--------DKAGSAQCKACLGLFAYPI
SYW_PROMP       ACGINPKICSIFVQSQISAHSELCWILNCMTPINWMERMIQFK---EKSIQQGN-----NVSIGLFDYPI
SYW_CLOAB       ASGIDPEKNTIFIQSHVPAHVQAQWILNCMSYVGELSRMTQFK---DKSKKYE----DTGIGAGLLNYPV
SYW_CLOPE       ASGINPEENTLFIQSHVPAHSEASWLLTCNSYMGELSRMTQYK--------DKSKKMGDSIGAGLFNYPV
SYW_THEMA       ACGIDPEKSVIFVQSGVKEHAELALLFSMIVSVSRLERVPTYKEIKSELNYKDLS------TAGFLIYPV
SYW_HELPJ       ACGISPKQSGLFIQSEVDEHPALAWLLDCQVSMGEMQRMTQFK---DKSLKNP-----KSVNVGLFNYPI
SYW_RICBR       AAGLDPNKVTIFAQSMVKEHAELAWLLNCVTPLGWLKRMTQFK-------DKAGKDQEKAC-LGLFSYPV
SYW_MYCPU       ACGLDPEKTVLFKQSDVYEHGLMQWILLNQTTIGELSRMTQFK---DKSSKITHANNTESIPSGLLTYPT
SYW_SYNY3       ACGIDLQYSTIFVQSHVAAHSELAWLLNCVTPLNWLERMIQFK--------EKAVKQGENVSVGLLDYPV
SYW_STAAW       ASGIDPDKATLFIQSEVPAHVQAGWMLTTIASVGELERMTQYKDKAQKAVE--------GIPAGLLTYPP
SYW_STAAS       ASGIDPDKATLFIQSEVPAHVQAGWMLTTIASVGELERMTQYKDKAQKAVE--------GIPAGLLTYPP
SYW_STAAN       ASGIDPDKATLFIQSEVPAHVQAGWMLTTIASVGELERMTQYKDKAQKAVE--------GIPAGLLTYPP
SYW_STAAM       ASGIDPDKATLFIQSEVPAHVQAGWMLTTIASVGELERMTQYKDKAQKAVE--------GIPAGLLTYPP
SYW_STAAC       ASGIDPDKATLFIQSEVPAHVQAGWMLTTIASVGELERMTQYKDKAQKAVE--------GIPAGLLTYPP
SYWM_YEAST      AVGVDPEKASVIYQSAIPQHSELHWLLSTLASMGLLNRMTQWKS--KSNIKQSTNDSDVGVRLGLFSYPV
SYW_STAAR       ASGIDPDKATLFIQSEVPAHVQAGWMLTTIASVGELERMTQYKDKAQKAVE--------GIPAGLLTYPP
SYW2_STRCO      AAGLDPDRCTLFVQSHVPEHAQLGWLMNCITGFGEASRMTQFK---DKSAKQGN----DRTTVGLFTYPM
SYW_STRP8       SVGLDPKQSTIFIQSQIPELAELSMYYMNLVSLARLERNPTVKTEIAQKGFGES------IPSGFLVYPV
SYW_STRP6       SVGLDPKQSTIFIQSQIPELAELSMYYMNLVSLARLERNPTVKTEIAQKGFGES------IPSGFLVYPV
SYW_STRP3       SVGLDPKQSTIFIQSQIPELAELSMYYMNLVSLARLERNPTVKTEIAQKGFGES------IPSGFLVYPV
SYW_STRP1       SVGLDPKQSTIFIQSQIPELAELSMYYMNLVSLARLERNPTVKTEIAQKGFGES------IPSGFLVYPV
SYW_TREPA       ACGIDAQRAVIYLQSAVPEVTELAFIFANLVTVPRLQRIPSLKEMAQANLSE--------LPFGLLGYPV
SYW_STRMU       SVGLDPEKVTIFIQSQIPELAELTMYYMNLVSLARLERNPTVKTEIAQKGFGES------IPTGFLVYPI
SYW_PROMM       ACGMDPDLCSIFVQSQVSAHSELCWLLNCVTPLNWLERMIQFK--------EKSVKQGDNVSVGLLDYPV
SYW_OCEIH       ASGIDPDSSTLFIQSEVPEHTQLGWMLQSISYVGELERMTQYK---------DKSQGQEAISSALLTYPS
SYW_PHOLL       ACGIDPEKSTIFVQSHVPQHAQLSWILNCYTYFGELSRMTQFK--------DKSARHAENINAGLFDYPV
SYW_LACLA       AAGLDPEKSTIFIQSQIPELAELSMYYMNLVSLARLERNPTVKTEIAQKAFGES------IPAGFLVYPV
SYW_BACHD       AVGIDPSKATLFIQSEVPAHAQLGWMMQCVSYIGELERMTQFK---------DKSDGKEAVSASLLTYPP
SYW_STAES       ATGIDPDKSTLFIQSEVPAHVQAGWMLTTIASIGELERMTQFK-----DKAQKRAD---GVPAGLLTYPP
SYW_VIBPA       AVGVDPKKSTLFVQSHVPEHAQLGWLLNCYTQMGELSRMTQFK--------DKSARYANDVNVGLFDYPV
SYW_STAEQ       ASGIDPDKSTLFIQSEVPAHVQAGWMLTTIASIGELERMTQFK-----DKAQKRAD---GVPAGLLTYPP
SYW_STRA5       AVGLDPNKSTLFIQSQIPELAELSMYYMNLVSLARLERNPTVKTEIAQKGFGES------IPAGFLVYPV
SYW_STRA3       AVGLDPNKSTLFIQSQIPELAELSMYYMNLVSLARLERNPTVKTEIAQKGFGES------IPAGFLVYPV
SYW_VIBF1       AVGVDPKKSTLFVQSHVPEHAQLGWLLNCYTQMGELSRMTQFK--------DKSARHSNDVNVGLFDYPV
SYW_SHEON       ACGVDPKKSTVFIQSQVPQHTQLGWALNCYTQMGELSRMTQFK---DKSQKHAN-----NINVGLFGYPV
SYW_STRR6       AVGLDPNKSTIFIQSQIPELAELSMYYMNLVSLARLERNPTVKTEISQKGFGES------IPTGFLVYPI
SYW_STRPN       AVGLDPNKSTIFIQSQIPELAELSMYYMNLVSLARLERNPTVKTEISQKGFGES------IPTGFLVYPI
SYW_CLOLO       AVGIDPLKSTILVQSQIPELNELTMHYLNLVTLSRLERNPTVKAEIKQKNFENS------IPAGFLIYPV
SYW_MYCPE       ACGLDFDKNIIFYQSSVLAHTQLSYIITCHSYMGELSRMTQFK----DKSQKTNANGTTNIPTGLFIYPC
SYW_VIBVU       AVGVDPKKSTLFVQSHVPEHAQLGWLLNCYTQMGELSRMTQFK--------DKSARYANDVNVGLFGYPV
SYW_PORGI       ACGIDPEKATIYVQSDVREVLELYLYLNMNAYLGELERTTSFK--------EKARKQPNNVNAGLLTYPT
SYW_VIBVY       AVGVDPKKSTLFVQSHVPEHAQLGWLLNCYTQMGELSRMTQFK--------DKSARYANDVNVGLFGYPV
SYW_VIBCH       AVGVDPKKSTLFVQSHVPEHAQLGWVLNCYTQMGELSRMTQFK--------DKSARYANDVNAGLFGYPV
SYW_CORGL       ALGIDPERSTLFVQSHVPAHAELSWVLTCLTGFGEASRMTQFK----DKSSKRGADRTSA---GLFTYPM
SYW_BRUSU       AAGIDPKKSIVFNQSRVMQHAELAWVFNCVARIGWMSRMTQFKDKAGKD--RENA------SLGLFAYPS
SYW_BRUME       AAGIDPKKSIVFNQSRVMQHAELAWVFNCVARIGWMSRMTQFKDKAGKD--RENA------SLGLFAYPS
SYW_SYNPX       ACGMDPQRCSIFIQSQVAAHSELCWLLNCVTPLNWLERMIQFK--------EKAVKQGDNVSVGLLDYPV
SYW_BUCAP       ACGVNPKKSIIFIQSHVYQHSQLNWILSCFSSFGELSRMTQFXXXXXXXXXXXXXXXX-----GLLNYPV
SYW_BUCAI       SCGVDPQKSIIFIQSHVYQHSQLNWILNCFSQFSELLRMTQFKI---------KSNCSKKINAALFNYPI
SYW_CAUCR       ASGLDPDKATIFPQSAVREHAELSWIFNCVARLGWLDRMTQFK--------EKSGKHKERSSVGLYTYPV
SYW_GLOVI       XCGIDPERSTVFVQSHVSAHTELTWLFNCLTPINWLERMIQFK--------EKAIKLGEEVGIGLFDYPV
SYWM_SCHPO      AIGINPQKSTLFFQSDVAQHSELAWLLACSTSMGQLNRMTQWKSXXXXSFLDASATSSTRFNLGLFSYPV
SYW_THEEB       ACGIDPAHATIFVQSHVSAHAELTWLLNCITPLNWLEDMIQFK--------EKAVKQGENVAAGLLDYPV
SYW_BACSU       AVGLDPEKATLFIQSEVPAHAQAGWMMQCVAYIGELERMTQFK---------DKSKGNEAVVSGLLTYPP
SYW_BUCBP       ACGLDPCKSVIFLQSCVHEHSELHWLLTCCTYYGELIRMTQFKDKARKN--------SKNINVGLLSYPI
SYW_BRAJA       ASGIDPKKHIVFNQSQVSGHAELAWIFNCVARMGWLGRMTQFKEKAGKD--RENA------SVGLFDYPV
SYW_ANASP       XCGIDLKYSNIFVQSHVSAHSELAWFLNCITPLNWLQDMIQFK--------EKAVKQGENVGAGLLIYPV
SYW_AGRT5       AAGIDPVKHIVFNQSAVPQHAELAWVFNCVARIGWMERMTQFKDKSGKNAEQ--------VSLGLLAYPS
SYW_RALSO       AAGVDPTQATLFIQSRVPEHAELFLLLSMGTPLGWLERVPTYKDQIEK-LKEKDLS-----TYGFLGYPL
SYW_COREF       ALGIDPERSTLFVQSHIPAHAELSWVLTCLTGFGEASRMTQFKDKSTKQGAERTS-------AGLFTYPM
SYWM_CAEEL      ACGVDPNRTLLFRQSDVPQIAQISWILGSLQTTSKLARLPQYK--------EKKERFKKGIPVGLLTYPL
SYWM_BOVIN      ACGINPEKSILFQQSQVSEHTQLSWILTCMVRLPRLQHLHQWKA--------KTAKEKHNGTVGLLTYPV
SYW_MYCLE       ALGIDPGRAVVFVQSHVPAHTQLAWVLGCFTGFGQASRMTQFK---DKALRQ-GAD---STTVGLFTYPV
SYWM_DICDI      ACGIDPEKVILFNQSMVPAHSELTWILNCITSFSKLSNMIQFK-------EKTKSSNEASVSNGLLSYPV
SYW_MYCTU       ALGIDPGRATIFVQSQVPAHTQLAWVLGCFTGFGQASRMTQFK---DKSARQGS----EATTVGLFTYPV
SYW_MYCBO       ALGIDPGRATIFVQSQVPAHTQLAWVLGCFTGFGQASRMTQFK---DKSARQGS----EATTVGLFTYPV
SYW_LEIXX       AAGIDPSVSTLYVQSHVPAHAQLAWVLSTITGYGEAARMTQFK---DKSAKQGA----EATSVGLFTYPV
SYW_WIGBR       ACDIDPNESVIFLQSHIPEHSQLSWILNCYTYFGELTRMVQFXXXXXXXXXXX---------LGLLSYPV
SYW_UREPA       AAGIDPKKTCLFYQSDILSIPLLAHILLCSTSIGELTRMTQFK---DKSIKATKANNTEMIPSGLLTYPT
SYWM_HUMAN      ACGINPEKSILFQQSQVSEHTQLSWILSCMVRLPRLQHLHQWKAKTTKQKHDG--------TVGLLTYPV
SYW_THETN       AIGLDPKKVTLFVQSHVSAHAELAWLLQCITYFGELSRMTQFXXXXXXXXXXXXX---------LFTYPD
SYW_RHILO       ASGIDPKKHIVFNQSRVMQHAELAWIFNCVARIGWMNKMTQFKDKAGKD--RENA------SLGLLAYPS
SYW_MYCPN       AVGLDPQKACLFLQSDLLEHSMMGYLMMVQSNLGELQRMTQFKAKKAE--QTRNPNGTLNIPTGLLTYPA
SYW2_STRAW      AAGLDPELCTVFVQSHVDEHARLSYLMECVATDGEMRRMIQYREKAAREQQRGGS-----VRLSLLTYPV
SYW_TROW8       AAGIDPAKSIVFLQSDVYQHNQLAWVLGNVCTFGEAARMTQFK---DKSGKQGN------ISTGLFTYPI
SYW_TROWT       AAGIDPAKSIVFLQSDVYQHNQLAWVLGNVCIFGEAARMTQFK---DKSGKQGN------ISTGLFTYPI
SYW_RHIME       ASGIDPEKHIVFNQSAVPQHAELAWIFNCVARIGWMNRMTQFKDKAGKD--RENA------SLGLLAYPS
SYWM_MOUSE      ACGINPEKSILFQQSKVSEHTQLSWILTCMVRLPRLQHLHQWKA--------KAANRKHDGTVGLLTYPV
SYW1_STRCO      XXXXDPELCTVFVQSHVDEHARLSYVLECVATDGEMRRMIQYKEKAARERVRGGS-----VRLSLLTYPV
SYW2_DEIRA      AAGLDPQKTTCVVQSAVPELAELTVYFLNLVTVSHLRQNPTVKAEIAQKGYGER------VPAGFFVYPV
SYW1_STRAW      XXXXDPERCTLFVQSHVPEHAQLAWIMNCLTGFGEASRMTQFK----DKSAKQGADR---ASVGLFTYPV
SYW_AQUAE       LFGMITPKSWLLRLTDXXRISEIVNLIPFNITKEEKFREHLLENLTQTMIEEGEIEPEETDTFGFLGYPV
SYW_MYCGA       ASGFDTNKNNIFLQSEINEHAALGHVLLCHTTMGELERMTQYK---DKKQKFVQSNQTIKIPTGLLTYPT
SYW_MYCGE       ALGLDYGKVNLFLQSDLMEHTMLGYLMLTQSNLGELQRMTQFKT--KKLAQKRNSNNTITIPTGLLTYPV
SYW_METJA       ALGLDPEKINVYLQSKYQKVKDLALILSKRTNWSEMKAIYGFKG-------ETN--------IGHVFAPI
SYW_AERPE       ALGLDPKDTEFYFQT---------------------NRGTPYFRLIQLFSGKVTAAEMEAITPAKMMASL
SYW_SULTO       AVGFNPDKTFIFQDT---EYIRNMYPIAIKIAKKLFSEVRATFGL------------DTSSNIGIIWYPA
SYW_SULAC       AVGFDPNKTFIFQDT---EYIKNMYPLSVKIAKKLFNEVRATFGL------------DTSSNIGIIFYPA
SYW_HYPBU       ALGLEKNKIYFQTNYETPYYRLIQMFSRRVT-------------LEEMSAIYGDLEPSKIMAA------L
SYW_PYRFU       AVGFDPDKTFIFQNSEFTKIYEMAIPIA---KKINFSMAKAVFGFTEQS------------KIGMIFFPA
SYY_PICTO       AAGLNSNVKFVWAS----ELVEKSWSLLLKVAKNA-SLLRIRRSLPIMGRSEEDADRD----FSKYIYPL
SYW_PYRCJ       ALGFTPDKLHLI--IDTKDIKPLYPIAAKVAKKLTWNTVKATFGFTDST------------NIGLIFYPS
SYW_THESM       AVGFDPDKTFIFQDSEFTKIYEMAIPIAKKVTYSMA------KAVFGFNEQSK---------IGMIFFPA
SYW_PYRAE       ALGFSPERLHLI--IDTKDIKPLYPIAVRVAKKLTWNTVKATFGFTDST------------NIGLIFYPS
SYW_PYRAR       ALGFGPDKLHLI--VDTKDIAPLYPIAVRVAKKLTWNTVKATFGFTDSS------------NIGLIFYPS
SYW_PYRHO       AVGFDPDKTFIFQNSEFTKIYEMAIPIA---KKINFSMAKAVFGFTEQS------------KIGMIFFPA
SYW_PYRAB       AVGFDPDKTFIFQNSEFTKIYEMAIPIA---KKINFSMAKAVFGFTEQS------------KIGMIFFPA
SYW_METKA       GLDLDPDRCEIYLQSERKTVQRMALLLAGRLTWNTVKNTYGFTG-------ETN--------MGHAFAPI
SYW_SULSO       AVGFNPDKTFIFQDT---EYIRNMYPITVKIAKKLFSEVRATFGL------------DASSNIGLIFYPA
SYY_METBF       ALGLDKEKTNFVYGSDYQLGAEYMLNVLKLSRSVTLNRARRSMDEVGRAMD----DP----TVSQMVYPL
SYY_METMA       ALGLDEEQTDFVYGSDFQLGAEYMLNVLKLSRAVTLNRAKRSMDEVGRAMD----DP----TVSQMVYPL
SYW_PYRKO       AVGFDPDKTFIFQNSEFTKIYEMALPIAKK-----INFSMA-RAVFGFNEQSK---------IGMIFYPA
SYY_METBU       ALGLDPEMTNFVYGSDFQLSPEYMLNVLKLTQATSLNRAKRSMDEVGRKMEDPKVSQ--------MVYPI
SYW_THEON       AVGFDPDRTFIFQDSEFTKIYEMAIPIA---KKINFSMAKAVFGFTEQS------------KIGMIFYPA
SYY_ARCFU       ALGLDESRAKFVLGSEYQLSRDYVLDVLKMARITTLNRAR--RSMDEVSRRKEDPMVSQMI------YPL
SYY_METAC       ALGLDEEQTDFVYGSDFQLGAEYMLNVLKLSRAVTLNRAKRSMDEVGRAMD----DP----TVSQMVYPL
SYW_THEVO       AMGLQPCEIYF--QSKNKDVQFLSYILGNWTN---MNELKALYGFTDSN------------DILHINAPL
SYY_THEVO       AEGLT--KAEYLWASQLVSSSNYWEMFIKTAKRSTLKRLT--RALPIMGRTEADAEKD----FSMYIYPI
SYW_METAC       ----------------------------------------------------------------------
SYW2_HALSA      AVGFDP---------------ELTRIVDTRDADVLYPLATAFAGDVRHTLQNVYGEPDN---VGQAFYPA
