[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30541.1

[Show Plain Result]


## Summary of Sequence Search
    1::351
   10::262     5e-19  26%  321 aa  ELIC_ERWCH RecName: Full=Cys-loop ligand-gated ionic
   61::308     2e-16  24%  456 aa  GLUCL_DROME RecName: Full=Glutamate-gated chloride channel;        
   69::318     1e-15  24%  456 aa  GLRA4_MOUSE RecName: Full=Glycine receptor subunit alpha-4;Flags:
   69::348     4e-15  25%  464 aa  GLRA3_RAT RecName: Full=Glycine receptor subunit alpha-3;Flags:
   69::348     4e-15  25%  464 aa  GLRA3_MOUSE RecName: Full=Glycine receptor subunit alpha-3;Flags:
   69::348     4e-15  25%  464 aa  GLRA3_HUMAN RecName: Full=Glycine receptor subunit alpha-3;Flags:
   60::339     3e-14  23%  444 aa  GLRA1_DANRE RecName: Full=Glycine receptor subunit alphaZ1;Flags:
   70::319     5e-14  24%  456 aa  GLRA4_HUMAN RecName: Full=Glycine receptor subunit alpha-4;Flags:
   70::318     5e-14  24%  452 aa  GLRA2_MOUSE RecName: Full=Glycine receptor subunit alpha-2;Flags:
   70::318     5e-14  24%  452 aa  GLRA2_HUMAN RecName: Full=Glycine receptor subunit alpha-2;Flags:
   64::312     3e-13  23%  457 aa  GLRA1_RAT RecName: Full=Glycine receptor subunit alpha-1;AltName:
   64::312     3e-13  23%  457 aa  GLRA1_MOUSE RecName: Full=Glycine receptor subunit alpha-1;AltName:
   64::312     3e-13  23%  457 aa  GLRA1_HUMAN RecName: Full=Glycine receptor subunit alpha-1;AltName:
   64::312     3e-13  23%  457 aa  GLRA1_BOVIN RecName: Full=Glycine receptor subunit alpha-1;AltName:
   86::374     3e-13  23%  465 aa  GBRG1_RAT RecName: Full=Gamma-aminobutyric acid receptor subunit
   91::219     3e-13  32%  492 aa  GBRA3_HUMAN RecName: Full=Gamma-aminobutyric acid receptor subunit
   91::219     3e-13  32%  492 aa  GBRA3_BOVIN RecName: Full=Gamma-aminobutyric acid receptor subunit
   70::318     4e-13  24%  452 aa  GLRA2_RAT RecName: Full=Glycine receptor subunit alpha-2;AltName:
   91::219     4e-13  32%  493 aa  GBRA3_RAT RecName: Full=Gamma-aminobutyric acid receptor subunit
   91::219     4e-13  32%  492 aa  GBRA3_MOUSE RecName: Full=Gamma-aminobutyric acid receptor subunit
   86::367     5e-13  23%  465 aa  GBRG1_MOUSE RecName: Full=Gamma-aminobutyric acid receptor subunit
   86::368     2e-12  23%  465 aa  GBRG1_HUMAN RecName: Full=Gamma-aminobutyric acid receptor subunit
   70::321     3e-12  24%  462 aa  GBRA5_BOVIN RecName: Full=Gamma-aminobutyric acid receptor subunit
   82::329     4e-12  21%  632 aa  GBRT_HUMAN RecName: Full=Gamma-aminobutyric acid receptor subunit
   70::321     8e-12  23%  464 aa  GBRA5_RAT RecName: Full=Gamma-aminobutyric acid receptor subunit
   70::321     8e-12  23%  463 aa  GBRA5_MOUSE RecName: Full=Gamma-aminobutyric acid receptor subunit
   70::321     8e-12  23%  462 aa  GBRA5_HUMAN RecName: Full=Gamma-aminobutyric acid receptor subunit
   82::371     1e-11  20%  467 aa  GBRR3_HUMAN RecName: Full=Gamma-aminobutyric acid receptor subunit
   79::358     1e-11  19%  464 aa  GBRR3_RAT RecName: Full=Gamma-aminobutyric acid receptor subunit
   87::217     6e-11  31%  466 aa  GBRG2_RAT RecName: Full=Gamma-aminobutyric acid receptor subunit
   88::218     6e-11  31%  467 aa  GBRG2_PONAB RecName: Full=Gamma-aminobutyric acid receptor subunit
   87::217     6e-11  31%  474 aa  GBRG2_MOUSE RecName: Full=Gamma-aminobutyric acid receptor subunit
   88::218     6e-11  31%  467 aa  GBRG2_HUMAN RecName: Full=Gamma-aminobutyric acid receptor subunit
  132::285     6e-11  30%  686 aa  GBRAL_DROME RecName: Full=Gamma-aminobutyric acid receptor
   88::218     8e-11  31%  475 aa  GBRG2_BOVIN RecName: Full=Gamma-aminobutyric acid receptor subunit
