[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30480.1

[Show Plain Result]


## Summary of Sequence Search
    1::121
   36::106     2e-09  36%  121 aa  CADF_STAAU RecName: Full=Cadmium efflux system accessory protein
   13::105     3e-09  31%  111 aa  ASER_BACSU RecName: Full=HTH-type transcriptional repressor aseR;
    3::73      5e-09  33%   89 aa  Y1325_METJA RecName: Full=Uncharacterized HTH-type
   22::100     8e-09  34%  119 aa  CADC_LISIN RecName: Full=Cadmium efflux system accessory
   22::100     8e-09  34%  119 aa  CADC_LACLA RecName: Full=Cadmium efflux system accessory
   26::96      2e-08  33%  119 aa  CADC_LISMO RecName: Full=Cadmium efflux system accessory
   11::87      2e-08  32%  104 aa  ARSR_STAXY RecName: Full=Arsenical resistance operon repressor;
   46::110     5e-08  34%  132 aa  ZIAR_SYNY3 RecName: Full=Transcriptional repressor smtB homolog;
   11::75      1e-07  35%  104 aa  ARSR_STAAU RecName: Full=Arsenical resistance operon repressor;
   11::103     1e-07  32%  117 aa  ARSR1_ECOLX RecName: Full=Arsenical resistance operon repressor;
   19::89      2e-07  32%  108 aa  HLYU_VIBCH RecName: Full=Transcriptional activator hlyU;
   11::71      2e-07  39%  117 aa  ARSR_ECOLI RecName: Full=Arsenical resistance operon repressor;
    6::83      3e-07  29%   90 aa  SDPR_BACSU RecName: Full=Transcriptional repressor sdpR;
   11::71      3e-07  39%  117 aa  ARSR2_ECOLX RecName: Full=Arsenical resistance operon repressor;
   17::80      4e-07  38%  105 aa  ARSR_BACSU RecName: Full=Arsenical resistance operon repressor;
   29::107     7e-07  27%  122 aa  CADC_STAAU RecName: Full=Cadmium efflux system accessory protein;
   26::120     4e-06  30%  122 aa  NOLR_RHIME RecName: Full=Nodulation protein nolR;
   29::107     4e-05  23%  122 aa  CADC_BACPF RecName: Full=Cadmium efflux system accessory protein;
   27::86      7e-05  35%  107 aa  CZRA_BACSU RecName: Full=HTH-type transcriptional repressor czrA;
   20::78      4e-04  29%  104 aa  YCZG_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    4::82      6e-04  33%  100 aa  YBZH_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    2::61      6e-04  28%  157 aa  Y1553_METJA RecName: Full=Uncharacterized HTH-type
   10::80      8e-04  31%   92 aa  YUZN_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    1::121