SYY_THEAC       AEGLT--KADYVWASDLVDSSEYWRMFIDTAKRSTLKRVIRSLPIMGRN----ETDAEKDFSMYL--YPI
SYY_METMP       AMGLVADYVYGFQLKDEYTIDVYKLALSTT-----LNRARRSMEVI--------AREDENPKVASVVYPL
SYW_THEAC       AMGLEPCEIYF--QSRNSDVQFLAYMLGNRTNMSELRSLYGFTDTHD---------------LLHINAPL
SYY_METTH       ALGLSPERTEFILGSSFPEYTDLVYRLALITT---LLRAKRSMAQITRESRDHK--------VAEVIYPL
SYY_METMJ       RCGLGLRGANYVLGSDVQLTPEYELAVLELSQAITLNRAK--RSMDEVGRQMDNP------TVSQMVYPI
SYY_METHJ       GLGLTDIKYVLGSSFQLPEYQILVHELSQAIT---LNRAK--RSMDEVGRQMDNP------TVSQMVYPI
SYY_METKA       AMGLDPNKTEFVLGSEFQ--LDEDYALDVYXXXXXXXXXXXXXSMDMIARSEENPPVSQVV------YPL
SYY_METVS       SMGLIADYVY---GSEFQLNEEYTIDVYKLALATTLNRA--------KRSMEVIAREDENPKVASVVYPL
SYY_METLZ       AVGLKG--AEFVLGTDVQLTPKYQTEVLTLCQQITLNRA-------TRSMDEVGRAMDNPMVSQMV-YPV
SYW_ARCFU       ALGLRED-AVIYFQSKSSHVKDLAFELSAEVNFSELRAIYGFNS--DTSLAKMFV---TAIQAADILHPQ
SYY_SYNY3       ---------------DLNKILEL--LATMTVGQMLAKEGFA------ERFQKENP-----IFLHEFLYPL
SYW1_HALSA      ALGFDADEGELYRQSTNRELQDLAFELGIEANTSEFEAIYGFGGDTDVSHMQS---------------VV
SYY_METJA       AMGL---KAKYVYGSEFQLDKDYTLNVYRLALKTTLKRARRSMELIAR--EDENPKVAEVI------YPI
SYY_AQUAE       ----------------IPEVFNSTWLEELGT-KGLIELCAKYTVARMLEREDFSKRFKEGIPIYIFIYPL
SYY2_BACSU      ---LDPEKVELHYNSKWLKTLNLEDVIELA---GKITVAR----LMERDDFEERIAMQKPISLHEFFYPL
SYY_SULAC       --GVDMSKLKVVYAEDLVENIDY-WSLVVKVAKNT-SLARMKRALTIMGRRSEEAELDTSKLI----YPA
SYY_PROMT       ------------------------------------------------------------ISLHEFLYPL
SYY_SULTO       --GVDMSKVRIVYAEDLVKDSNYWALVIRIAKNTSLARMKRALTIMGRKAEEAELDTSKLI------YPA
SYY_PROMP       ------------------------------------------------------------IALHEFLYPL
SYY_PROM9       ------------------------------------------------------------IALHEFLYPL
SYY_HAEI8       ---LDPQKTKIVFNSE--------WLSKLGT-EGMIRLASNYTVMLERDDFKKRFGNNQPIAIHEFIYPL
SYY_HALSA       AYGLDEDQTEFVLGSSFQLDEDYELDLHAMQVETSLKRA-----------QRAMAEIQSGETPKVSHYPL
SYY_HALS3       AYGLDEDQTEFVLGSSFQLDEDYELDLHAMQVETSLKRA-----------QRAMAEIQSGETPKVSHYPL
SYY_HAEIN       ---LDPQKTKIVFNSE--------WLSKLGTX-GMIRLASNYTVMLERDDFKKRFGNNQPIAIHEFIYPL
SYY2_BACLD      --------------------------------------------LMERDDFEERIAMQKPISLHEFFYPL
SYY_SULSO       --GVDVGKLNIVDADDIVKEKDYWALVIKVAKNASLARIKRALTIMGRRAEEAEIDASKLI------YPA
SYY_COXBU       ---LDPDKTQVTSNS--------TWI-NKLKADDLVRLAATYTVMLERDDFNKRYLSQQPIAIHEFLYPL
SYY_SYNSC       ------------------------------------------------------------IALHEFLYPL
SYY_SYNPX       ------------------------------------------------------------IALHEFLYPL
SYY_PROMM       -------------------------------------------ATVGQMLAKEDFGNRYGIALHEFLYPL
SYY_PASMU       ---LDPQKTRI--------VFNSSWLGELGT-EGMIRLTSNYTVMLERDDFKKRFSNNQPIAIHEFIYPL
SYY_GLOVI       -----------------------------------------------------------------FLYPL
SYY_SYNS9       ------------------------------------------------------------IALHEFLYPL
SYY_SULIY       --GVDTTKLNIVDADDMVKEKDYWALVIKVAKNASLARIKRALTIMGRRAEEAEIDASKLI------YPA
SYY_SULIN       --GVDTTKLNIVDADDMVKEKDYWALVIKVAKNASLARIKRALTIMGRRAEEAEIDASKLI------YPA
SYY_SULIM       --GVDTTKLNIVDADDMVKEKDYWALVIKVAKNSSLARIKRALTIMGRRAEEAEIDASKLI------YPA
SYY_SULIL       --GVDTTKLNIVDADDMVKEKDYWALVIKVAKNASLARIKRALTIMGRRAEEAEIDASKLI------YPA
SYY_SULIK       --GVDTTKLNIVDADDMVKEKDYWALVIKVAKNSSLARIKRALTIMGRRAEEAEIDASKLI------YPA
SYY_SULIA       --GVDTTKLNIVDADDMVKEKDYWALVIKVAKNASLARIKRALTIMGRRAEEAEIDASKLI------YPA
SYY_MANSM       ---LDPQKTRIVFNSD--------WLGKLGT-EGMIRLASNYTVMLERDDFKKRFTEKQPIAIHEFIYPL
SYY_LEGPL       ---LDPDKAFNSQWLNKFNAVDLIRLAATHTVARMLERD-------DFNKRYTTGQP---IAIHEFLYPL
SYY_HALMA       AAGADPEDVTFVRGTDFQLDEEYTLEMYRMAAETTISRTQRAASEVVRESESPN--------LGGLIYPL
SYWC_DICDI      ----------------------------------------------------------------------
SYY_LEGPH       ---LDPDKAFNSQWLNKFNAVDLIRLAATHTVARMLERD-------DFNKRYTTGQP---IAIHEFLYPL
SYY_LEGPA       ---LDPDKAFNSQWLNKFNAVDLIRLAATHTVARMLERD-------DFNKRYTTGQP---IAIHEFLYPL
SYY_AZOSE       ---LDPDKTEICFNS--------SWMESLGTA-GMIRLASRYTVMLERDDFAKRYAGGQAIAIHEFLYPL
SYY_AERPE       AAGVPVERVRFVDAEELASDKDYWGLVIRVAKRASLARVRRALTIMGRRAEEAEVDASKLI------YPL
SYY_PROMA       ------------------------------------------------------------IALHEFLYPL
SYY_HAEDU       -----------------------------------------------------------------FIYPL
SYY_BORPE       -------------------------------ARGMIQLASRYTVARMMEREDFTRRFKGGVPIAVFLYPL
SYY_BORPA       -------------------------------ARGMIQLASRYTVARMMEREDFTRRFKGGVPIAVFLYPL
SYY_BORBR       -------------------------------ARGMIQLASRYTVARMMEREDFTRRFKGGVPIAVFLYPL
SYY_THET8       ---------------------------------------------------------EAGIPISLHEYPF
SYY_THET2       ---------------------------------------------------------EAGIPISLHEYPF
SYY_THEMA       ------------------------------------------------------------IAISEFLYPL
SYY_HELPY       -----------------------TWL-DALGAKGMIELCAKFSVMLERDDFTKRYKENRPISIVEFLYPL
SYY_DESPS       ---LDPEKTTVAFNS--------TWL-SKLTAHEMIQLASELTVMLEREDFKNRYESGKPISIHEFMYPL
SYY_BACSK       ------------------------------------------------------------ISVHEFFYPL
SYW_METTH       GLDLEKDNIHVYLQSENLMVEDLAYVLAGKVNFNELRAIYGFTG---------------STSMAHMYAPI
SYY_PHOPR       -----------------------TWL-SELGAEGMIRLAQTVARMLERDDFKKRYNGGRPIAIHEFMYPL
SYY_CAMJE       -------------------IVELT---STFSVARMLERDDFTKRFKEQS----------PISICEFLYPL
SYY_THIFE       -----------------------------------------------------------------FLYPL
SYY_PYRIL       VLGGDPDATRFILGSELYHHNDEYWLLLMDITR------HLTLSQVRHSLTILGRKMGESIPLAYLVYPP
SYY_HALLT       AYGLDESNTQFVLGSDFQLDDDYTLDLHSLELETTLARAERAMAEITSG---------DSVKVSQAVYPL
SYI_PEDPA       -------------------------------AKDLLPEGYSNEHSPNGEFTKENDIMDVWFDSGSSHQGV
SYY2_PYRAE      -----------------PKYWELVVKIAKETSLARVKRA---TPVMGRRAEEVELDFSK------LMYPL
SYW_METMA       ----------------------------------------------------------------------
SYY_NITOC       ---LDPEKTLVVFNSSWMSGMDLVRLSSHYTVARMLERDDFYKRYQGK----------RPIAIHEFLYPL
SYY_ANASP       -----------------------------------------------------------------FLYPL
SYY_FRATT       ---LDKDKTIIRRNGDWFNKMEMIKLASKSTVARMLERSKRYKG-------------GQSISIHEFLYPL
SYY_THEON       VMGGDPDKVEFVLASEILEKGDYWQTVIDISKNVTLARMMRSITIMGRQMGE-------AIDFAKLIYPA
SYY_PELCD       -----------------------------------------------------------------FLYPL
SYY_HELHP       ---------------------------------------------------------NQSISIVEFIYPL
SYY_ANAVT       -----------------------------------------------------------------FLYPL
SYY_SULDN       ------------------------------------------------------------IAISEFLYPL
SYY_SHEON       ----------------------------------------------------------QSIAIHEFMYPL
SYY_RALSO       ------------------------------------------------------------ISVHEFLYPL
SYY_LEPIN       ------------------------------------------------------------ISMIEFLYPL
SYY_LEPIC       ------------------------------------------------------------ISMIEFLYPL
SYY_CAMJR       -------------------IVELT---STFSVARMLERDDFTKRFKEQS----------PISICEFLYPL
SYY2_VIBVY      -----------------------------------------------------------------FMYPL
SYY2_VIBVU      -----------------------------------------------------------------FMYPL
SYY2_CLOAB      FKILDRNKSQWLEKLNFKEVIELA---SKYTVARMLEREDFKKRFKNQ----------QSIGIHEFFYPL


                         +         .         .         .         .         *         .:210
query           LMAADILIFDADLVPVGKDQIQHIEIARDIANRFNHIYQKPVLKAPQALTSEDSQTILGLDGRKMSKSYD
SYW_PSEAE       LMAADILMFNAHKIPVGRDQVQHVEMARDIGQRFNHLFGREFFVLPEAVIEENVATLPGLDGRKMSKSYD
SYW_NEIMA       LMTADILMFNAHEVPVGRDQIQHVEMARDIAGRFNHRFRE-LFTLPEVKIDENVELLVGLDGRKMSKSYG
SYW_PSEPK       LMAADILMFNANKVPVGRDQIQHVEMARDIGQRFNHLFGKDFFALPEAVIEESVATLPGLDGRKMSKSYD
SYW_XANAC       LMAADILIFNAHQVPVGRDQIQHIEMARDFAQRFNHVYGREFFTLPEAVIDEQVSTLPGLDGRKMSKSYG
SYW_NEIMB       LMTADILMFNANEVPVGRDQIQHVEMARDIAGRFNHRFRE-LFTLPEVKIDENVELLVGLDGRKMSKSYG
SYW_XANCP       LMAADILIFNAHKVPVGRDQIQHIEMARDFAQRFNHVYGQDYFTLPDAVIDEQVATLPGLDGRKMSKSYN
SYW_PSESM       LMAADILMFNAHQVPVGRDQIQHVEMARDIGQRFNHLFGKEFFVMPEALIEESVATLPGLDGRKMSKSYD
SYW_BORPE       LMAADILLFNANQVPVGRDQVQHLEMARDIAQRFNHLYGREFFVLPEVVIAEEVATLPGLDGRKMSKSYN
SYW_BORPA       LMAADILLFNANQVPVGRDQVQHLEMARDIAQRFNHLYGREFFVLPEVVIAEEVATLPGLDGRKMSKSYN
SYW_BORBR       LMAADILLFNANQVPVGRDQVQHLEMARDIAQRFNHLYGREFFVLPEVVIAEEVATLPGLDGRKMSKSYN
SYW_XYLFA       LMAADILLFNAHQVPVGRDQIQHIEMARDFAQRFNHIYGGEYFVLPEAAIDEQVATLPGLDGRKMSKSYG
SYW_XYLFT       LMAADILLFNAHQVPVGRDQIQHIEMARDFAQRFNHIYGGEYLVLPEAAIDEQVATLPGLDGRKMSKSYG
SYW_FUSNN       LMAADILIYDSDVVPVGKDQKQHLEMTRDIAMKFNQQYGVEFFKLPEPLILDDSAIVPGTDGQKMSKSYN
SYW_CAMJR       LMAADILLFDTRIVPVGKDQIQHVEIARDIALKVNNEWGE-IFTLPXXXXXXXXXXXXGTDGAKMSKSYQ
SYW_CAMJE       LMAADILLFDTRIVPVGKDQIQHVEIARDIALKVNNEWGE-IFTLPXXXXXXXXXXXXGTDGAKMSKSYQ
SYW_RHOBA       LMAADILAYDSQIVPVGVDQVQHIEVCRDLAGSFHHAFGETFV-LPKAKTLDVGAKVPGTDGQKMSKSYN
SYW_LISMF       LMAADILLYQTDLVPVGEDQKQHIELTRDLAERFNKKH-ADIFTMPEVFIPKQGARVMSLQDKKMSKSLK
SYW_LISIN       LMAADILLYQTNLVPVGEDQKQHIELTRDLAERFNKKH-ADIFTMPEVFIPKQGARVMSLQDKKMSKSLK
SYW_HAEIN       LMAADILLYQAKSVPVGDDQKQHLEITRDIANRFNALYGN-IFTIPEIFIGKAGARIMSLQDKKMSKSDD
SYW_PASMU       LMAADILLYQANQVPVGEDQKQHLEITRDIANRFNALY-GDLFAVPEPFIPKAGARVMSLPEKKMSKSRN
SYW_LISMO       LMAADILLYQTDLVPVGEDQKQHIELTRDLAERFNKKH-ADIFTMPEVFIPKQGARVMSLQDKKMSKSLK
SYW_DEIRA       LMAADILLYKADIVPVGEDQTQHIELTREIARKFNHNFGE-TFTEPKAVYNKEALRIPGVDGQKMSKSKG
SYW_WOLSU       LMAADILLYQTDFVPVGEDQKQHLELTRDVAERFNRDYGE-TFKIPEPMIPKMGARIMGLDDKKMSKSEN
SYW_CHLTR       LQSADILLAKAHLVPVGKDNEAHVELTRDIAKTFNRLYGE-VFPEPDILQGE-LTALVGTNGQKMSKSAN
SYW_BACAN       LMAADILLYNTEIVPVGDDQKQHMELTRDLAERFNKRFRE-VFTIPEIRIPKVGARVMSLPTKKMSKSDP