   56::338     1e-10  23%  453 aa  GBRA6_HUMAN RecName: Full=Gamma-aminobutyric acid receptor subunit
   56::330     1e-10  23%  465 aa  GBRA6_CHICK RecName: Full=Gamma-aminobutyric acid receptor subunit
   79::330     2e-10  22%  496 aa  GLRB_RAT RecName: Full=Glycine receptor subunit beta;AltName:
   79::330     2e-10  22%  496 aa  GLRB_MOUSE RecName: Full=Glycine receptor subunit beta;AltName:
   79::330     2e-10  22%  497 aa  GLRB_HUMAN RecName: Full=Glycine receptor subunit beta;AltName:
   79::330     2e-10  22%  497 aa  GLRB_BOVIN RecName: Full=Glycine receptor subunit beta;AltName:
   87::217     2e-10  30%  474 aa  GBRG2_CHICK RecName: Full=Gamma-aminobutyric acid receptor subunit
   59::217     2e-10  26%  488 aa  GBRB4_CHICK RecName: Full=Gamma-aminobutyric acid receptor subunit
   85::355     3e-10  22%  465 aa  GBRR2_MOUSE RecName: Full=Gamma-aminobutyric acid receptor subunit
   59::285     3e-10  23%  440 aa  GBRP_BOVIN RecName: Full=Gamma-aminobutyric acid receptor subunit
   69::317     4e-10  23%  467 aa  GBRG3_HUMAN RecName: Full=Gamma-aminobutyric acid receptor subunit
   59::306     4e-10  20%  474 aa  GBRB2_RAT RecName: Full=Gamma-aminobutyric acid receptor subunit
   59::306     4e-10  20%  474 aa  GBRB2_MOUSE RecName: Full=Gamma-aminobutyric acid receptor subunit
   59::306     4e-10  20%  474 aa  GBRB2_HUMAN RecName: Full=Gamma-aminobutyric acid receptor subunit
   57::304     4e-10  20%  472 aa  GBRB2_BOVIN RecName: Full=Gamma-aminobutyric acid receptor subunit
   56::338     5e-10  21%  499 aa  GBRB_LYMST RecName: Full=Gamma-aminobutyric acid receptor subunit
   56::184     5e-10  29%  453 aa  GBRA6_RAT RecName: Full=Gamma-aminobutyric acid receptor subunit
   56::184     5e-10  29%  453 aa  GBRA6_MOUSE RecName: Full=Gamma-aminobutyric acid receptor subunit
   66::314     5e-10  24%  451 aa  GBRA2_BOVIN RecName: Full=Gamma-aminobutyric acid receptor subunit
   62::209     5e-10  31%  455 aa  GBRA1_RAT RecName: Full=Gamma-aminobutyric acid receptor subunit
   63::210     5e-10  31%  456 aa  GBRA1_PONAB RecName: Full=Gamma-aminobutyric acid receptor subunit
   62::209     5e-10  31%  455 aa  GBRA1_MOUSE RecName: Full=Gamma-aminobutyric acid receptor subunit
   63::210     5e-10  31%  456 aa  GBRA1_MACFA RecName: Full=Gamma-aminobutyric acid receptor subunit
   63::210     5e-10  31%  456 aa  GBRA1_HUMAN RecName: Full=Gamma-aminobutyric acid receptor subunit
   63::210     5e-10  31%  456 aa  GBRA1_BOVIN RecName: Full=Gamma-aminobutyric acid receptor subunit
   59::309     7e-10  20%  434 aa  GLUCB_CAEEL RecName: Full=Glutamate-gated chloride channel subunit
   69::317     7e-10  23%  467 aa  GBRG3_MOUSE RecName: Full=Gamma-aminobutyric acid receptor subunit
   66::314     7e-10  24%  451 aa  GBRA2_RAT RecName: Full=Gamma-aminobutyric acid receptor subunit
   66::314     7e-10  24%  451 aa  GBRA2_PONAB RecName: Full=Gamma-aminobutyric acid receptor subunit
   66::314     7e-10  24%  451 aa  GBRA2_MOUSE RecName: Full=Gamma-aminobutyric acid receptor subunit
   66::314     7e-10  24%  451 aa  GBRA2_HUMAN RecName: Full=Gamma-aminobutyric acid receptor subunit
   63::210     7e-10  31%  455 aa  GBRA1_CHICK RecName: Full=Gamma-aminobutyric acid receptor subunit
   85::363     9e-10  22%  465 aa  GBRR2_RAT RecName: Full=Gamma-aminobutyric acid receptor subunit
   85::325     9e-10  20%  465 aa  GBRR2_BOVIN RecName: Full=Gamma-aminobutyric acid receptor subunit
   69::317     1e-09  23%  467 aa  GBRG3_RAT RecName: Full=Gamma-aminobutyric acid receptor subunit
   92::365     2e-09  20%  506 aa  GBRE_HUMAN RecName: Full=Gamma-aminobutyric acid receptor subunit