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKLANIVDFQKALGDETRIRILMVIYQHQLCLCHLAHIFKLANSTLSKHLDILRRNGFIHKRKQGRFHYF
CADF_STAAU      ----------KALSDDTRVKIAYVLLEGELCVCDVANIIESSTATASHHLRLLKNLGIAKYRKEGKLVYY
ASER_BACSU      ----------KTLSDQTRLIMMRLFLEQEYCVCQLVDMFEMSQPAISQHLRKLKNAGFVNEDRRGQWRYY
Y1325_METJA     -KYEKAAEIFKAFGDPTRLMILKLLAENSMCVCKIIDELKKPQPTISHHLNILKKAGIVKARKEGTWNFY
CADC_LISIN      -KLANVSGFFKILSDENRLKIVALVHEDELCVCDIANIIDASVATTSHHLNSLKKLGVVDSHKDGKLVYY
CADC_LACLA      -KLANVSGFFKILSDENRLKIVALVHEDELCVCDIANIIDASVATTSHHLNSLKKLGVVDSHKDGKLVYY
CADC_LISMO      VEVTTISQIFKILSDETRVKIVYALLENELCVCDLANIVEATVAATSHHLRFLKKQGIANYRKDGKLVYY
ARSR_STAXY      ----------KVLSDPSRLEILDLLSCGELCACDLLEHFQFSQPTLSHHMKSLVDNELVTTRKNGNKHMY
ZIAR_SYNY3      -----MAEFFSALADPSRLRLMSALARQELCVCDLAAAMKVSESAVSHQLRILRSQRLVKYRRVGRNVYY
ARSR_STAAU      ----------KILSDSSRLEILDLLSCGELCACDLLEHFQFSQPTLSHHMKSLVDNELVTTRKDGNKHWY
ARSR1_ECOLX     ----------KNLSDETRLGIVLLLREMELCVCDLCMALDQSQPKISRHLAMLRESGILLDRKQGKWVHY
HLYU_VIBCH      ---AKAVVLLKAMANERRLQILCMLLDNELSVGELSSRLELSQSALSQHLAWLRRDGLVNTRKEAQTVFY
ARSR_ECOLI      ----------KILADETRLGIVLLLSEGELCVCDLCTALDQSQPKISRHLALLRESGLLLDRKQGKWHY-
SDPR_BACSU      ----------KAISDPTRRKILDLLKGGDMTAGDIAEHFNISKPSISHHLNILKQAEVISDHRKGQFIYY
ARSR2_ECOLX     ----------KILSDETRLGIVLLLREMELCVCDLCTALEQSQPKTSRHLAMLRESGLLLDRKQGKWHY-
ARSR_BACSU      ----------KALADQKRLEIMYELCQRKTCVCDLTEIFEVTQSKLSYHLKILLDANLITKETKGTWSYY
CADC_STAAU      --ISGVSQILKAIADENRAKITYALCQEELCVCDIANILGVTIANASHHLRTLYKQGVVNFRKEGKLALY
NOLR_RHIME      --------FLSAMANPKRLLILDSLVKEEMAVGALAHKVGLSQSALSQHLSKLRAQNLVSTRRDAQTIYY
CADC_BACPF      --IVSVAQMLKAIADENRAKITYALCQEESCVCDXXXXXXXXXXXXSHHLRTLHKQGIVRYRKEGKLAFY
CZRA_BACSU      ----------KALSDPTRIRILHLLSQGEHAVNGIAEKLNLLQSTVSHQLRFLKNLRLVKSRREGTSIYY
YCZG_BACSU      -----------ALSDPLRLELVKQLAEAKEKTCSTCADVQVAKSTLSHHFKVLRESGIAQVRIEGKRRYY
YBZH_BACSU      ------IEVFKALSNESRLQILQWLKEHEVCVSQITDKLKMTQSTASQYLTILLRAGLIKAERIGKYTYY
Y1553_METJA     ----------KFLFSKTKIEILKKLNERNYTISELSKILGKSKSTISEHLNALYEMGLVDKENYSKWVYY
YUZN_BACSU      ----------KALGDSTRRLILDELSENELTLYELTYDLSITRQAIAKHLSVLEDAGLVTSKRKGKYRVL


                         .         .         *         .         .         .         .:140
query           YFNSAYQQQLNWLFDILADDEIIQSDQKLVKQLIAQELEHLPEIHAKExxx
CADF_STAAU      SLDDEHVKQL-----------------------------------------
ASER_BACSU      SINGSCPE-----FDTL----------QLILHQIDQEDELLNHIKQKK---
Y1325_METJA     Y--------------------------------------------------
CADC_LISIN      FIKN-----------------------------------------------
CADC_LACLA      FIKN-----------------------------------------------
CADC_LISMO      ---------------------------------------------------
ARSR_STAXY      QLNHEFLDYINQNLDII----------------------------------
ZIAR_SYNY3      ---------------------------------------------------
ARSR_STAAU      QLNHA----------------------------------------------
ARSR1_ECOLX     RLSPHIP---SWAAQIIEQAWLSQQDD---VQVIARKL-------------
HLYU_VIBCH      TLSS-----------------------------------------------
ARSR_ECOLI      ---------------------------------------------------
SDPR_BACSU      SLNTVLQDSINWMLNFI----------------------------------
ARSR2_ECOLX     ---------------------------------------------------
ARSR_BACSU      DLN------------------------------------------------
CADC_STAAU      SLGDEHIRQI-----------------------------------------
NOLR_RHIME      SSSSAVLKILGALSDIYGDDTDAVEEKPLVRK-------------------
CADC_BACPF      SLDDEHIRQI-----------------------------------------
CZRA_BACSU      ---------------------------------------------------
YCZG_BACSU      ---------------------------------------------------
YBZH_BACSU      ---------------------------------------------------
Y1553_METJA     ---------------------------------------------------
YUZN_BACSU      IFNN-----------------------------------------------