SYW_YERPE       LMAADILLYQTNQVPVGEDQKQHLELSRDIASRFNNLY-GDIFKIPEPFIPKAGARVMSLQDKKMSKSDD
SYW_CHLMU       LQSADILLAKAHLVPVGKDNEAHVELTRDIAKTFNRLYGS-VFPEPDILQGE-LTSLVGTNGQKMSKSAN
SYW_SALTY       LMAADILLYQTNLVPVGEDQKQHLELSRDIAQRFNGLY-GDIFKVPEPFIPKSGARVMSLPTKKMSKSDD
SYW_SALTI       LMAADILLYQTNLVPVGEDQKQHLELSRDIAQRFNGLY-GDIFKVPEPFIPKSGARVMSLPTKKMSKSDD
SYW_BORBU       LMSADILMTKANLVPVGRDNESHIEFARELARRFNHLYKNNFFPIPESVFT-DSRPLVGIYGKKMSKSLD
SYW_RICFE       LMAADILIYKADIVPVGEDQKQHLELTRDIAGVINRRFDKEILKVPEVLISETGTRIMSLDGKKMSKSKD
SYW_KLEAE       LMAADILLYQTNQVPVGEDQKQHLELSRDIAQRFNAIY-GDIFKVPEPFIPKSGARVMSLPTKKMSKSDD
SYW_CHLPN       LQSADILLAKAQFVPVGKDNEAHVELTRDIARNFNRLYGQ-VFPEPEVLQGE-LTSLVGIDGQKMSKSAN
SYW_HAEDU       LMAADILLYQANQVPVGDDQKQHLEITRDIANRFNTLYGKSVFTVPECFIAKACARVMSLPTKKMSKSDD
SYW_ECOLI       LMAADILLYQTNLVPVGEDQKQHLELSRDIAQRFNALYGE-IFKVPEPFIPKSGARVMSLPTKKMSKSDD
SYW_SHIFL       LMAADILLYQTNLVPVGEDQKQHLELSRDIAQRFNALYGE-IFKVPEPFIPKSGARVMSLPTKKMSKSDD
SYW_RICCN       LMAADILIYKADIVPVGEDQKQHLELTRDIAGVINRKFNKEILKVPEVLISETGTRIMSLDGKKMSKSKD
SYW_HELPY       LMASDILLYQSDLVPVGEDQKQHLELTRNIAEKFNRDFGN-CFKVPEPLIAKVGARVMGLDDPKMSKSHQ
SYW_ECOL6       LMAADILLYQTNLVPVGEDQKQHLELSRDIAQRFNALY-GDIFKVPEPFIPKSGARVMSLPTKKMSKSDD
SYW_ECO57       LMAADILLYQTNLVPVGEDQKQHLELSRDIAQRFNALY-GDIFKVPEPFIPKSGARVMSLPTKKMSKSDD
SYW_PROMA       LMAADILLYDADLVPVGEDQKQHLELARDIASRFNK-ESKSILKIPKPLIMKEGGKIMSLDGNKMSKSDP
SYW_HELHP       LMAADILLYQADFVPVGEDQKQHLELTRDVAMRFNRDYGE-CFNIPEPMIPQVGARVMGLDNSKMSKSEN
SYW_BACST       LMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGE-LFTIPEARIPKVGARIMSLPTKKMSKSDP
SYW_ENTFA       LMVGDIVLYNADLVPVGDDQKQHLELTRDFVERFNKRYNQEILTIPEVKIAEQGSRIMSLQTKKMSKSDT
SYW_CLOTE       LMAADILLYNADLVPVGNDQKQHLELTRDIATRFNNLY-SPTFKVPEPYIGKTGARIMDLQKKKMSKSAE
SYW_CHLCV       LQSADILLAKAQLVPVGKDNEAHIELTRDIARNFNRLYGE-IFPEPETLQGE-LTSLVGIDGQKMSKSAN
SYW_RICTY       LMAADILIYKADIVPVGEDQKQHLELTRDIAEVINRRFDKEILKVPDILISETGTRIMSLRNKKMSKSKD
SYW_BLOFL       LMASDILLYQTDFVPVGEDQRQHVELVRDIARRFNNIF-GTVFKIPNVLISMYGSRIMSLPTRKMSKSPN
SYW_RICPR       LMAADILIYKADIVPVGEDQKQHLELTRDIAEVINRRFDKEILKVPDILISETGTRIMSLRNKKMSKSKD
SYW_PROMP       LMAADILLYDADYVPVGEDQKQHLELAKDIAQRINAKFGKEILKIPQPIIMKKGSKIMSLNSKKMSKSDI
SYW_CLOAB       LMAADILIYQADLVPVGKDQTQHIELTRDLAQRFNSTYSE-TFKIPEGYIPTGGAKIMSLQEKKMSKSSD
SYW_CLOPE       LMAADILLYNADLVPVGKDQMQHLELARDIGTRFNNSYSK-TFTIPEGYVPKEGAKIMDLQSKKMSKSDA
SYW_THEMA       LQAADILIYKAEGVPVGEDQVYHIELTREIARRFNYLYDE-VFPEPEAILSRVPK-LPGTDGRKMSKSYG
SYW_HELPJ       LMASDILLYQSDLVPVGEDQKQHLELTRNVAEKFNRDFGN-CFKVPEPLIAKVGARVMGLDDPKMSKSHK
SYW_RICBR       LMAADILIYKADIVPVGEDQKQHLELTRDIAGVINRKFNKEILKVPEVLIGGSGTRIMSLXXXRINLRDD
SYW_MYCPU       LMAADILLYNPNLVPVGQDQVQHLELTRKIARKLNNKYNTK-FNEPTTFVPETGAKIMSLTNKKMSKSSD
SYW_SYNY3       LMAADILLYDADKVPVGEDQKQHLELTRDIVIRINDKFGRPVLKLPEPLIRKEGARVMSLDGKKMSKSDE
SYW_STAAW       LMAADIVLYNTNIVPVGDDQKQHIELTRNLVDRFNSRY-NDVLVKPEIRMPKVGGRVMSLQDRKMSKSDD
SYW_STAAS       LMAADIVLYNTNIVPVGDDQKQHIELTRNLVDRFNSRY-NDVLVKPEIRMPKVGGRVMSLQDRKMSKSDD
SYW_STAAN       LMAADIVLYNTNIVPVGDDQKQHIELTRNLVDRFNSRY-NDVLVKPEIRMPKVGGRVMSLQDRKMSKSDD
SYW_STAAM       LMAADIVLYNTNIVPVGDDQKQHIELTRNLVDRFNSRY-NDVLVKPEIRMPKVGGRVMSLQDRKMSKSDD
SYW_STAAC       LMAADIVLYNTNIVPVGDDQKQHIELTRNLVDRFNSRY-NDVLVKPEIRMPKVGGRVMSLQDRKMSKSDD
SYWM_YEAST      LQAADILLYKSTHVPVGDDQSQHLELTRHLAEKFNKMYKKNFFPKPVTMLAQTKKVLLSTPEKKMSKSHD
SYW_STAAR       LMAADIVLYNTNIVPVGDDQKQHIELTRNLVDRFNSRY-NDVLVKPEIRMPKVGGRVMSLQDRKMSKSDD
SYW2_STRCO      LMVADILLYQADQVPVGEDQRQHLELTRDLADRFNQTY-GDAFTVPTAYILKETAKIYDLQDAKMSKSAA
SYW_STRP8       SQAADITAFKANLVPVGNDQKPMIEQTREIVRSFNHTYHTDCLVEPEGIYPENEKALPGLDGNKMSKSLG
SYW_STRP6       SQAADITAFKANLVPVGNDQKPMIEQTREIVRSFNHTYHTDCLVEPEGIYPENEKALPGLDGNKMSKSLG
SYW_STRP3       SQAADITAFKANLVPVGNDQKPMIEQTREIVRSFNHTYHTDCLVEPEGIYPENEKALPGLDGNKMSKSLG
SYW_STRP1       SQAADITAFKANLVPVGNDQKPMIEQTREIVRSFNHTYHTDCLVEPEGIYPENEKALPGLDGNKMSKSLG
SYW_TREPA       LQAADILLARAHLVPVGKDNESHVELTREVAKRFNRLYGE-VFPLPRALLS-DCATLVGTDGQKMSKSLG
SYW_STRMU       SQAADITAFKANYVPVGNDQKPMIEQTREIVRSFNHTYKTNCLVEPEGIKNEAAGRLPGLDGNKMSKSLG
SYW_PROMM       LMAADILLYDADLVPVGEDQKQHLELARDIAQRINARFEKPVLKVPDPLIIKEGARVMSLDGRKMSKSDP
SYW_OCEIH       LMAADILLYNTDVVPVGDDQKQHLELARNLAQRFNNRF-NDIFTVPEVRIPKVGARIMSLQTKKMSKSDT
SYW_PHOLL       LMTADILVYQTNQVPVGIDQKQHLELSRDIAQRFNAIYGN-IFAVPEPFIPTGGARVMALQDKKMSKSDD
SYW_LACLA       SQAADITAFKATHVPVGNDQKPMIEQTREIVRSFNNAYHTDVLVEPEGIYPENEAALPGLDGNKMSKSLG
SYW_BACHD       LMAADILLYHTNIVPVGEDQKQHLELTRDLAERFNDIFTIPEVQIPKVGARIMSLXXXXXXXXXXXXXXX
SYW_STAES       LMAADIVIYNTNIVPVGDDQKQHMELTRNLVDRFNSRY-NDVLVKPEVRMPKVGGRVMSLQDKKMSKSDD
SYW_VIBPA       LMAADILLYGAHQVPVGSDQKQHLELARDIATRFNNIYESPIFTVPEPYIPTVNARVMSLQDKKMSKSDD
SYW_STAEQ       LMAADIVIYNTNIVPVGDDQKQHMELTRNLVDRFNSRY-NDVLVKPEVRMPKVGGRVMSLQDKKMSKSDD
SYW_STRA5       AQAADITAFKANLVPVGTDQKPMIEQTREIVRSFNHAYNCQVLVEPEGIYPENDAALPGLDGNKMSKSLN
SYW_STRA3       AQAADITAFKANLVPVGTDQKPMIEQTREIVRSFNHAYNCQVLVEPEGIYPENDAALPGLDGNKMSKSLN
SYW_VIBF1       LMAADILLYGAHQVPVGSDQKQHLELARDIATRFNNIYEAPIFTVPEPYIPQVNARVMSLQDKKMSKSDD
SYW_SHEON       LMAADILLYQANEIPVGQDQKQHLELTRDIATRFNNAYGE-TFTIPEPFIPEHGAKVMSLQDKKMSKSDD
SYW_STRR6       AQAADITAFKANYVPVGTDQKPMIEQTREIVRSFNNAYNCDVLVEPEGIYPENERALPGLDGNKMSKSLN
SYW_STRPN       AQAADITAFKANYVPVGTDQKPMIEQTREIVRSFNNAYNCDVLVEPEGIYPENERALPGLDGNKMSKSLN
SYW_CLOLO       SQAADITAFKATTVPVGEDQLPMIEQAREIVRSFNTIYGKEVLVEPKAVIPKGTGRLPGTDGKKMSKSIG
SYW_MYCPE       LMAADILLYDADLVPVGKDQKQHMELARDIAIRMNKKYKTNLFKIPEIYQSEMGAKIMDLPSIKMSKSNA
SYW_VIBVU       LMAADILLYGAHQVPVGSDQKQHLELARDIATRFNNIYENPIFTIPEPYIPTVNARVMSLQDKKMSKSDD
SYW_PORGI       LMAADILIHRAVKVPVGKDQEQNMEMARKFARRFNTIYEVDFFPEPESFSGATALKVPGLDGSKMGKSEG
SYW_VIBVY       LMAADILLYGAHQVPVGSDQKQHLELARDIATRFNNIYENPIFTIPEPYIPTVNARVMSLQDKKMSKSDD
SYW_VIBCH       LMAADILLYGAHQVPVGSDQKQHLELARDIATRFNNIYEQPIFTIPEPYIPTVNARVMSLQDKKMSKSDD
SYW_CORGL       LMAADILLYRPHLVPVGEDQRQHLELTRTLAERFNNRFGK-AFEVPEGFIPQGASKIYDLQNAKMSKSGD
SYW_BRUSU       LMAADILLYRATAVPVGEDQKQHLELTRDIAQKFNNDYSDRIFPLTEPMISGPAMRIMSLDGKKMSKSDP
SYW_BRUME       LMAADILLYRATAVPVGEDQKQHLELTRDIAQKFNNDYSDRIFPLTEPMISGPAMRIMSLDGKKMSKSDP
SYW_SYNPX       LMAADILLYDADLVPVGEDQKQHLELARDIAQRINARFERPVLKVPKPLILKEGARVMSLDGRKMSKSDP
SYW_BUCAP       LMSSDILLYQTNLVPVGQDQKQHLELTRNIANRFNFLY-GDIFTLPNPLISKNGSKIMSLPTKKMSKSDT
SYW_BUCAI       LMAADILLYQTNFVPVGQDQKQHVELTRNIAHRFNSLYGH-VFTLPKPLITQHGSKIMSLPSKKMSKSKK
SYW_CAUCR       LQAADILIYKATHVPVGEDQKQHLELTRDIAQKFNHDFNAPFFPLPDPLIQGPGARVMSLDGAKMSKSTD
SYW_GLOVI       LQAADILLYEPHLVPVGEDQRQHLELTRDIARRFNDRYGES-LRVPEMLIRKEGARVMSLDGSKMSKSDP
SYWM_SCHPO      LQAADILLYGATHIPVGKDQSQHVELTRSIARSFNSSYKEKILTVPDILNSSSSIMALCQPEKKMSKSSK
SYW_THEEB       LMAADILLYDADLVPVGEDQKQHLELTRDIAARVNYLFQXXXXXXXXXXXXXAGARVMSLDGKKMSKSDP
SYW_BACSU       LMAADILLYGTDLVPVGEDQKQHLELTRNLAERFNKKY-NDIFTIPEVKIPKVGARIMSLNDKKMSKSDP
SYW_BUCBP       LMASDVLLYDTDVVPIGLDQKQHMELICNIARRFNLLYGN-TFKIPKNKMSYYGSNILSLSDKKMSKSDV
SYW_BRAJA       LMAADILLYRATHVPVGEDQKQHLELSRDIAQKFNNDFGDSIFPLPEPFITGPATRVMSLDGKKMSKSSD
SYW_ANASP       LMAADILLYQADKVPVGEDQKQHLELTRDIVNRFNHQFDKPVMKLPEPLIRKEGARVMSLDGRKMSKSDP
SYW_AGRT5       LMAADILVYRATHVPVGDDQKQHLELARDIAQKFNHIRDEPVFPMVEPLIGGPAPRVMSLDGKKMSKSDP
SYW_RALSO       LQAADILIYRAGFVPVGEDQVPHVEMTREVARRFNYLYARALLAESQSLSMGDRERLFGLEGARMSKSYG
SYW_COREF       LMAADILLYRPQLVPVGEDQRQHLELTRTLAERFNNRF-GTVFEVPEGFIPEGASKIYDLQNAKMSKSGE
SYWM_CAEEL      LQAADVLTFKATTVPVGEDQSQHLNLLGGLAYAFNKTYETEIFPIPKQLTRESHARIRSLPEKKMSKSSG
SYWM_BOVIN      LQAADILLYKSTHVPVGEDQVQHMELVQDLAQSFNKKYGEFFPVPKSILTSMKKVKSLRDPSAKMSKSDP
SYW_MYCLE       LQAADVLAYDTDLVPVGEDQRQHLELARDLAQRFNSRFPDTFV-VPDMFIPKMAAKIYDLPTSKMSKSAS
SYWM_DICDI      LMAADILLYKATHVPVGEDQTQHLEFTRDIAQAFHSNFKSKFFPYPSIITSEQSKRIMSLDGRKMSKSDP
SYW_MYCTU       LQAADVLAYDTELVPVGEDQRQHLELARDVAQRFNSRF-PGTLVVPDVLIPKMTAKIYDLQDSKMSKSAG
SYW_MYCBO       LQAADVLAYDTELVPVGEDQRQHLELARDVAQRFNSRF-PGTLVVPDVLIPKMTAKIYDLQDSKMSKSAG
SYW_LEIXX       LMAADILLFDADVVPVGDDQRQHVELTRDLAERFNSRFGETFV-VPQAMILKDGARIYDLQSSKMSKSAD
SYW_WIGBR       LMASDILLYQTDIVPVGKDQIQHLELSRTIARRFNKLH-GDVFIIPEKIISKTGSKIMSLSNKKMSKSRN
SYW_UREPA       LMAADILTFNADVVPVGQDQKQHLELTRTLADRFNKRYGN-TFKLPQVYIPKIGAKIMDLPNIKMSKSSK
SYWM_HUMAN      LQAADILLYKSTHVPVGEDQVQHMELVQDLAQGFNKKYGEFFPVPESILTSMKKVKSLRDPSAKMSKSDP
SYW_THETN       LMAADILLYKTHYVPVGEDQKQHLELTRDVAQRFNNRFGETFV-IPEPMILKFGARIMSLTNKKMSKSPN
SYW_RHILO       LMAADILLYRATHVPVGEDQKQHLELTRDIAQKFNNDFSDRIARLGVGVEMQGEETVNGFDGKKMSKSDP
SYW_MYCPN       LMAGDILLYQPDIVPVGNDQKQHLELTRDLAQRIQKKF-KLKLRLPQFVQNKDTNRIMDLPTKKMSKSSK
SYW2_STRAW      LMAADILAYGTDEVPVGDDQTQHVELTRDLAVRFNQRYGHTFV-VPRATRPEVAARVMNLQTSKMGKSDD
SYW_TROW8       LMASDILLYDSAFVPVGADQKQHLELTRTLARRFNAQYGQTFL-VPQPFECSIRIYDLQDPAVKMSKSES
SYW_TROWT       LMASDILLYDSAFVPVGADQKQHLELTRTLARRFNAQYGQTFL-VPQPFECSIRIYDLQDPAVKMSKSES
SYW_RHIME       LMAADILVYRATHVPVGDDQKQHLELTRDIAQKFNHAYFPPV----EPLIGGPAPRVMSLDGKKMSKSDP
SYWM_MOUSE      LQAADILCYKSTHVPVGEDQVQHMELVQDLARSFNQKYGEFFPLPKSILTSMKKVKSLRXXXXXXXXXXX
SYW1_STRCO      LMAADILAYGTDEVPVGEDQTQHVELARDLAVRFNQRYGHTFV-VPRATSPAVAARVMNLQASKMGKSDD
SYW2_DEIRA      SQAADIAAFGATLVPVGDDQLPMLEQTREIVRRFNALY-APVLAEPQAQLSRVPR-LPGLDGQKMSKSLG
SYW1_STRAW      LQVADILLYQANEVPVGEDQRQHIELTRDLAERFNGRFGE-TFTVPKPYILKETAKIFDLQSIKMSKSAS
SYW_AQUAE       LQAADILIYKGEGVPVGEDQLPHIELSREIARRFNRLYGK-IFPEPKALLTE-TPKIPGTDGRKMSKSYG
SYW_MYCGA       LMAADILLYQSDYVCVGDDQKQHLELTRDIAIRMNKRYGE-LFKVPEPIIAKVGSRIMDLNXXXXXXXXX
SYW_MYCGE       LMAADILLYQPDIVPVGNDQKQHLELTND-XXXXXXXXXXXXXXXPVFIENKDTNRIMDLSNKKMSKSQN
SYW_METJA       VQVADILHPQLDVVPVGIDQDPHIRLTRDIANRAKEFKFIPP-------SSTYHRFMTGLLGGKMSSSKP
SYW_AERPE       TQAADILHVQLDVVPVGADQDPHLRLTRDLADRMAGVVE---LERP-ASTYHKLQP--GLDGRKMSSSRD