   60::307     2e-09  21%  473 aa  GBRB3_RAT RecName: Full=Gamma-aminobutyric acid receptor subunit
   60::307     2e-09  21%  473 aa  GBRB3_MOUSE RecName: Full=Gamma-aminobutyric acid receptor subunit
   60::307     2e-09  21%  473 aa  GBRB3_HUMAN RecName: Full=Gamma-aminobutyric acid receptor subunit
   60::307     2e-09  21%  476 aa  GBRB3_CHICK RecName: Full=Gamma-aminobutyric acid receptor subunit
   69::307     2e-09  20%  474 aa  GBRB1_RAT RecName: Full=Gamma-aminobutyric acid receptor subunit
   69::307     2e-09  20%  474 aa  GBRB1_MOUSE RecName: Full=Gamma-aminobutyric acid receptor subunit
   69::307     2e-09  20%  474 aa  GBRB1_HUMAN RecName: Full=Gamma-aminobutyric acid receptor subunit
   69::307     2e-09  20%  474 aa  GBRB1_BOVIN RecName: Full=Gamma-aminobutyric acid receptor subunit
   72::354     2e-09  21%  554 aa  GBRA4_HUMAN RecName: Full=Gamma-aminobutyric acid receptor subunit
   72::354     2e-09  21%  555 aa  GBRA4_BOVIN RecName: Full=Gamma-aminobutyric acid receptor subunit
   72::200     3e-09  29%  552 aa  GBRA4_RAT RecName: Full=Gamma-aminobutyric acid receptor subunit
   72::200     3e-09  29%  552 aa  GBRA4_MOUSE RecName: Full=Gamma-aminobutyric acid receptor subunit
   60::285     4e-09  22%  440 aa  GBRP_RAT RecName: Full=Gamma-aminobutyric acid receptor subunit
   59::312     4e-09  22%  514 aa  ACHG_CHICK RecName: Full=Acetylcholine receptor subunit
  101::328     5e-09  21%  638 aa  GBRT_MOUSE RecName: Full=Gamma-aminobutyric acid receptor subunit
  106::346     5e-09  20%  480 aa  GBRR1_MOUSE RecName: Full=Gamma-aminobutyric acid receptor subunit
   59::189     5e-09  28%  440 aa  GBRP_HUMAN RecName: Full=Gamma-aminobutyric acid receptor subunit
  106::346     6e-09  20%  480 aa  GBRR1_RAT RecName: Full=Gamma-aminobutyric acid receptor subunit
  105::345     6e-09  20%  479 aa  GBRR1_HUMAN RecName: Full=Gamma-aminobutyric acid receptor subunit
   60::285     6e-09  22%  440 aa  GBRP_MOUSE RecName: Full=Gamma-aminobutyric acid receptor subunit
   93::374     1e-08  21%  506 aa  GBRE_RAT RecName: Full=Gamma-aminobutyric acid receptor subunit
   56::312     2e-08  19%  432 aa  GLUCB_HAECO RecName: Full=Glutamate-gated chloride channel subunit
   58::208     2e-08  28%  494 aa  ACHA6_PANTR RecName: Full=Neuronal acetylcholine receptor subunit
   58::208     3e-08  28%  494 aa  ACHA6_HUMAN RecName: Full=Neuronal acetylcholine receptor subunit
   71::319     4e-08  22%  457 aa  GBRG4_CHICK RecName: Full=Gamma-aminobutyric acid receptor subunit
   63::192     1e-07  26%  449 aa  GBRD_RAT RecName: Full=Gamma-aminobutyric acid receptor subunit
   63::192     1e-07  26%  449 aa  GBRD_MOUSE RecName: Full=Gamma-aminobutyric acid receptor subunit
   63::192     1e-07  26%  452 aa  GBRD_HUMAN RecName: Full=Gamma-aminobutyric acid receptor subunit
   80::212     1e-07  27%  576 aa  GBRB_MUSDO RecName: Full=Gamma-aminobutyric acid receptor subunit
   82::214     1e-07  27%  606 aa  GBRB_DROSI RecName: Full=Gamma-aminobutyric acid receptor subunit
   79::350     1e-07  22%  550 aa  GBRB_CAEEL RecName: Full=Gamma-aminobutyric acid receptor subunit
   54::305     2e-07  21%  510 aa  ACHG_XENLA RecName: Full=Acetylcholine receptor subunit
   58::208     2e-07  28%  494 aa  ACHA6_MOUSE RecName: Full=Neuronal acetylcholine receptor subunit
   58::190     2e-07  27%  494 aa  ACHA6_CHICK RecName: Full=Neuronal acetylcholine receptor subunit
   60::198     2e-07  30%  521 aa  ACH3_DROME RecName: Full=Acetylcholine receptor subunit beta-like
   85::325     3e-07  19%  465 aa  GBRR2_HUMAN RecName: Full=Gamma-aminobutyric acid receptor subunit