SYW_SULTO       LQIAPTMFEKRRLIPAGIDQDPYWRLQRDIAESLGYY------KAAQ-IHSKFLPPLTGPEGKMSSSQPE
SYW_SULAC       LQIVPTMFEKRRLIPAGIDQDPYWRLQRDIAESLGYF------KAAQ-IHSKFLPPLTGPEGKMSSSQPE
SYW_HYPBU       TQAADILHPQLDVVPVGADQDPHIRLTRDIAARFEN---ELGLRRP-ASTYHRFQT--GLDGNKMSSSRE
SYW_PYRFU       IQAAP-TFFEKKLIPAAIDQDPYWRLQRDFAESLG--YYKTA-----ALHSKFFPPLTGLEGKMSASKPE
SYY_PICTO       MQVTDIFYLDVDFALGGMDQRHAHMLARDIAERMN--IKKPVSVHTPLLSSLKGSGRMD-SFKKMSKSEP
SYW_PYRCJ       LQIA-VAFLPTELIPCAIDQDPYFRLARDIAESLG--YPKPATLY--------SKFIMALTGEKMSASNP
SYW_THESM       IQAAPTFFEERSLIPAAIDQDPYWRIQRDFAESLG--YYKTA-----ALHSKFVPGLMGLGGKMSASKPE
SYW_PYRAE       LQIAVAFLATPVLIPCAIDQDPYFRLARDIADALG--YPKP--------STLYSKFIMALTGEKMSASND
SYW_PYRAR       LQIA-VAFLPTELIPCAIDQDPYFRLARDIADSLS--YPKP--------TTLYSKFIMALTGESKMSASN
SYW_PYRHO       IQIAP-TFFERKLIPAAIDQDPYWRLQRDFAESLG--YYKTA-----ALHSKFVPSLTSLSGKMSASKPE
SYW_PYRAB       IQIAPTFFEKRRLIPAAIDQDPYWRLQRDFAESLG--YYKTA-----AIHSKFVPSLTSLSGKMSASKPE
SYW_METKA       VQAADILHPQEILVPVGVDQDPHLRLTRDIAEKEDLI--KPASTYHRFMT--------GLTGGKMSSSKP
SYW_SULSO       LQIAPTMFEKKRLIPAGIDQDPYWRLQRDIAESLGYY------KAAQ-IHSKFLPPLTGPEGKMSSSNPE
SYY_METBF       MQAIDIAMLGVDIAVGGIDQRKIHMLARE--NLKNLGFETPICI--------HTPILLGLDGTKMASSKE
SYY_METMA       MQAIDIALLEVDVAVGGIDQRKIHMLARENLKSLG--FETPICI--------HTPILLGLDGTKMASSKD
SYW_PYRKO       IQAAP-TFFEKKLIPAAIDQDPYWRLQRDFAESLG--YYKTA-----AIHSKFVPGLTSLEGKMSASKPE
SYY_METBU       MQAVDIALLGVDVAVGGIDQRKIHMLAREGLPGLG-------FKAPLCI---HTPILLGLDGTKMSSSNE
SYW_THEON       IQAAP-TFFEKKLIPAAIDQDPYWRLQRDFAESLG--YYKTA-----AIHSKFVPGLMGLEGKMSASKPE
SYY_ARCFU       MQALDIAHLGVDLAVGGIDQRKIHMLARENLPRLG--YSSPVLHTP---------ILVGLDGQKMSSSKG
SYY_METAC       MQAIDIALLEVDVAVGGIDQRKIHMLARENLKSLG--FETPICI--------HTPILLGLDGTKMASSKD
SYW_THEVO       IQAADVLHTQLNVVPVGFDQDPHIRLMRDLAKRFNVFY--------------------------------
SYY_THEVO       MQVTDIFYLDVDIAFGGMDQRHAHMLARDIADKMK--VKKAVSVHGYLLSSLKGNTRMD-NFVKMSKSDP
SYW_METAC       ----------------------------------------------------------GLQGGKMSSSIE
SYW2_HALSA      VQTAHLLLPQLTLVPIAVDQDPHVRVSRDVAAKARY----PVGK-PGALLMQFLPSLAG--PGKMSSSAG
SYY_THEAC       MQVTDIFYLDVDMAFGGMDQRHAHMLARDIAEKMK---RKKVVSVHGFLLSSLKGNARMDNFVKMSKSDP
SYY_METMP       MQVNDIKHLNADVAVGGMEQRKIHMLSREILPSMGY-------KAPVCI---HNPVLTGLDGEKMSSSKG
SYW_THEAC       IQAADVLHTQMKVVPVGFDQDPHLRLMRDLAKR-------------------------------------
SYY_METTH       MQVIDMVYLGVDVALGGMEQRKIHMLARENLPRLG--FDAPVCIHTPLLHGTDG-------SEKMSSSKG
SYY_METMJ       MQMVDIATLGVDAAVGGIDQRKIHMLARE------HL---PSIGYPAPVCIH-TPIINGLDGKKMSSSAG
SYY_METHJ       MQMADIAMLGVDAALGGIDQRKIHMLAREYLPSKN--YPSPVIHVP---------ILQGLDGKKMSSSQG
SYY_METKA       MQALDIVHLNVDLAVGGLEQRKIHMLARDVLPKLG--YDSP--------TCLHTPIIHGLDGEKMSSSKN
SYY_METVS       MQVNDIKHLNVDVAVGGMEQRKIHMLSREILPNMGY-------KAPICI---HNPILTGLDGEKMSSSKG
SYY_METLZ       MQVVDIPTLNVDAAVGGIDQRKIHMLAREHLPTLG--YKPPVCI--------HTPIVNGLDGEKMSSSKG
SYW_ARCFU       L--SDFXXXXXXXXXXXADQDPHMRLTRDLAARISIFSFEPVRKGAEYLSSEEHMDIFGLTGGKMSSSKE
SYY_SYNY3       MQGYDSVAVNADVELGGTDQKFNIAVGRDLQRHFGKTPQFGLL----------LPILLGTDGQKMSKSLN
SYW1_HALSA      TQMADILYPQLDVIPVGPDQDPHVRFARDLAER-------------------------------------
SYY_METJA       MQVNDIHYLGVDVAVGGMEQRKIHMLAREL--------------LPKKVVCIHNPVLTGLDGEKMSSSKG
SYY_AQUAE       LQAYDSVAIKADVEIGGTDQKFNLLIGRDIQREYG---QEPQVCITLPL-------LVGTDGRKMSKSYG
SYY2_BACSU      MQGYDSVVLESDIELGGTDQHFNVLMGRHFQERYNKEKQVVIL----------MPLLEGLDGEKMSKSKH
SYY_SULAC       MQVSDIFFQDLDIALGGTDQRKAHMLARDVAEK---LQRKKVIAIHTPL-------LVGLQGGQRMNTED
SYY_PROMT       LQGYDSVAINSDVELGGTDQKFNIAMGRDLQKAFG---QKPQFGMLLPI-------LVGLDGRKMSKSLD
SYY_SULTO       MQVADILYQDLDIALGGTDQRKAHMLARDVSDKLG---KKKVIHTPLLIGLQGGQRMEGVESVKMSKSKP
SYY_PROMP       LQGYDSVAVNSDIELGGTDQKFNIAIGRDLQRHFKQEPQYGIL----------LPILTGLDGKKMSKSES
SYY_PROM9       LQGYDSVVVQSDIELGGTDQKFNIAIGRDLQRHFKQEPQFGVL----------LPILTGLDGKKMSKSEF
SYY_HAEI8       LQGYDSVALDADVELGGTDQKFNLLVGREL--------QKSAGKKPQVAIT--LPLLVGLDGKKMSKSLG
SYY_HALSA       MQALDIEYLDLDLAIGGMDQRKVHMLAREELPSVGY-EKRPVLHTP--IIGD-----LGSGDGKMSSSEG
SYY_HALS3       MQALDIEYLDLDLAIGGMDQRKVHMLAREELPSVGY-EKRPVLHTP--IIGD-----LGSGDGKMSSSEG
SYY_HAEIN       LQGYDSVALDADVELGGTDQKFNLLVGREL--------QKSAGKKPQVAIT--LPLLVGLDGKKMSKSLG
SYY2_BACLD      MQGYDSVVLDSDIELGGTDQHFNVLMGRHFQEKYGKEKQVVIL----------MPLLEGLDGEKMSKSKN
SYY_SULSO       MQVSDIFYLDLDIALGGTDQRKAHMLARDVAEKMG---KKKIIHTPLLVGLQGGQRMNITEGMKMSKSKP
SYY_COXBU       LQGYDSVALKADVELGGTDQKFNLLVGRELQKHFG---QRPVLTVP---------LLEGLDGQKMSKSLN
SYY_SYNSC       LQGYDSVAVNADVELGGTDQKFNVAMGRDLQRHFNKGTQFGLL----------LPILVGLDGQKMSKSLG
SYY_SYNPX       LQGYDSVAVNADVELGGTDQKFNVAMGRDLQRHFNKGTQFGLL----------LPILVGLDGQKMSKSLG
SYY_PROMM       LQGYDSVAVQADVELGGTDQKFNVAMGRDLQRHFDQRPQFGLL----------LPILAGLDGQKMSKSLS
SYY_PASMU       LQGYDSVALDADIELGGTDQKFNLLVGREL--------QKSAGQKPQVAIT--LPLLVGLDGKKMSKSLG
SYY_GLOVI       MQGYDSVALDADIELGGTDQRFNLLMGRNLQELFG---KKPQL----ALT---VPLLVGLDGKKMSKSLD
SYY_SYNS9       LQGYDSVAVNADVELGGTDQKFNVAMGRDLQRHFGRGTQFGLL----------LPILVGLDGQKMSKTLG
SYY_SULIY       MQVSDIFYLDLDIALGGTDQRKAHMLARDVAEKMG---KKKIIHTPLLVGLQGGQRMSITEGMKMSKSKP
SYY_SULIN       MQVSDIFYLDLDIALGGTDQRKAHMLARDVAEKMG---KKKIIHTPLLVGLQGGQRMSITEGMKMSKSKP
SYY_SULIM       MQVSDIFYLDLDIALGGTDQRKAHMLARDVAEKMG---KKKIIHTPLLVGLQGGQRMSITEGMKMSKSKP
SYY_SULIL       MQVSDIFYLDLDIALGGTDQRKAHMLARDVAEKMG---KKKIIHTPLLVGLQGGQRMSITEGMKMSKSKP
SYY_SULIK       MQVSDIFYLDLDIALGGTDQRKAHMLARDVAEKMG---KKKIIHTPLLVGLQGGQRMSITEGMKMSKSKP
SYY_SULIA       MQVSDIFYLDLDIALGGTDQRKAHMLARDVAEKMG---KKKIIHTPLLVGLQGGQRMSITEGMKMSKSKP
SYY_MANSM       LQGHDSVALEADVELGGTDQKFNLLVGREL--------QKSAGQKPQVAMT--LPLLVGLDGKKMSKSLG
SYY_LEGPL       LQGYDSVALKADVELGGTDQKFNLLMGRELQKHYGF--------EPQVVMM--TPLIEGLDGKKMSKSLD
SYY_HALMA       MQTLDVKALDADIAYGGVDQRGIYMLSREILP--DHGGESPILFAP---------LLSGLSGGKMSAS--
SYWC_DICDI      ------------LIPCAIDQDPYFRMTRDIAHRIGH--QKPAL-----IHSKFFPALQG-HNTKMSASDT
SYY_LEGPH       LQGYDSVALKADVELGGTDQKFNLLMGRELQKHYGF--------EPQVVMM--TPLIEGLDGKKMSKSLD
SYY_LEGPA       LQGYDSVALKADVELGGTDQKFNLLMGRELQKHYGF--------EPQVVMM--TPLIEGLDGKKMSKSLD
SYY_AZOSE       CQGYDSVAMRADVELGGTDQKFNLLVGREL--------QKHDRQAPQCVLM--MPLLEGLDGNKMSKSLG
SYY_AERPE       MQVSDIFYMDLDIALGGMDQRKAHMLARDVAEKLGR--KKPVLQGPGRMEASQGEIDDVLAEVKMSKSKP
SYY_PROMA       FQGYDSVAVQADVELGGVDQKFNVAMGRDMQRHFS---QKPQFGLLLPI-------LVGLDGQKMSKSLG
SYY_HAEDU       LQGYDSVALQADVELGGTDQTFNLLVGREL--------QKSAEQKPQVAIT--LPLLVGLDGKKMSKSLG
SYY_BORPE       LQGYDSVALKADLELGGTDQKFNLLVGRELQKEYGQ-EQQCILTMP---------LLVGTDGEKMSKSKG
SYY_BORPA       LQGYDSVALKADLELGGTDQKFNLLVGRELQKEYGQ-EQQCILTMP---------LLVGTDGEKMSKSKG
SYY_BORBR       LQGYDSVALKADLELGGTDQKFNLLVGRELQKEYGQ-EQQCILTMP---------LLVGTDGEKMSKSKG
SYY_THET8       AQAYDSVAIRADVEMGGTDQRFNLLVGREVQRAYGQSPQVCFLMP----------LLVGLDGRKMSKSLD
SYY_THET2       AQAYDSVAIRADVEMGGTDQRFNLLVGREVQRAYGQSPQVCFLMP----------LLVGLDGRKMSKSLD
SYY_THEMA       AQAYDSVAIQSDVELGGTDQLFNLLVGRKIQEEYG---QEPQIVMTMPI-------IEGTDGKKMSKSYG
SYY_HELPY       LQGYDSVAMDADIELGGNDQKFNLLVGRFLQRAYGLNKEQSVITMP---------LLEGLDGQKMSKSLG
SYY_DESPS       IQGYDSVALEADVEIGGTDQRFNVLMGRDL--------QRSRGQAPQVVLT--LPLLEGLDGNKMSKSLG
SYY_BACSK       MQGYDSVAMETDIEVGGTDQTFNLLMGRQLQEAYG--------KEKQVMLT--LPLIEGLDGRKMSKSLN
SYW_METTH       IQVSDILHPQLDELXXXXDQDPHIRLTRDIAARFRDRYGFIL------PSSTYHRFMGGLTGGKMSSNRP
SYY_PHOPR       LQGYDSVAMETDVELGGTDQKFNLLMGREL--------QKSHGQKPQVVLT--MPLLVGLDGKKMSKSAH
SYY_CAMJE       LQGYDSVALKSDIEMGGTDQKFNLLMGRQLQRVYNIGKEQAVIMMP---------LLEGLDGNKMSKSLN
SYY_THIFE       LQGYDSVAIKADVELGGTDQRFNLLVGRELQREYG---QKPQLVLTMPI-------LEGLDGQKMSKSLG
SYY_PYRIL       LQVADVFALEAHIPHGGIDQRRAHILARQVADK-------------------------------------
SYY_HALLT       MQALDIPYLGVDLAVGGMEQRKVHMLARDV---LPSIDREPPTSLHTPLIAD-----LGTGRGKMSSSEG
SYI_PEDPA       LAQRDYLEYPADLVLEGSDQYR---------GWFNSSLITSVAKAPYKKVISQGFTLDG-KGHKMSKSLG
SYY2_PYRAE      MQVADIFYLGVDVAVGGMDQRRAHMLARDVAEKLG-------LKKPIALHTPIITSLSG-TGRMTHREID
SYW_METMA       ----------------------------------------------------------GLQGGKMSSSID
SYY_NITOC       LQGYDSVALKADVELGGTDQKFNLLVGRDLQKAYGQ-EQQIIITMP---------ILEGLDGQKMSKSLG
SYY_ANASP       MQGYDSVAIEADVELGGTDQKFNIAVGRDLQRHFGQKPQFGVL----------LPILIGTDGQKMSKSLG
SYY_FRATT       VQGYDSVAMNADIELGGTDQKFNLLMGREL--------QKQQGQEPQVIIT--MPLLEGLDGKKMSKSSQ
SYY_THEON       MQVADIFYQGVTIAHAGMDQRKAHVIAIEVAQKLNGEKLKPVLQEPPVWPIESEEQYKELKTQKMSKSKP
SYY_PELCD       VQGYDSVALKADVELGGTDQKFNLLVGREL--------QKQEGQVPQCVLT--MPLLEGLDGNKMSKSLG
SYY_HELHP       LQGYDSVALNCDIELGGNDQKFNLLVGRSLQRAYKLNKEQSVMTLP---------LLEGLDGHKMSKSLN
SYY_ANAVT       MQGYDSVAIEADVELGGTDQKFNIAVGRDLQRHFGQKPQFGVL----------LPILIGTDGQKMSKSLG
SYY_SULDN       LQGYDSVHLKSDIEVGGTDQKFNLLMGRHLQRSYDVGKEQAVLMVP---------ILEGLDGQKMSKSLG
SYY_SHEON       LQGYDSVALKADVELGGTDQKFNLLMGREL--------QKAEGQKPQAVIM--MPLLEGLDGKKMSKSAH
SYY_RALSO       MQGYDSVALKSDLELGGTDQKFNLLVGREL--------QKEYGQEPQCILT--MPLLVGLDGEKMSKSKG
SYY_LEPIN       VQGYDSVAMECDVELGGTDQKFNLLVGRDLQREYGKEAQ-CVLTLP---------LLVGLDGKKMSKSLG
SYY_LEPIC       VQGYDSVAMECDVELGGTDQKFNLLVGRDLQREYGKEAQ-CVLTLP---------LLVGLDGKKMSKSLG
SYY_CAMJR       LQGYDSVALKSDIEMGGTDQKFNLLMGRQLQRVYNIGKEQAVIMMP---------LLEGLDGNKMSKSLN
SYY2_VIBVY      LQGYDSVAMETDVELGGTDQKFNLLMGREL--------QKANGQKPQVVLM--MPLLVGLDGKKMSKSAN
SYY2_VIBVU      LQGYDSVAMETDVELGGTDQKFNLLMGREL--------QKANGQKPQVVLM--MPLLVGLDGKKMSKSAN
SYY2_CLOAB      MQAYDSMAIKADIEFGGTDQ------------RFNLLMGRTL----QAEYGEEKQIAIGIDGKKMSKSLG


                         .         .         .         +         .         .         .:280
query           NTIAIFSMEKKLRKQVMKIITNSQMPEEKKDPNNCTIFAIYKSIASQTEIAALEEKYLAGGLGWGDAKQI
SYW_PSEAE       NTIPLFSPSRQLKDAIARIVTDSRAPGEPKDPDSSHLFLLYSAFASAEQVAAFRQELLE-GLAWGEAKQR
SYW_NEIMA       NTIPLWENDKKTQKSVNKIITNMKEPGEPKKPDESPLFEIYKAFSTPSETAEF-TKMLADGLAWGEAKKL
SYW_PSEPK       NTIPLFTSAKDMKDAISRIVTDSRAPGEAKDPDNAHLFTLYQAFSTPEQCAGFREELLQ-GLGWGDAKQR
SYW_XANAC       NTIPLFAPREELRKLVFSILTDSRAPGQAKDTQGSALFQLYQAFATPQESAAFAQAF-ADGIGWGDAKQQ
SYW_NEIMB       NTIPLWENDKKTQKSVNKIITNMKEPGEPKQPDESPLFEIYKAFSTPSETVEF-TKMLADGLAWGEAKKL
SYW_XANCP       NTIPLFAPREELRKLVFSILTDSRAPGEAKDTQGSALFQLYQAFATPQETAAFAQAF-ADGISWADAKQQ
SYW_PSESM       NTIPLFSSAKDMKSAISRIVTDSLAPGEAKDPDNSHLFTLYQAFSTPEQCAQFRSELLQ-GLGWGEAKTR
SYW_BORPE       NTIPLFGGAAGLRNATQRIVTDSRLPGEPKDAEASHLYMLYRAFSTQQESMAF-RRQLEEGMGWGDAKQA
SYW_BORPA       NTIPLFGGAAGLRNATQRIVTDSRLPGEPKDAEASHLYMLYRAFSTQQESMAF-RRQLEEGMGWGDAKQA
SYW_BORBR       NTIPLFGGAAGLRNATQRIVTDSRLPGEPKDAEASHLYMLYRAFSTQQESMAF-RRQLEEGMGWGDAKQA
SYW_XYLFA       NTMPLFCTREELKKYVFSIVTDSRAPGEPKEAVGSAVFQLYQAFAGVEECSMFAQA-LAEGLGWGEAKVR
SYW_XYLFT       NTMPLFCTREELKKYVFSIVTDSRAPGEPKEAVGSAVFQLYQAFAGVEECSMFAQA-LVEGLGWGEAKVR
SYW_FUSNN       NTINMFATKKKLKEQVMSIVTDSTPLEEPKNPDNAKIYALFNNIDKQNE---LKDKFLAGNFGYGHAKTE
SYW_CAMJR       NTIDIFSSEKTLKKQISSIVTDSTALEDPKDHENCNIFKIAKLFLDESGQKELQIRYEKGGEGYGHFKIY
SYW_CAMJE       NTIDIFSSEKTLKKQISSIVTDSTALEDPKDHENCNIFKIAKLFLDESGQKELQIRYEKGGEGYGHFKIY
SYW_RHOBA       NTLPLFGEVKKIRKQIMRIVTDSRPMEDPKDPTDDHLFQLYQLFAGPAEVETMAAKYRAGGFGYGEIKKA
SYW_LISMF       NAIFLLDPPATIRKKIKSAVTDSEYNKEEK-PGVSNLLTIYSVITGET-ISTIEEKYV--GKGYGDFKTD
SYW_LISIN       NAIFLLDPPATIRKKIKSAVTDSEYNKEEK-PGVSNLLTIYSVITGET-IANIEEKYV--GKGYGDFKTD
SYW_HAEIN       NVVTLLEDPKSVAKKIKRAVTDSDEPPVVRVQNKAGVSNLLDILSAVTDIADLEKEF--EGKMYGHLKTA
SYW_PASMU       NVIGLLEDPKAVAKKIKRAVTDSEPPVVRYDVQNSNLLDILSGVTGKS-IAELETEF--EGKMYGHLKGT
SYW_LISMO       NAIFLLDPPATIRKKIKSAVTDSEYNKEEK-PGVSNLLTIYSVITGET-IASIEEKYV--GKGYGDFKTD
SYW_DEIRA       NTIGILEPFGDIWQKLRVAPTDPARVRDPGDPDKCLIGDYHKLFSPPETLETVYQGCRTAGIGCVDCKKM
SYW_WOLSU       HGIALLDTPDEILKKFKKATTDSENPEQIGIFNLLTIYQIFTGYSQEVIEAEFE------GKGYGIFKVA
SYW_CHLTR       NAIYLSDDAKTVQEKIRKLYTDNRIHATTPGRVEGNPLFIYHDLFNKEEVEEFKTRYRQGCIRDVEVKAR
SYW_BACAN       NPKSMISMPKTIEKKIKSAVTDSEKFDKENKPGISNLLTIYSSFSGKTEIEAMYE-----GKGYGDFKGD
SYW_YERPE       NVIELLEDPKSVVKKIKRAMTDSDEPDVEKKAGVSNLLDILSGVTGQS-IPELEAQFT--GQMYGHLKGA
SYW_CHLMU       NAIYLSDDEKTVQEKIRKMYTDNRVHATTPGRVEGNPLFIYHDLFNKEEVEEFKTRYRQGCIKDVEVKAR
SYW_SALTY       NVIGLLEDPKSVVKKIKRAVTDSDEPDVKEKAGVSNLLDILSAVTGQS-IPELEKQF--EGKMYGHLKGE
SYW_SALTI       NVIGLLEDPKSVVKKIKRAVTDSDEPDVKEKAGVSNLLDILSAVTGQS-IPELEKQF--EGKMYGHLKGE
SYW_BORBU       NAIFLNDDENLLEKKIMSMYTNRIRADIPGNVEGNPIF-IYHSFSNHEEVEDLKSRYXXXXXXXXXXXXX
SYW_RICFE       DNDLIHQKIKKAKTDHLSFVSY----DKETRPEISNLLDIYRSL-SEESLEKIINNY--QNQGFSKFKED
SYW_KLEAE       NVIGLLEDPKSVVKKIKRAVTDSDEPDLKEKAGVSNLLDILSAVTGKT-IPELEQHF--EGKMYGHLKGE
SYW_CHLPN       NAIYLSDSDATITEKVRKMYT---------DPNRIRALFIYHDIFNKDEVEEFKARYRQGCIKDIEVKAR
SYW_HAEDU       NVIGLLEDPKAVAKKIKRAMTDSDEPPVIKQKNKAGVSNLLDILAAITGKSMVELEAEFEGKMYGHLKTE
SYW_ECOLI       NVIGLLEDPKSVVKKIKRAVTDSEPPVVRYDVQNSNLLDILSAVTGQS-IPELEKQF--EGKMYGHLKGE
SYW_SHIFL       NVIGLLEDPKSVVKKIKRAVTDSEPPVVRYDVQNSNLLDILSAVTGQS-IPELEKQF--EGKMYGHLKGE
SYW_RICCN       DNDLIHQKIKKAKTDHLSFVSYDQ----ETRPEISNLLDIYXXXXXXXXXQIIGNYQ---NQGFAKFKED
SYW_HELPY       GNHAIFLLDEPIVKKIKKAATDSMIAFDEKREGIFNLLNIYMLLSNESP-ENIEERF--KNKGYGDFKKE
SYW_ECOL6       NVIGLLEDPKSVVKKIKRAVTDSEPPVVRYDVQNSNLLDILSAVTGQS-IPELEKQF--EGKMYGHLKGE
SYW_ECO57       NVIGLLEDPKSVVKKIKRAVTDSEPPVVRYDVQNSNLLDILSAVTGQS-IPELEKQF--EGKMYGHLKGE
SYW_PROMA       NRIALLDSPEIIKKKIKRAKTDSFLGDNNQRPEANNLLGIYSMVSNQNREAVQKE---FSNIGWGKFKPI
SYW_HELHP       HAIFLLDSPDVITRKCKKAVTDSQIVFDESRAGLYNLLCIYE-IFTQKSRKSIEAEF--EGKGYGHLKMA
SYW_BACST       NPITLLDDAKTIEKKIKSAVTDSERYDKEAKPGISNLLNIYSTLSGQS-IEELERQY--EGKGYGVFKAD
SYW_ENTFA       NVKGFISMLDEIRKKIRSAVTDSEYNKEEK-PGITNLLNIYSAATGQT-VEELVQAY--EGKGYGDFKAD
SYW_CLOTE       NKILIMDPPNIIQNKINRAVTDNEVRYSDEQPGVKNLMNIL-STATGKNVESIEKEY--AGLGYSKFKKD
SYW_CHLCV       NAIYLSDDDATIEDKVRRMYTDNRIHASTPGRVEGNPLFIYHDIPNKEEVEEFKTRYRQGCIKDVEIKTR
SYW_RICTY       SNDLIYQKIKKAKTDHLSFISY----DKKTRPEISNLLDIYKSL-SKESMEKIINNY--QNQGFAKFKED
SYW_BLOFL       SYITLLDNVDCISKKIQGAVTDSDSPDPIKKPGISNLLAILSGISGQS-ILNLEESFQS--KTYAQLKDV
SYW_RICPR       SNDLIHQKIKKAKTDHLSFISYN----KKTRPEISNLLDIYKSF-SKESIEKIIDNY--QNQGFAKFKED
SYW_PROMP       NRINLLDTPEIITKKIKRAKSDSYMGMEPERPESRNLLMIY-SLLSGKEVSELEND--LSQTGWGTFKKI
SYW_CLOAB       NPILIMDPPEVIKRKIARAVTNVGVVKYTDDQPGVKNLMNIMSCCTGMSVKDIEDKY--EGQGYSKFKED
SYW_CLOPE       NPILIMDEPNVIRKKISRAVTDSIVNYTDEQPGVKNLINILCAIKGYTPDEVVK---MYDGKGYAEFKND
SYW_THEMA       NIINLEISEKELEQTILRMMTDPARRSDPGNPENCPVWKYHQAFISEEESKWVWEGCTTASIGCVDCXXX
SYW_HELPJ       GNHAIFLLDEPIVKKIKKAATDSMIAFDETREGVFNLLNIYMLLSDESP-EKIEERF--RNKGYGDFKKE
SYW_RICBR       NDL-IHQKIKKAKTDHLSFVSY----DKEARPEISNLLDIYTTL-SEEKLENIIQNY----EGFAKFKED
SYW_MYCPU       DTIFLLEDPELAYKKIKKSITDSEVYHDPSKPGVSNLLEIYKSLKEAQEIFK-DKNYL-------ELKEG
SYW_SYNY3       SELSLLDPPEMIKKKVKKCKTDPQRGDDPERPECHNLLTLYTLLSNQTKEAVAQE---CAEMGWGQFKPL
SYW_STAAW       NAISLLDEPNVAAKKIKSAVTDSDGIIKFDRDNKPGITNLISIYAGLTDMPIKDIEAXXXXXXXXXXXXD
SYW_STAAS       NAISLLDEPNVAAKKIKSAVTDSDGIIKFDRDNKPGITNLISIYAGLTDMPIKDIEAXXXXXXXXXXXXD
SYW_STAAN       NAISLLDEPNVAAKKIKSAVTDSDGIIKFDRDNKPGITNLISIYAGLTDMPIKDIEAXXXXXXXXXXXXD
SYW_STAAM       NAISLLDEPNVAAKKIKSAVTDSDGIIKFDRDNKPGITNLISIYAGLTDMPIKDIEAXXXXXXXXXXXXD
SYW_STAAC       NAISLLDEPNVAAKKIKSAVTDSDGIIKFDRDNKPGITNLISIYAGLTDMPIKDIEAXXXXXXXXXXXXD
SYWM_YEAST      SVIFLNDEPKAIQKKIRKALTDSISDRFYYDPVERPGVSNLINIVSGIQRKSIEDEDVSRFNNYRDFKDY
SYW_STAAR       NAISLLDEPNVAAKKIKSAVTDSDGIIKFDRDNKPGITNLISIYAGLTDMPIKDIEAXXXXXXXXXXXXD
SYW2_STRCO      TPKGLINLXXXXXXXXXDTDTVVRFDRETK-PGVSNLLTIYSTLTG-AEIAELERKY--EGKGYGALKTD
SYW_STRP8       NGIYLSDDADTVRKKVMSMYT---------DPNHIKILDIFARKEDQADIEAMKEHYQRGGLGDVKTKRY
SYW_STRP6       NGIYLSDDADTVRKKVMSMYT---------DPNHIKILDIFARKEDQADIEAMKEHYQRGGLGDVKTKRY
SYW_STRP3       NGIYLSDDADTVRKKVMSMYT---------DPNHIKILDIFARKEDQADIEAMKEHYQRGGLGDVKTKRY
SYW_STRP1       NGIYLSDDADTVRKKVMSMYT---------DPNHIKILDIFARKEDQADIEAMKEHYQIGGLGDVKTKRY
SYW_TREPA       NAIFLSDDEETVRRKVRAMYTDADIPGRVE---GNPVFAYHDAFNPNTEVAHFKERYRAGRVGDTEVKDA
SYW_STRMU       NGIFLSDDADTVRKKVMSMYTNHIRVEDPGQIEGNMVFDIFGRKEDQTDIAAMKEHYQSGGLGDVKTKHY
SYW_PROMM       NRITLLDPPELITKKIKRAKTDPQMGLQFGNPDRDNLLGIYAILSGRGRDAAAQE---CAEMGWGTFKPL
SYW_OCEIH       NQKGFISMPKRIEKKIKSAVTDSEKFDKENKPGVSNLLTIYSSCTGES-IADLE--XXXXXXXXXXFKQG
SYW_PHOLL       NVIALLEDPKSAAKKIKRAVTDSEEPDLEQKPGVSNLLDLLAGVTGKT-IPELEAEF--EGQMYGHLKSA
SYW_LACLA       NGIFLADDMDTLKKKVMSMYTDPKVEDPGKIEGNMVFLDVFGKAEDAEQISEMKAQYQAGGLGDVKTKRF
SYW_BACHD       XYISMLDDEKTITKKIKSAVTDSDKFDKENKPAISNLLSIY-SLCKGASIEEVEAQFV--GKGYGEFKES
SYW_STAES       NQISLLDEPHVAAKKIKSAVTDSDKFDRENKPGISNLLSIYSGLTNES-IKNIESXXXXXXXXXXXXD--
SYW_VIBPA       NVITLLEEPKSIIKKINKAQTDTETPPSRHDVENANLMGLY-SAATGMSFEEIEAKY-KGVEMYGPFKKD
SYW_STAEQ       NQISLLDEPHVAAKKIKSAVTDSDKFDRENKPGISNLLSIYSGLTNDS-IKNIESXXXXXXXXXXXXD--
SYW_STRA5       NGIFLADDMDTVKKKVMSMYTNHIKVEEPGQIEGNMVFDVFGRDEDQKEITAMKEHYQKGGLGDVKTKRY
SYW_STRA3       NGIFLADDMDTVKKKVMSMYTNHIKVEEPGQIEGNMVFDVFGRDEDQKEITAMKEHYQKGGLGDVKTKRY
SYW_VIBF1       NVITLLEEPKSILKKINKAQTDAEMPENKAGISN--LMGLYSAATGKT-FEEIEAQY-QGVEMYGPFKKD
SYW_SHEON       NVIGLLEDPKAVMKKLKKAMTDSDEPDIENKPGVSNLLSLMSGITGQS-IASLEAEF--EGKMYGHLKGA
SYW_STRR6       NGIYLADDADTLRKKVMSMYTDPRVEDPGKIEGNMVFLDVFGRPEDAQEIADMKERYQRGGLGDVKTKRY
SYW_STRPN       NGIYLADDADTLRKKVMSMYTDPRVEDPGKIEGNMVFLDVFGRPEDAQEIADMKERYQRGGLGDVKTKRY
SYW_CLOLO       NAIYLADEADVIKQKVMSMYTD---PNHIKDPGQVTVFTYLDTFCKDTELEEMKAHYSRGGLGDVKVKKF
SYW_MYCPE       NTKTIFLLDKDVRKKIMQAKTNKVKYDVENQPGVSNLMTIYSCLTNK-KTDEIEKEF--ENKNYGEFKTK
SYW_VIBVU       NVITLLEDPKSIIKKINKAQTDTETPPRAHDWDNSNLMGLY-SAATGMSFEEIEAKY-QGVEMYGPFKKD
SYW_PORGI       NAIYLADDAKTISKKVMKAVTDAEVPNSVKPEPVENLFSMLRIVSSDEVYRHFDDLYNNCSIRYGDLKKQ
SYW_VIBVY       NVITLLEDPKSIIKKINKAQTDTETPPRAHDWDNSNLMGLY-SAATGMSFEEIEAKY-QGVEMYGPFKKD
SYW_VIBCH       NVITLLEDPKSIIKKINKAQTDAETPDVENKAGIANLMGLYSAATGKT-FAEIEAQY-AGVEMYGPFKKD
SYW_CORGL       NPKGIINLPKVSTKRIKSAVTDNDDPENKPGVSN---LLVIQSALTGTSIDSLVDGY--QGAGYGALKGD
SYW_BRUSU       SDLSRINLEDTITKKIRKAKTDSDLPSEEGRPEADNLVGIYAALSSTTKEDVLKE---FGGRQFSDLKAS
SYW_BRUME       SDLSRINLEDTITKKIRKAKTDSDLPSEEGRPEADNLVGIYAALSSTTKEDVLKE---FGGRQFSDLKAS
SYW_SYNPX       NRITLLDPPELITKKIKRAKTDPKRGLEFSNPDTDNLLGLYAILSGKGREAAADE---CADMGWGQFKPL
SYW_BUCAP       NKNNVIFLLENISSVFFKIVTDSETPDVKRKLGISNLLEILSAITNK-EIFILEKEF--DGIMYSEFKNI
SYW_BUCAI       NVIFLLDDIKTVISKIQNAYTDSETPSKEKKPGISNLLEILSAITNKDIDILLKE---LEGMLYSEFKNI
SYW_CAUCR       TADDIAAKVKKARTDPEPLPETIEELATRAEADN--LVGIFAALAGKTKAEVLAD---YAGKGFGTFKPA
SYW_GLOVI       SDLSLLDAPEKLRDKIKRAKSDAVM-GLKFDPPECTLLTIYQLLSGESP-EAVEARF--ADAGFGRFKPI
SYWM_SCHPO      NYILLSDSTGEIRKKISRAQTDNIKGITYGDSNRPGINNLINIFAAISDSTPSDIAQANASCSNAEFKEK
SYW_THEEB       SELSLLDSPDEIRKKIKRCKTDPIRGLAFDDPDRNNLLSLYQVLTGKTKEAVAAE---CADMGWGQFKPL
SYW_BACSU       NQITLLDEPKQLEKKIKSAVTDSEKFDKENKPGVSNLLTIY-SILGNTTIXXXXXXXXXXXXXXXXXD--
SYW_BUCBP       NVIFLLDNLSSVKKKIKLAVTDSDNPPDKDTKIGISNLINILSCFQNRDISDIEKEFYY--YSYQDFKSV
SYW_BRAJA       NSINLTDDADTIAQKIRKAKTDPELPTEEKGPEADNLVGIFAALADRSKADVLRD---FGGGQFSSFKNA
SYW_ANASP       SELSIANKIKRCKTDPVKGLTFDD-PERPECNNLLTLYMLLSGKKKEEVAAECQD------MGWGQFKPL
SYW_AGRT5       SDLSRINLVDAISKKIKKAKTDDALPSEKGRPEAENLVGIYAALSDKTKADVLAE---FGGQQFSTFKPA
SYW_RALSO       NTIRMREDKASVEKKVRTMPTDPARVRDPGDPGKCPVWQLHQVYSDADTREWVQKGCRSAGIGCLECKQP
SYW_COREF       NPKGLINLPKVSSKRIKSAVTDNDAFDVANKPGVSNLLVIQSALTGES-----VDKLVAGGKGYGALKTD
SYWM_CAEEL      SRIEITDSRSTIIEKCQKAQSDNAGKVTYDKENRLAVSNLLDLYSAVTKTQTSEIDF----SNWTDLKMN
SYWM_BOVIN      DTVRITDSPEEIVQKFRKAMTDSEVTYEPASRGGVSLVAIHAAVAG---LPVEEVVRRSAGMDTARYKLV
SYW_MYCLE       SDAGLINLLDDPALSVKKIVTDSERPEVKPGVSN---LLNIQSAVTGVDVDTLVQRYV--GHGYGDLKKD
SYWM_DICDI      SRISLTDTDDQIKLKIKKSKTDT-IIGITYDPINRPDISNLLSIASETSITDLQSEF--KDKSNAIFKEF
SYW_MYCTU       TDAGLINLPALSAKKIRSAVTDSERPDVKPGVSN---LLNIQSAVTGTDIDVLVDGY--AGHGYGDLKKD
SYW_MYCBO       TDAGLINLPALSAKKIRSAVTDSERPDVKPGVSN---LLNIQSAVTGTDIDVLVDGY--AGHGYGDLKKD
SYW_LEIXX       SGAGIVWLLDEARKKIMRAVTDTDSYDRAGKPGVSNLLSIYSALSGRA-IQQIELDY--EGKGYGDFKKG
SYW_WIGBR       NFISLLDQPYSIIEKIKNAKTDSDNPPKIKKPGISNLLSIISELRG-INIKDLEISF--KNKSYKYLKNE
SYW_UREPA       NLVIFLNDSKDIIFKKIKGALTDNLNKVKYDPGVSNLMTIYACL-TNLSFKEIELKYQQ--QNYGVFKND
SYWM_HUMAN      DTVRITDSPEEIVQKFRKAVTDFTSEVTYDPAGRAGVSNIVAVHAAVTGLSVEEVVRRSAGMNTARYKLA
SYW_THETN       NRVNLLDDPDTIYRKIMKAVTDSESEDWEKKPGISNLLTIY-SLFTGMEVDEVVNKF--KGQGYGTLKKE
SYW_RHILO       SDLSRINLADTISKKIRKAKTDPELPSEESRPEAENLVGIYAGLAEMSKADVLKE---FGGQQFSVFKPA
SYW_MYCPN       NQNGVIYLDDPKEVVVKKI---------------------------------------------------
SYW2_STRAW      GIVYLLDEPEAVRKKVMRAVTDSVVYDRESRPGVSNLLEILAACEGGSP-EALSGAYAS----YGALKKD
SYW_TROW8       GTIFLLDSPDKIVKKIMRSVTDSEDVDRETKPGVSNLVVMYSCL---TDCTIEQTVNIYSGKKYSVLKKD
SYW_TROWT       GTIFLLDSPDKIVKKIMRSVTDSEDVDRETKPGVSNLVVMYSCL---TDCTIEQTVNIYSGKKYSVLKKD
SYW_RHIME       SDLSRINLADTILKKIRKAKTDDALPSEKDRPEAENLVGIYAALADRSKEEVLAE---FGGQQFSTFKPA
SYWM_MOUSE      XTVRITDSPEEIVQKFRKAVTDFTSEVTYEPDSRAGVSNMVAIHAAVSGLSVEEVVRSSAGLDTARYKLL
SYW1_STRCO      GIVYLLDEPDVVRKKVMRAVTDSGRDVVYDPEERAGLANLLEILAACTDGEPAE---LAGGYSYGALKKD
SYW2_DEIRA      NAIALGDSADEVARKVMGMYTDPRASDPGRVEGNPVFTFLDAFDPDPARVQALKDQYRAGGLGDVKVKKH
SYW1_STRAW      TPKGLINLXXXXXXXXXDTDTVIRYDAEHK-PGISNLLTIYSTLTG-TGIPELEEKYT--GKGYGALKTD
SYW_AQUAE       NAVFFSDXXXXXXXXXXXXFTDPQ-KIRKNDPGRCPVFSWHKLFTKDEEVKKIEEDCRAGRLGCVECKRI
SYW_MYCGA       XXXGIINLDDSREEVLSKIKSNKVNFDYKTQPEISNLVSIYLGLKSAKFNKALDEEVVPIDISYKDFKEE
SYW_MYCGE       GVIYLDDSKETIIKKVRKATTDS-----------------------------------------------
SYW_METJA       ETIFLTDDEKTVKKKIFSAKTGGRLEEHKKYPEECVVYELYHLILDDKELAEIYQKCRSGELTCGKCKKM
SYW_AERPE       STIFLTDPPEVARNKLFRALTGGRATAEEQRPEVCSVYDLYHLMPDDGEVKHIYTSCRLGKILCGECKQI
SYW_SULTO       TAIYLTDDPKTVERKIMKYAFSGGQPTHRKYGGNPDIDVSFQWLPDDNKIKKIEEDYRSGALLTGELKQI
SYW_SULAC       TAIYLTDDPKTVERKIMKYFSGGQATVERKYGGNPDIDVAFQWLPDDQRIRKIEEDYRSGAMLTGELKQI
SYW_HYPBU       YTIFLTDPVDIAVRKLKRALTGGRATVEEQEPEKCTVFYLYHLIEDDTQLRKIYEDCRGSRLLCGPDKEY
SYW_PYRFU       TAIYLTDNPEEAGKKIWKFALTGGQPEKGGNPEKCVVFK-WLEIFFEPDDKKLMERYYAGELLCGECKRY
SYY_PICTO       DS-AIFMTDS--NDDIKRKIKNAYCPMKEVNGNKYIIFPYYNDKISDVDMDSLTRMYISGEIHPVDLKNA
SYW_PYRCJ       NS-AIYTIEKTIRRKIANAYTGGRPTAEEQNPDVCPVYHYH--MLFDPDDASVEKIYKSGALLCGECKQM
SYW_THESM       TAIYLTDDPEEAGKKIWKYATAKEQRELGGEPDKCVVFK-WLEIFFEPDEKKLLERYIAGEILCGQCKRY
SYW_PYRAE       SAIYTLDDEKTVRRKVMNAFTGGRPTAEEQNPEVCPVFHYHMLFPDDASVEKIRQDCKSGALLCGECKLK
SYW_PYRAR       PDSAIYTMDKTVKHKILNAFTGGRPTAEEQNPDICPVFHYHMLFPDDASVEKIRQDCKSGALLCGECKLK
SYW_PYRHO       TAIYLTDSPEDVEKKVWKFTLTGGRPEKGGEPEKCVVFK-WLEIFFEEDDKKLKERYYAGELTCGECKRY
SYW_PYRAB       TAIYLTDSPEDVEKKVWKFALTGGRPEKGGEPEKCVVFK-WLEIFFEEDDKKLKERYYAGELTCGECKRY
SYW_METKA       NT-AIFAKEKVWNAKTGGGATLEEHREHGGNPDECVVYELMDRIGGDEKLREIRKKCREGDIICGECKRM
SYW_SULSO       TAIYLVDDPKTVERKIMKYAFSGGQPTHRKYGGNPEIWLYYFFEEDDNRIKEIEEEYRSGKMLTGELKQI
SYY_METBF       NFISVDDTERKLKKAYCKIGDTEENP--------------------------------------------
SYY_METMA       NFISVDDTEEEIYRKFKKAF--CKMGDVEENP----ILALFRHIFPRYETIVIERPEKFGG---------
SYW_PYRKO       TAVYLTDDPEEAGKKIWKFALTGGQPEKGGNPEKCVVFKWFE-IFFEPDDEKLMERYKAGELTCGQCKRE
SYY_METBU       NYISV-----------------------------------------------------------------
SYW_THEON       TAIYLTDDPEEVGRKIWKYATAKEQREKGGEPEKCVVFK-WLEIFFEEDDKKLMERYHAGELLCGQCKRY
SYY_ARCFU       NYISVRDPPEEVERKIRKAYCPAGVVEENPDIAKYHILPRFGKIGGDVEYASFEEDFKSGQLHPLDLKIA
SYY_METAC       NFISIEDIYRKFKKAFCKI---------------------------------------------------
SYW_THEVO       ----------------------------------------------------------------------
SYY_THEVO       NSAILINDE---YKDIERKVNAAFCPPEKVDGN-------------------------------------
SYW_METAC       SQIALTDSPKEGAKKVKRAKTGGTLEEQKKKPEECSVFELFHLIASDEELLEIKQECISGTRMCGSCKQL
SYW2_HALSA      VSIRLTDSPDTVREKVTHAYTGGRASVEEHRPAEDVPFQYLSAFPDDAELARIEREYRAGDLLSGELKDL
SYY_THEAC       NS--------------------------------------------------------------------
SYY_METMP       NFIAVDDDEATIKKKMMKEVSGNPVLEIAK------YYLKYPATVKRPEYEALENAFVEG-LHPMDVKNL
SYW_THEAC       ----------------------------------------------------------------------
SYY_METTH       NFIAVDDSPDEIREKVKK----------------------------------------------------
SYY_METMJ       NVISVADSEEDIKKKMKKAFC---PPEVENNP--------------------------------------
SYY_METHJ       NYISVAESEEDIRKKMKKAF----CPPEVED--NPVLQVLQHHIFPRLDTVTIERPEKFGG---------
SYY_METKA       NFIAVDDEPEVIREKLRK----------------------------------------------------
SYY_METVS       NLIAVDDDEVTIKNKLMKEVFGNPVLEIARYPVNINRPEKYGGNLVLNNYGELETAYIE-GLHPMDVKTL
SYY_METLZ       NVVSVADSPEEIKKKMKKAFC---PPETEGNPFRYNVFPRMDTIAIRRSYAELEAAYAGGKIHPMDLKAA
SYW_ARCFU       SYISLLDPPEEGAKKVMKAFTGGRATAEEQEPDRCVVFELYSLIDSDEELNQIEAECREGRLLCGKCKKM
SYY_SYNY3       NYVGLLSMYSKLEKEYFELLTNLDLAELPENPREC-----------------------------------
SYW1_HALSA      ----------------------------------------------------------------------
SYY_METJA       NFIAVDDSPEEIRAKIKK----------------------------------------------------
SYY_AQUAE       NYVGITEDPKTMFAKIMSI---------------------------------------------------
SYY2_BACSU      NYIGIMSLPDSLMKKYIHLATDLELEEKKQ----------------------------------------
SYY_SULAC       DYLATIKMSKSKPETAIFIHDSPELVESKLKNSYC-----------------------------------
SYY_PROMT       NIVGILSMYSKLEK--------------------------------------------------------
SYY_SULTO       ET-AIFVVEAKLRSAYCPVIDNPVLQINKYAKDNATL-KVERDIKYGGDIEELEKIYSEGKLHPLDLKLA
SYY_PROMP       NTVGLLSMYSKLEKVPDNII--------------------------------------------------
SYY_PROM9       NTVGLLSMYSKLEKVPDNII--------------------------------------------------
SYY_HAEI8       NYIGVTEAPSDMFGKVMSI---------------------------------------------------
SYY_HALSA       VTISMEDSTADIEEKV----TGAFCP-QTRDPEGETV---------------------------------
SYY_HALS3       VTISMEDSTADIEEKV----TGAFCP-QTRDPEGETV---------------------------------
SYY_HAEIN       NYIGVTEAPSDMFGKVMSI---------------------------------------------------
SYY2_BACLD      NYIGIMSLPDSLMKKYIHLATDLEAEEKKR----------------------------------------
SYY_SULSO       ES-AIFVNDS--REDVERKIMGAYCPKGVAENNKYIIFPRYNFVKIERDIEELERTYIEGKIHPMDLKKT
SYY_COXBU       NYIGITEPPEEMFGKVMSI---------------------------------------------------
SYY_SYNSC       NVVGLLSMYSKLEK--------------------------------------------------------
SYY_SYNPX       NVVGLLSMYSKLEK--------------------------------------------------------
SYY_PROMM       NTVGLLSMYSKLEK--------------------------------------------------------
SYY_PASMU       NYIGVAESPTEMFGKVMSI---------------------------------------------------
SYY_GLOVI       NYVGVLTMYSKLEK--------------------------------------------------------
SYY_SYNS9       NTVGLLSMYSKLEKDYVTLLTDEALPENPREKQKAMALAV-TATRHGTDAAALDAGNLVGGAG-------
SYY_SULIY       ES-AIFVSDS--REDVERKIMGAYCPKGVAENNKYIIFPRYNFVKIERDIEELERAYIEGKIHPMDLKKA
SYY_SULIN       ES-AIFVSDS--REDVERKIMGAYCPKGVAENNKYIIFPRYNFVKIERDIEELERAYIEGKIHPMDLKKA
SYY_SULIM       ES-AIFVSDS--REDVERKIMGAYCPKGVAENNKYIIFPRYNFVKIERDIEELERAYIEGKIHPMDLKKA
SYY_SULIL       ES-AIFVSDS--REDVERKIMGAYCPKGVAENNKYIIFPRYNFVKIERDIEELERAYIEGKIHPMDLKKA
SYY_SULIK       ES-AIFVSDS--REDVERKIMGAYCPKGVAENNKYIIFPRYNFVKIERDIEELERAYIEGKIHPMDLKKA
SYY_SULIA       ES-AIFVSDS--REDVERKIMGAYCPKGVAENNKYIIFPRYNFVKIERDIEELERAYIEGKIHPMDLKKA
SYY_MANSM       NYIGVTDAPNDMFGKIMSI---------------------------------------------------
SYY_LEGPL       NYIGINETSEQMFGKIMSV---------------------------------------------------
SYY_HALMA       ----------------------------------------------------------------------
SYWC_DICDI      NSAVYLSVKDKIKKHAFS-GGGATKEEQEKNGADLSVDITYEYLTFMLELKDIAHRYSTGKMMTGEIKQI
SYY_LEGPH       NYIGINETPEQMFGKIMSV---------------------------------------------------
SYY_LEGPA       NYIGINETPEQIFGKIMSV---------------------------------------------------
SYY_AZOSE       NYIGITEAPREIFGKIMSI---------------------------------------------------
SYY_AERPE       ET-AVFVVD-------------------------------------------------------------
SYY_PROMA       NTVGLLSMYSKLEK--------------------------------------------------------
SYY_HAEDU       NYIGVTEAPNEMFGKVMSI---------------------------------------------------
SYY_BORPE       NYIGISEAPESMFGKLMSI-------------SDTLMWRYYESFRSLADIAALKAE-IDGGRNPRDAKVA
SYY_BORPA       NYIGISEAPESMFGKLMSI-------------SDMLMWRYYESFRSLADIAALKAE-IDGGRNPRDAKVA
SYY_BORBR       NYIGISEAPESMFGKLMSI-------------SDTLMWRYYESFRSLADIAALKAE-IDGGRNPRDAKVA
SYY_THET8       NYIGLTEPPEAMFKKLMRV---------------------------------------------------
SYY_THET2       NYIGLTEPPEAMFKKLMRV---------------------------------------------------
SYY_THEMA       NYIALMSIPDELIIKYMRLLTD--IPEER-----------------------------------------
SYY_HELPY       NYVGITEEPNAMFGKIMSV---------------------------------------------------
SYY_DESPS       NYIGITEDADSIYGKVLSV-------------SDDLMFRYYELLSDLTEIADLRAQMEAGTLHPKEVKKQ
SYY_BACSK       NYIGIDEAPNEIFGKAMSI------PDE--------LMVKYYKLATDVEIEALEKGLADGSVHPRDAKMR
SYW_METTH       KSAIFLSAEAKIRN--AKTGGRETLKEQREVPEECIIYLLYHMSGSDSRLEEIYESCRNGTLMCGECKNN
SYY_PHOPR       NYIGVSEVPTEMFGKIMSI---------------------------------------------------
SYY_CAMJE       NYIGVTEKANDMYAKILSI-------------SDELMFRYYELLSQKSEIAQIKKDIEQGNLHPKKAKEN
SYY_THIFE       NFIAVEDPPAEMFGKIMSI---------------------------------------------------
SYY_PYRIL       ----------------------------------------------------------------------
SYY_HALLT       VTISMEDSREDIESKVNDAYCPRTADPEPTDDGQSRVFPRFDTVVVEDSYDALEAELESGELHPADAKGA
SYI_PEDPA       NTIVPDEINKKMGAEIIRL---------------------------------------------------
SYY2_PYRAE      EVYAMYKMSKS-KPQSAILITDSEEDVRKK----------------------------------------
SYW_METMA       SHIALTDDPKEGAKKVKRAKTGGTLEEQKKKPDECSVFELFHXXXXXXXXXXXXXXCIYGTRMCGSCKQL
SYY_NITOC       NYIGISEPPREIFGKLMSI---------------------------------------------------
SYY_ANASP       NYVSLSGVPDVLLKDYFELLTNDALPENPRDRQMLLAWEIVK----------------------------
SYY_FRATT       NYIGIEEPANEIFGKIMSI---------------------------------------------------
SYY_THEON       YS-AVFEIKQKLRKKYNPVLDWAEYIIFREEPTEFTIHAKFGGDVTYTTFEELKRDFAEGKLHPLDLKNA
SYY_PELCD       NYIGITEPAKEVFGKVMSI---------------------------------------------------
SYY_HELHP       NYIGVTESANTMYAKILSI---------------------------------------------------
SYY_ANAVT       NYVSL-----------------------------------------------------------------
SYY_SULDN       NYIGVSENPNEIFGKVLSI-------------SDELMWRYYELLSTKTEIERLKSGVEAGTLHPKKVKEE
SYY_SHEON       NYIGVSEPANEMFGKIMSI---------------------------------------------------
SYY_RALSO       NYVGISEAPNEMFGKLMSI---------------------------------------------------
SYY_LEPIN       NYVGIMSISDDLMWNYFELLTDLPLPEIENRKN-------------------------------------
SYY_LEPIC       NYVGIMSISDDLMWNYFELLTDLPLPEIENRKN-------------------------------------
SYY_CAMJR       NYIGVTEKANDMYAKILSI---------------------------------------------------
SYY2_VIBVY      NYIGVSEAPSEMFGKIMSI---------------------------------------------------
SYY2_VIBVU      NYIGVSEAPSEMFGKIMSI---------------------------------------------------
SYY2_CLOAB      NYIGIEESAKDMYVKVMQI---------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LFEKINEYLRDAREKYDYYINNPKIVDDILNQGAAKVRPLAKDKLKEVKDIIGM
SYW_PSEAE       LFQLLDNELGEARERYQALIAKPDDIEDILLAGAAKARRIATPFIAELREAVGL
SYW_NEIMA       LAAKINAELAEPRERYNELTADPSQIEEILQAGAQKARKEARELLGKVRDAVGI
SYW_PSEPK       LFQLLDGQLAEKREYYHQLIARPADLEDILLAGAAKARKIATPFLEQLREAVGL
SYW_XANAC       VFERIDQEIAPLRTRYEGLIAEPRIEXXXXXXXXXXXXXYATPLLAELRDAVGL
SYW_NEIMB       LAAKINAELAEPRERYNELTADPSQIEEILQAGXXXXXXXXXXXXDKVRDAVGI
SYW_XANCP       LFERIDLEIAPLRARYEALMAEPAKIE---------------------------
SYW_PSESM       MFTLLDEQLGEAREQYLSLIERPADLEDILLAGAQKARRVATPFLEELREAVGL
SYW_BORPE       LYERLERDLAPMRERYVELISNPGLIEDILQVGAAKARKLAQPLVRTLRDAVGL
SYW_BORPA       LYERLERDLAPMRERYVELISNPGLIEDILQAGAAKARKLAQPLVRTLRDAV--
SYW_BORBR       LYERLERDLAPMRERYVELISNPGLIEDILQAGAAKARKLAQPLVRTLRDAV--
SYW_XYLFA       LFERIDAEVAPLRERYEDFMRRPADIEAMLCDSAGRLRERAIPLLARLREAVGL
SYW_XYLFT       LFERIDAEVAPLRERYEDFMRRPADIEAMLRDSAGRLRERAIPLLARLREAVGL
SYW_FUSNN       LLNSILEYFGTAREKREELEKNMDYVKDVLNEGSKKAR----------------
SYW_CAMJR       LNELVNAYFKEAREKYNELLEKPSHLKEILDFGATKARKIAQEKMQKIYEKIGL
SYW_CAMJE       LNELVNAYFKEAREKYNELLEKPSHLKEILDFGATKARKIAQEKMQKIYEKIGL
SYW_RHOBA       VAEVSEEYFAPARAKREELESDLDTVRDILAEGAKRAREVAASVVDRARRNCGL
SYW_LISMF       LAELVVAELEPIQERYYAYLKSEEL-DTILDAGAEKAARVANKTLKKMENGVGL
SYW_LISIN       LAELVVAELEQIQERYYAYLESEEL-DNILDAGAEKAARVANKTLKKMENGVGL
SYW_HAEIN       VADEVSTLLASLQERFHQYRNDETLLDNILRQGAEKARAKAQETLAKVYEAVG-
SYW_PASMU       VADEVSAMLTTLQERFHHFRNNEALLNDIAREGAQKARERAKATLDAVYQAVG-
SYW_LISMO       LAELVVSELEPIQERYYAYLKSEEL-DTILDAGAEKAARVANKTLKKMENGVGL
SYW_DEIRA       LMTHITEHLDPIQTRAAQLRADPDYVRDALRQGDQEARAIASEVMDEVRQKVG-
SYW_WOLSU       VAEAVIEGLKPIQERYAKLTKEQGYLEEVLSHGASEVRKIAQKTYKEVKERVGL
SYW_CHLTR       LAEEINLFLNPFREKRSELVAQPKFLEEALQQGTEKMRTVARETMEEVHDHLGL
SYW_BACAN       LAQVVVEAIRPIQDKYNELINSPEL-DEILDKGAEKANRVAFKQLRKVENAMGL
SYW_YERPE       VADAVSGMLSELQERYRTYREDEALLQDVMREGAAKARARAQVTLAKVYEAIG-
SYW_CHLMU       LAEEINLFLNPFREKRSEFVAQPKILEEALQKGTEKMRSVARETMEEVHNNLGL
SYW_SALTY       VAEAVSGMLSELQERYHRFRNDEAFLQKVMKDGAEKASARAAETLKAVYEAIG-
SYW_SALTI       VAEAVSGMLSELQERYHRFRNDEAFLQKVMKDGAEKASARAAETLKAVYEAIG-
SYW_BORBU       LFLALNSFLKPIRDKRSFYEAKKKYIDEIIFDGTSKARFIANKVVKDVKDLIGL
SYW_RICFE       LAEIIITNLQPIRDKYLELMNDKEYLLKILHKGAEKARIRASETVNEVKEQFG-
SYW_KLEAE       VAEAVSGMLIDLQERYHRFRNDEAFLNQVMKDGAEKASARASQTLKAVYEAIG-
SYW_CHLPN       LAEELIHFLKPIKERRSEFLSKPLALQNVLEDGTHKMREVAKVTMEEVHDKFG-
SYW_HAEDU       VADQVMAMLTGLQERYQRFRQDEALLEKIYRDGAEKARMRAKKTLDEVYKLIG-
SYW_ECOLI       VADAVSGMLTELQERYHRFRNDEAFLQQVMKDGAEKASAHASRTLKAVYEAIG-
SYW_SHIFL       VADAVSGMLTELQERYHRFRNDEAFLQQVMKDGAEKASVHASRTLKAVYEAIG-
SYW_RICCN       LAEIIITNLQPIRDKYLELMNDKEYLLKILHKGAEKARIRASETVNEVKEQFG-
SYW_HELPY       LAEVMIQALKPIQERYKEISDDE--VKAILNGGAEKARPLARATYQKAKELMGL
SYW_ECOL6       VADAVSGMLTELQERYHRFRNDEAFLQQVMKDGAEKASAHASRTLKAVYEAIG-
SYW_ECO57       VADAVSGMLTELQERYHRFRNDEAFLQQVMKDGAEKASAHASRTLKAVYEAIG-
SYW_PROMA       LTDAIIESLNPIQQKYYSLIKDKTELNNILNKGYIKANTISNQTLKRVRNALG-
SYW_HELHP       LAEVIIESLRPIQQSYAKISQDKTYIQSVLTKSADSIRPIAKNTYENAKRLVGL
SYW_BACST       LAQVVIETLRPIQERYHHWMESEEL-DRVLDEGAEKANRVASEMVRKMEQAMGL
SYW_ENTFA       XXXXXXXXXXPIQVRYQELLASEEL-DMILDEGAENARLVANKTLQRMKNAVGL
SYW_CLOTE       VAEAIIAEVEPLQKEVKRYLEDKSYLEKVYKEGAQKASYVANKTLSKMKRKIG-
SYW_CHLCV       LAEELIRFLQPFREKRAELLAHPKILQEALQKGTENMCALAKETMEEVHNTL--
SYW_RICTY       LAEIIITNLQPIRDKCLELMNDKEYLLKILHKGAEKAKIRASETVNEVKKQFG-
SYW_BLOFL       VIQELSCMLKDLQCRYISERSNEGKLNHILNVGSQKARMQAQITFKKVNELMG-
SYW_RICPR       LAEIIITNLQPIRNKCLELMNDKEYLLKILHKGAQKARIRASETVNEVKKQFG-
SYW_PROMP       FTEQIIESLKPIQERYQVLINDPHELNKILIQGKEKAEVVANKTLSRVKSELG-
SYW_CLOAB       VADALIQELEPIQNKVNELLKDKAYLQDICKKGAQKASYIANKTVSKMMRKVG-
SYW_CLOPE       VAEAIVEELAPVQEKVKALLGDKKALEEIYKKGAEKANYAAMKTLRKMQKKIGL
SYW_THEMA       XXXXXXXXXAPIWENFRKIDEDPHYVDDVIMEGTKKAREVAAKTMEEVR-----
SYW_HELPJ       LAEVVIQSLKPIQERYQEISDDE--VKAVLNCGAEKARPLARATYQKAKELMGL
SYW_RICBR       LAEIIITNLQPMRDKYLELMNDQEYLLKILHQGAEKARVRASETVNELKEQFG-
SYW_MYCPU       VGNSVKNFLTKLQAKYQ---ENYKRVDEILNQGKIKAQKVASYNLNNLMKKIGI
SYW_SYNY3       LTETAIAALEPIQAKYAEILADRGELDRIIQAGNAKASQTAQQTLARVRDALG-
SYW_STAAW       LAEIVKAFLVEFQEKYESFYNSDKL-DDILDQGRDKAHKVSFKTVKKMEKAMGL
SYW_STAAS       LAEIVKAFLVEFQEKYESFYNSDKL-DDILDQGRDKAHKVSFKTVKKMEKAMGL
SYW_STAAN       LAEIVKAFLVEFQEKYESFYNSDKL-DDILDQGRDKAHKVSFKTVKKMEKAMGL
SYW_STAAM       LAEIVKAFLVEFQEKYESFYNSDKL-DDILDQGRDKAHKVSFKTVKKMEKAMGL
SYW_STAAC       LAEIVKAFLVEFQEKYESFYNSDKL-DDILDQGRDKAHKVSFKTVKKMEKAMGL
SYWM_YEAST      VSEVIIEELKGPRTEFEKYINEPTYLHSVVESGMRKAREKAAKNLADIHKIMG-
SYW_STAAR       LAEIVKAFLVEFQEKYESFYNSDKL-DDILDQGRDKAHKASFKTVKKMEKAMGL
SYW2_STRCO      LADVVVEFVTPFRERTRQYLDDPETLDAILAKGAEKARSVAAETLARAYDEVG-
SYW_STRP8       LLDILERELAPIRERRLEYAKDMGEVFRMLQEGSQKARTVAAKTLSEVKSAMGI
SYW_STRP6       LLDILERELAPIRERRLEYAKDMGEVFRMLQEGSQKARTVAAKTLSEVKSAMGI
SYW_STRP3       LLDILERELAPIRERRLEYAKDMGEVFRMLQEGSQKARTVAAKTLSEVKSAMGI
SYW_STRP1       LLDILERELAPIRERRLEYAKDMGEVFRMLQEGSQKARTVAAKTLSEVKSAMGI
SYW_TREPA       LARALNTFLEPIRARRAQLEQQPAYLARVLEEGCARMRAEARKTMQRVKEAMGL
SYW_STRMU       LLDILERELTPIRRRRLEYEKNMDQVLDILKKGSETARETASETLSGVKRAMGI
SYW_PROMM       LADATVSALEPIQHRYQQLMGDRIELIRVLDQGRTRAEETAQATLQRVRQALG-
SYW_OCEIH       VANAVIDTLRPIQEKYEQLIQSDEL-DAILDQGRDKASFSAGKTIKKAKKAMGL
SYW_PHOLL       VADAVSGMLTELQERFHYFRND--------------------------------
SYW_LACLA       LLDVLDRELSPIRERRIEFAQNMDYVYDMLKAGSLKAQAVASQTLDEVKSAMGI
SYW_BACHD       LAQVVVDTLKPIQERYEQLIQSEEL-DHILDQGADKANRVARKTLEKAERAMGL
SYW_STAES       LSEIVKDFLINFQEKYASFYNSDDL-DDILDKGKEKAQKASFKTLKKMEKAMGL
SYW_VIBPA       VGEAVVAMLEPIQEEYRRIRADRAFMDEVMKQGAEKASARAAETLKKAYEAVG-
SYW_STAEQ       LSEIVKDFLINFQEKYASFYNSDDL-DDILDKGKEKAQKASFKTLKKMEKAMGL
SYW_STRA5       LLDILERELSPIRERRLEYAKDMGQVYQMLQKGSEKAQAVAASTLDEVKSAMGL
SYW_STRA3       LLDILERELSPIRERRLEYAKDMGQVYQMLQKGSEKAQAVAASTLDEVKSAMGL
SYW_VIBF1       VGEAIVTMLEPIQEEYKRIREDRAYMDAVMKAGAEKASERAAVTLKKAYEAVG-
SYW_SHEON       AGEAVVGMLEPLQEXXXXXXXXXXXXXQVMRAGAENAQARAEVTLKKVYEKIGL
SYW_STRR6       LLEILERELGPIRERRIEFAKDMGEVYNMIQKGSERAREVAGQTLSEVKGAMGL
SYW_STRPN       LLEILERELGPIRERRIEFAKDMGEVYNMIQKGSERAREVAGQTLSEVKGAMGL
SYW_CLOLO       LNEILQAELEPIRNRRKEFQKDIPEVYRILKEGSEKAREVAAGTLKEVRETIGI
SYW_MYCPE       VADAVCLLLEDIQKKYQIYFNSNEI-EQKLEKNAKKCNEIVNKKINLVQQTLGL
SYW_VIBVU       VGEALVSMLEPIQAEYHRIREDRGYMNEVMRQGADKASARAAETLKKVYEVVG-
SYW_PORGI       LAADIVAFTTPIRER---------------------------------------
SYW_VIBVY       VGEALVAMLEPIQAEYHRIREDRGYMNEVMRQGADKASARAAETLKKVYEVVG-
SYW_VIBCH       VGEAVVAMLEPVQAEYQRIRNDREYLNSVMRDGAEKASAKALQTLKKVYAAVG-
SYW_CORGL       TADALEAFTTPLKAKYDEYMNDRGELERVLAIGAERATEVANETLADVYDKIG-
SYW_BRUSU       LADLAVARLSPITHEMRRLVADPAHIDSVLRDGGEQAGAIAEQTMRHVRDIVG-
SYW_BRUME       LADLAVARLSPITHEMRRLVADPAHIDSVLRDGGEQAGAIAEQTMRHVRDIVG-
SYW_SYNPX       LADAAVAALEPIQARHKELMADRVELDRVLAKGRDQAESVANASLERVRDALG-
SYW_BUCAP       VFDNISKFLHKLQKSYLIYRKDESYLKNIAKEGAIKARLKSEKILKRV------
SYW_BUCAI       VADHLSKFLYKLQKSYNDYRNDEVYLKKIAYEGAMKSQLKSNKTLTKVYDKLGL
SYW_CAUCR       LAELAVESLAPVGERMRGLLGDPAVLDAILXXXXXXXXXXXXPTLAEVKKLVG-
SYW_GLOVI       LADLVIEYLRPIRERYDAIAGESGYLEGILREGALRASKVAGLTLERIRDRMGL
SYWM_SCHPO      VSSAIIRCLQPISTSFNEWRQNRELLRDIAKKGXXXXXXXXSSCMHKLKTLTGL
SYW_THEEB       LTDAVIATLEPIQQRYNEIMADPSYLKDLLKKGQEQAATVANATLERVKLAFG-
SYW_BACSU       LAEVVVNALKPIQDRY-YELIESEELDRILDEGAERANRTANKMLKKMENAMGL
SYW_BUCBP       VIKEIVNFMTNFQNLYFSFRKNEDYLEKILSEGSKRASWYAKKLLKKVKTSMGL
SYW_BRAJA       LAELCVTKLAPIAGEMKRLVADPGHIDAILNEGSDRARAIADETMKLSKDIVG-
SYW_ANASP       FTETAINALKPIQEKYQEITADKGYLESVLRDGREKAETVANQTLADVKAALG-
SYW_AGRT5       LVELAVNVLAPVNNEMRRLLDDPTHIDAILSQGGERARTIAEKTMNEVRDIIG-
SYW_RALSO       VIDGILREQQPMLERAQKYMDDPSLLRAIIADGCDTAHKVTQETMREVREAMGL
SYW_COREF       TADALEAFTTPLRAKYDEYMSDRAELERVLAIGAERAGEIATKVLAEVYDKIG-
SYWM_CAEEL      LAEAVDKRLAPIRQKFE-ELQNTGEVDKVLTENGEKAREIAEKNLEEIRRTIG-
SYWM_BOVIN      VADAVIEKFAPIKSEIEKLKMNKDHLEKVLQVGSARAKELAYPVCQEVKKLVG-
SYW_MYCLE       TAEAVVEFVSPIKDRVDELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLG-
SYWM_DICDI      LSNSIIKNISPIREKINYYQSNPKLVRDILLQGS--------------------
SYW_MYCTU       TAEAVVEFVNPIQARVDELTADPAELEAVLAAGAQRAHDVASKTVQRVYDRLG-
SYW_MYCBO       TAEAVVEFVNPIQARVDELTADPAELEAVLAAGAQRAHDVASKTVQRVYDRLG-
SYW_LEIXX       LVEVVVDALGPIRERTLELLADPAELD---------------------------
SYW_WIGBR       VTGAVLEHLKILQKKYFLIRKDEKYLINILKSGSKKAKKIARGTLKKVNESIGL
SYW_UREPA       LANIVADFLEKLQQKISYWLNSPEL-DIMIDNSCERANDIAYQNVQLV------
SYWM_HUMAN      VADAVIEKFAPIKREIXXXXXXXXXXXXXXQIGSAKAKELAYTVCQEVKKLVG-
SYW_THETN       LAEVVIDKLSVIQKNY-RDISEEEVL-RVLKXXXXXXXXXXXXTLKEVKEKMGL
SYW_RHILO       LADLAVEKLAPIAGEMRRIEGDRAYVDAVLRDGGERAGVLAETTMKTVRDIIGL
SYW_MYCPN       ------------------------------------------------------
SYW2_STRAW      TAEAVVELLRPLQERHKALCAEPGYVEGVLRDGARRARELARPRVDAAYRAIGL
SYW_TROW8       LSDILVEVCTTIATRTNELLDDKNYIRKILVTASEQARGVAQKTIDRVYEKLGV
SYW_TROWT       LSDILVEVCTTIATRTNELLDDKNYIRKILVTASEQARGVAQKTIDRVYEKLGV
SYW_RHIME       LADLAVSVLSPITGEMRRLMGDTAHIDAILRKG---------------------
SYWM_MOUSE      VADAVIEKFAPIRKEIEKLKMDKDHLRKVLLVGSAKAKELASPVFEEVKKLVGI
SYW1_STRCO      TAEAVVEMLRPVRERHMELSADPGYVDGVLREGAEKARAMARPTVDDAYRAIGL
SYW2_DEIRA      LIDVLNGVLAPIRTRRAEYERDPDAVLRFVTEGTARGREVAAQTLGQVR-----
SYW1_STRAW      LAEVMVDFVTPFRERTQQYLDDPETLDSILXXXXXXXXXXXXXTLSQAYDRVG-
SYW_AQUAE       LLKHXXXXXXXXXXXXXXXXXXXXXXXXVFYENSRKAREIAQKTMEEVRKAMNL
SYW_MYCGA       LFELIWNILDNIQ------TNMKKITDEVLKSGKDKLLPIAQKTLLKVYQKLGM
SYW_MYCGE       ------------------------------------------------------
SYW_METJA       AYERVVEFLKDLKEK---------------------------------------
SYW_AERPE       AWEKLERFLAEHQSRLE-------------------------------------
SYW_SULTO       LIEKLNDFLEEHRQK---------------------------------------
SYW_SULAC       LVDKLNAFLEEHREK---------------------------------------
SYW_HYPBU       AAELLAKFLEEARDRVLEYVEPPK------------------------------
SYW_PYRFU       LIQRVQEFLKEHQEK---------------------------------------
SYY_PICTO       VGELLCDIIGPVREK---------------------------------------
SYW_PYRCJ       LYEKIRKFVKQARDKVDAYRLSSKL-----------------------------
SYW_THESM       LIEKVQNFLKE-------------------------------------------
SYW_PYRAE       LHEKITKFLKEHRER---------------------------------------
SYW_PYRAR       LHEKISKFLKEHRER---------------------------------------
SYW_PYRHO       LISKIQEFLKEHQRR---------------------------------------
SYW_PYRAB       LISKIQEFLKEHQKR---------------------------------------
SYW_METKA       V-----------------------------------------------------
SYW_SULSO       LIDKLNNFL---------------------------------------------
SYY_METBF       ------------------------------------------------------
SYY_METMA       ------------------------------------------------------
SYW_PYRKO       LIERVQKFL---------------------------------------------
SYY_METBU       ------------------------------------------------------
SYW_THEON       LIKKVQEFL---------------------------------------------
SYY_ARCFU       VAKYLNMLLEDARKR---------------------------------------
SYY_METAC       ------------------------------------------------------
SYW_THEVO       ------------------------------------------------------
SYY_THEVO       ------------------------------------------------------
SYW_METAC       AAEKMQEFLKDHQEK---------------------------------------
SYW2_HALSA      AADRITEFL---------------------------------------------
SYY_THEAC       ------------------------------------------------------
SYY_METMP       VSEQLIEILRPIREK---------------------------------------
SYW_THEAC       ------------------------------------------------------
SYY_METTH       ------------------------------------------------------
SYY_METMJ       ------------------------------------------------------
SYY_METHJ       ------------------------------------------------------
SYY_METKA       ------------------------------------------------------
SYY_METVS       VAEQLIEILNPIREK---------------------------------------
SYY_METLZ       CGDALTELLADAYAYVQSYKN---------------------------------
SYW_ARCFU       AAELVKSFLKEHQEKME-------------------------------------
SYY_SYNY3       ------------------------------------------------------
SYW1_HALSA      ------------------------------------------------------
SYY_METJA       ------------------------------------------------------
SYY_AQUAE       ------------------------------------------------------
SYY2_BACSU      ------------------------------------------------------
SYY_SULAC       ------------------------------------------------------
SYY_PROMT       ------------------------------------------------------
SYY_SULTO       TARKLNEILDPIRKKLESKTEFTLLVEEL-------------------------
SYY_PROMP       ------------------------------------------------------
SYY_PROM9       ------------------------------------------------------
SYY_HAEI8       ------------------------------------------------------
SYY_HALSA       ------------------------------------------------------
SYY_HALS3       ------------------------------------------------------
SYY_HAEIN       ------------------------------------------------------
SYY2_BACLD      ------------------------------------------------------
SYY_SULSO       TARKLNEILEPIRKSLE-------------------------------------
SYY_COXBU       ------------------------------------------------------
SYY_SYNSC       ------------------------------------------------------
SYY_SYNPX       ------------------------------------------------------
SYY_PROMM       ------------------------------------------------------
SYY_PASMU       ------------------------------------------------------
SYY_GLOVI       ------------------------------------------------------
SYY_SYNS9       ------------------------------------------------------
SYY_SULIY       TARRLNEILEPIRKSLE-------------------------------------
SYY_SULIN       TARRLNEILEPIRKSLE-------------------------------------
SYY_SULIM       TARRLNEILEPIRKSLE-------------------------------------
SYY_SULIL       TARRLNEILEPIRKSLE-------------------------------------
SYY_SULIK       TARRLNEILEPIRKSLE-------------------------------------
SYY_SULIA       TARRLNEILEPIRKSLE-------------------------------------
SYY_MANSM       ------------------------------------------------------
SYY_LEGPL       ------------------------------------------------------
SYY_HALMA       ------------------------------------------------------
SYWC_DICDI      LIDLMNKIIIRHKEA------RAKITDEVLS-----------------------
SYY_LEGPH       ------------------------------------------------------
SYY_LEGPA       ------------------------------------------------------
SYY_AZOSE       ------------------------------------------------------
SYY_AERPE       ------------------------------------------------------
SYY_PROMA       ------------------------------------------------------
SYY_HAEDU       ------------------------------------------------------
SYY_BORPE       LAQEI-------------------------------------------------
SYY_BORPA       LAQEI-------------------------------------------------
SYY_BORBR       LAQEI-------------------------------------------------
SYY_THET8       ------------------------------------------------------
SYY_THET2       ------------------------------------------------------
SYY_THEMA       ------------------------------------------------------
SYY_HELPY       ------------------------------------------------------
SYY_DESPS       LAREL-------------------------------------------------
SYY_BACSK       LGHKFVEHGKEAADEAEQY-----------------------------------
SYW_METTH       TAEFIRKFFEELSVK---------------------------------------
SYY_PHOPR       ------------------------------------------------------
SYY_CAMJE       LALEITERFHSKEE----------------------------------------
SYY_THIFE       ------------------------------------------------------
SYY_PYRIL       ------------------------------------------------------
SYY_HALLT       LAEYLNRLIAPGREQ---------------------------------------
SYI_PEDPA       ------------------------------------------------------
SYY2_PYRAE      ------------------------------------------------------
SYW_METMA       AAEKMQEFLKDHQEK---------------------------------------
SYY_NITOC       ------------------------------------------------------
SYY_ANASP       ------------------------------------------------------
SYY_FRATT       ------------------------------------------------------
SYY_THEON       VAEYLIELLKPVR---DYFEKHPE------------------------------
SYY_PELCD       ------------------------------------------------------
SYY_HELHP       ------------------------------------------------------
SYY_ANAVT       ------------------------------------------------------
SYY_SULDN       LAIEISESAQNAKDEFDRVHSNNQI-----------------------------
SYY_SHEON       ------------------------------------------------------
SYY_RALSO       ------------------------------------------------------
SYY_LEPIN       ------------------------------------------------------
SYY_LEPIC       ------------------------------------------------------
SYY_CAMJR       ------------------------------------------------------
SYY2_VIBVY      ------------------------------------------------------
SYY2_VIBVU      ------------------------------------------------------
SYY2_CLOAB      ------------------------------------------------------