   45::179     6e-07  24%  489 aa  ACHB_XENLA RecName: Full=Acetylcholine receptor subunit beta;Flags:
   66::280     7e-07  25%  473 aa  GLRB4_CAEEL RecName: Full=Glycine receptor subunit beta-type
   82::214     7e-07  26%  606 aa  GBRB_DROME RecName: Full=Gamma-aminobutyric acid receptor subunit
   58::208     7e-07  28%  493 aa  ACHA6_RAT RecName: Full=Neuronal acetylcholine receptor subunit
   45::179     5e-06  28%  494 aa  ACHE_RAT RecName: Full=Acetylcholine receptor subunit
   59::297     6e-06  20%  519 aa  ACHG_BOVIN RecName: Full=Acetylcholine receptor subunit
   44::297     8e-06  22%  504 aa  ACHE_XENLA RecName: Full=Acetylcholine receptor subunit
   62::345     1e-05  23%  496 aa  GBRB3_DROME RecName: Full=Gamma-aminobutyric acid receptor subunit
   54::292     1e-05  21%  506 aa  ACHG_TORCA RecName: Full=Acetylcholine receptor subunit
   59::180     1e-05  28%  516 aa  ACHD_BOVIN RecName: Full=Acetylcholine receptor subunit
   71::260     1e-05  25%  576 aa  ACH2_DROME RecName: Full=Acetylcholine receptor subunit alpha-like
   57::227     2e-05  27%  520 aa  ACHD_MOUSE RecName: Full=Acetylcholine receptor subunit
   55::182     2e-05  26%  493 aa  ACHB_TORCA RecName: Full=Acetylcholine receptor subunit beta;Flags:
    8::197     2e-05  24%  474 aa  ACH8_CAEEL RecName: Full=Neuronal acetylcholine receptor subunit
   52::302     2e-05  21%  538 aa  ACR7_CAEEL RecName: Full=Acetylcholine receptor subunit alpha-type
  100::215     4e-05  28%  575 aa  ACR2_CAEEL RecName: Full=Acetylcholine receptor subunit beta-type
   49::191     5e-05  22%  495 aa  ACHA3_BOVIN RecName: Full=Neuronal acetylcholine receptor subunit
   59::311     7e-05  20%  519 aa  ACHG_RAT RecName: Full=Acetylcholine receptor subunit gamma;Flags:
   59::297     7e-05  20%  517 aa  ACHG_HUMAN RecName: Full=Acetylcholine receptor subunit
   45::296     7e-05  21%  493 aa  ACHE_HUMAN RecName: Full=Acetylcholine receptor subunit
   54::224     7e-05  26%  517 aa  ACHD_RAT RecName: Full=Acetylcholine receptor subunit delta;Flags:
   53::195     7e-05  22%  499 aa  ACHA3_RAT RecName: Full=Neuronal acetylcholine receptor subunit
   53::195     7e-05  22%  499 aa  ACHA3_MOUSE RecName: Full=Neuronal acetylcholine receptor subunit
   50::192     7e-05  22%  496 aa  ACHA3_CHICK RecName: Full=Neuronal acetylcholine receptor subunit
   51::193     7e-05  24%  512 aa  ACHA3_CARAU RecName: Full=Neuronal acetylcholine receptor subunit
   33::316     9e-05  21%  476 aa  YO99_CAEEL RecName: Full=Uncharacterized glycine receptor-like
   46::159     9e-05  25%  498 aa  ACH1_CAEEL RecName: Full=Acetylcholine receptor subunit alpha-type
   59::311     1e-04  21%  519 aa  ACHG_MOUSE RecName: Full=Acetylcholine receptor subunit
   59::201     2e-04  22%  505 aa  ACHA3_HUMAN RecName: Full=Neuronal acetylcholine receptor subunit
   53::241     2e-04  24%  557 aa  ACH1_SCHGR RecName: Full=Acetylcholine receptor subunit
   45::179     3e-04  26%  493 aa  ACHE_MOUSE RecName: Full=Acetylcholine receptor subunit
  136::268     6e-04  20%  615 aa  LGC4_CAEEL RecName: Full=Ligand-gated ion channel 4;Flags:
  138::270     6e-04  20%  636 aa  LGC4_CAEBR RecName: Full=Ligand-gated ion channel 4;Flags:
   60::188     6e-04  26%  517 aa  ACHD_HUMAN RecName: Full=Acetylcholine receptor subunit
   46::195     6e-04  21%  481 aa  ACH8_CAEBR RecName: Full=Neuronal acetylcholine receptor subunit
 1084::1201    8e-04  26% 2029 aa  LAR_DROME RecName: Full=Tyrosine-protein phosphatase Lar;       
   57::245     8e-04  26%  513 aa  ACHD_CHICK RecName: Full=Acetylcholine receptor subunit
    1::351

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxYKIILVLSIVAIFYSDIFGYGDIPPQKPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLE
ELIC_ERWCH      ------------------------------RPVDVSVSIFINKIYGVNTLEQTYKVDGYIVAQWTGK---
GLUCL_DROME     -------------------------------PAIVRINLFVRSIMTISDIKMEYSVQLTFREQWTDERLK
GLRA4_MOUSE     -------------------------------PVNVTCNIFINSFGSVTETTMDYRVNVFLRQQWNDPRLA
GLRA3_RAT       -------------------------------PVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLA
GLRA3_MOUSE     -------------------------------PVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLA
GLRA3_HUMAN     -------------------------------PVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLA
GLRA1_DANRE     -------------------------------PVNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLA
GLRA4_HUMAN     -------------------------------PVNVTCNIFINSFSSITKTTMDYRVNVFLRQQWNDPRLS
GLRA2_MOUSE     -------------------------------PVNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLA
GLRA2_HUMAN     -------------------------------PVNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLA
GLRA1_RAT       -------------------------------PVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLA
GLRA1_MOUSE     -------------------------------PVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLA
GLRA1_HUMAN     -------------------------------PVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLA
GLRA1_BOVIN     -------------------------------PVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLA
GBRG1_RAT       ------------------------------RPTVIETDVYVNSIGPVDPINMEYTIDIIFAQTWFDSRLK
GBRA3_HUMAN     --------------------------------TEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDERLK
GBRA3_BOVIN     --------------------------------TEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDERLK
GLRA2_RAT       -------------------------------PVNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLA
GBRA3_RAT       --------------------------------TEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDERLK
GBRA3_MOUSE     --------------------------------TEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDERLK
GBRG1_MOUSE     ------------------------------RPTVIETDVYVNSIGPVDPINMEYTIDIIFAQTWFDSRLK
GBRG1_HUMAN     ------------------------------RPTVIETDVYVNSIGPVDPINMEYTIDIIFAQTWFDSRLK
GBRA5_BOVIN     -----------------------------ERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLR
GBRT_HUMAN      -------------------------------PVPVRISIYVTSIEQISEMNMDYTITMFFHQTWKDSRLA
GBRA5_RAT       -----------------------------ERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLR
GBRA5_MOUSE     -----------------------------ERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLR
GBRA5_HUMAN     -----------------------------ERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLR
GBRR3_HUMAN     -------------------------------PVPVGIDVHVESIDSISETNMDFTMTFYLRHYWKDERLS
GBRR3_RAT       -------------------------------PVPVGIDVQVESIDSISEVNMDFTMTFYLRHYWKDERLS
GBRG2_RAT       ------------------------------KPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLK
GBRG2_PONAB     ------------------------------KPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLK
GBRG2_MOUSE     ------------------------------KPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLK
GBRG2_HUMAN     ------------------------------KPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLK
GBRAL_DROME     -------------------------------PATIEVDIMVRSMGPISEVDMTYSMDCYFRQSWVDKRLA
GBRG2_BOVIN     ------------------------------KPTLIHTDMYVNSIGPVNAINMEYTIDIFFGQTWYDRRLK
GBRA6_HUMAN     --------------------------------TEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWTDERLK
GBRA6_CHICK     --------------------------------TEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWTDERLK
GLRB_RAT        -------------------------------PVDVVVNIFINSFGSIQETTMDYRVNIFLRQKWNDPRLK
GLRB_MOUSE      -------------------------------PVDVVVNIFINSFGSIQETTMDYRVNIFLRQKWNDPRLK
GLRB_HUMAN      -------------------------------PVDVVVNIFINSFGSIQETTMDYRVNIFLRQKWNDPRLK
GLRB_BOVIN      -------------------------------PVDVVVNIFINSFGSIQETTMDYRVNIFLRQKWNDPRLK
GBRG2_CHICK     ------------------------------KPTVIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLK
GBRB4_CHICK     -------------------------------PVTVGMSIHISSIDQISEVNMDYTITMYFQQSWRDKRLA
GBRR2_MOUSE     ----------------------------------------VESVDSISEVDMDFTMTLYLKHYWKDERLA
GBRP_BOVIN      ------------------------------EPVQIALTLDVASISSISESNMDYTATIYLRQRWTDQRLV
GBRG3_HUMAN     ------------------------------KPTVIDVDIYVNSIGPVSSINMEYQIDIFFAQTWTDSRLR
GBRB2_RAT       -------------------------------PVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLS
GBRB2_MOUSE     -------------------------------PVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLS
GBRB2_HUMAN     -------------------------------PVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLS
GBRB2_BOVIN     -------------------------------PVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLS
GBRB_LYMST      -------------------------------PLEIGIEVILASFDSISEVDMDYTITMYLNQYWRDERLQ
GBRA6_RAT       --------------------------------TEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWTDERLK
GBRA6_MOUSE     --------------------------------TEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWTDERLK
GBRA2_BOVIN     --------------------------------TEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDERLK
GBRA1_RAT       -----------------------------ERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLK
GBRA1_PONAB     -----------------------------ERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLK
GBRA1_MOUSE     -----------------------------ERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLK
GBRA1_MACFA     -----------------------------ERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLK
GBRA1_HUMAN     -----------------------------ERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLK
GBRA1_BOVIN     -----------------------------ERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLK
GLUCB_CAEEL     ----------------------------------VRVNIMIRMLSKIDVVNMEYSIQLTFREQWIDPRLA
GBRG3_MOUSE     ------------------------------KPTVIDVDIYVNSIGPVSSINMEYQIDIFFAQTWTDSRLR
GBRA2_RAT       --------------------------------TEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDERLK
GBRA2_PONAB     --------------------------------TEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDERLK
GBRA2_MOUSE     --------------------------------TEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDERLK
GBRA2_HUMAN     --------------------------------TEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDERLK
GBRA1_CHICK     -----------------------------ERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLK
GBRR2_RAT       ----------------------------------------VESLDSISEVDMDFTMTLYLRHYWRDERLA
GBRR2_BOVIN     ----------------------------------------VESLDSISEVDMDFTMTLYLRHYWKDERLA
GBRG3_RAT       ------------------------------KPTVIDVDIYVNSIGPVSSINMEYQIDIFFAQTWTDSRLR
GBRE_HUMAN      -----------------------------EKPTVVTVEISVNSLGPLSILDMEYTIDIIFSQTWYDERLC
GBRB3_RAT       -------------------------------PVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLA
GBRB3_MOUSE     -------------------------------PVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLA
GBRB3_HUMAN     -------------------------------PVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLA
GBRB3_CHICK     -------------------------------PVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLA
GBRB1_RAT       ----------------------------------------VASIDMVSEVNMDYTLTMYFQQSWKDKRLS
GBRB1_MOUSE     ----------------------------------------VASIDMVSEVNMDYTLTMYFQQSWKDKRLS
GBRB1_HUMAN     ----------------------------------------VASIDMVSEVNMDYTLTMYFQQSWKDKRLS
GBRB1_BOVIN     ----------------------------------------VASIDMVSEVNMDYTLTMYFQQSWKDKRLS
GBRA4_HUMAN     --------------------------------TEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLK
GBRA4_BOVIN     --------------------------------TEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLK
GBRA4_RAT       --------------------------------TEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLK
GBRA4_MOUSE     --------------------------------TEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLK
GBRP_RAT        -------------------------------PVRIALTLDIASISSISESNMDYTATIYLRQRWTDPRLV
ACHG_CHICK      ----------------------------------------LTNLISLNEREETLTTNVWIEMQWSDYRLR
GBRT_MOUSE      --------------------------------------------------NMDYTITMFLHQTWKDTRLA
GBRR1_MOUSE     ----------------------------------------VESLDSISEVDMDFTMTLYLRHYWKDERLS
GBRP_HUMAN      ------------------------------EPVQIALTLDIASISSISESNMDYTATIYLRQRWMDQRLV
GBRR1_RAT       ----------------------------------------VESLDSISEVDMDFTMTLYLRHYWKDERLS
GBRR1_HUMAN     ----------------------------------------VESLDSISEVDMDFTMTLYLRHYWKDERLS
GBRP_MOUSE      -------------------------------PVRIALTLDIASISSISESNMDYTATIYLRQRWTDPRLV
GBRE_RAT        -----------------------------EKPTVVTVKVFVNSLGPISILDMEYSIDIIFYQTWYDERLR
GLUCB_HAECO     ----------------------------PMGPVTVRVNIMIRMLSKIDVVNMEYSMQLTFREQWLDSRLA
ACHA6_PANTR     -------------------------------PVTVHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLR
ACHA6_HUMAN     -------------------------------PVTVHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLR
GBRG4_CHICK     ------------------------------KPTFIDVDIYVNSIGPVSVIQMEYTIDIFFAQTWYDRRLR
GBRD_RAT        -------------------------------PVNVALALEVASIDHISEANMEYTMTVFLHQSWRDSRLS
GBRD_MOUSE      -------------------------------PVNVALALEVASIDHISEANMEYTMTVFLHQSWRDSRLS
GBRD_HUMAN      -------------------------------PVNVALALEVASIDHISEANMEYTMTVFLHQSWRDSRLS
GBRB_MUSDO      -------------------------------PVEVGVTMYVLSISSLSEVKMDFTLDFYFRQFWTDPRLA
GBRB_DROSI      -------------------------------PVEVGVTMYVLSISSLSEVKMDFTLDFYFRQFWTDPRLA
GBRB_CAEEL      ---------------------------------LLTMDIIIASFDSISEVDMDYTLTMYLHQYWTDERLR
ACHG_XENLA      ----------------------------------------LTNLISLNEKEEALTTNVWVEMQWKDYRLS
ACHA6_MOUSE     -------------------------------PVTVHLELAITQLANVDEVNQIMETNLWLRHIWKDYRLR
ACHA6_CHICK     -------------------------------PVTVHFELAITQLTNVDEVNQIMETNLWLRHIWNDYKLR
ACH3_DROME      --------------------------------------AFVQLINV-NEKNQVMKSNVWLRLVWYDYQLQ
GBRR2_HUMAN     ----------------------------------------VESLDSISEVDMDFTMTLYLRHYWKDERLA
ACHB_XENLA      ----------------------------PDQRVVVQVGMTLAHVISVSEKDEELKTKVYLEMAWNDQRLS
GLRB4_CAEEL     --------------------------------THVDIQMYIEGMSSFHAQSMDFQVDIYFQEKWVDHRLQ
GBRB_DROME      -------------------------------PVEVGVTMYVLSISSVSEVLMDFTLDFYFRQFWTDPRLA
ACHA6_RAT       -------------------------------PVTVHFELAITQLANVDEVNQIMETNLWLRHVWKDYRLC
ACHE_RAT        ----------------------------PEDTVTITLKVTLTNLISLNEKEETLTTSVWIGIEWQDYRLN
ACHG_BOVIN      ----------------------------------------LTNLISLNEREEALTTNVWIEMQWCDYRLR
ACHE_XENLA      ----------------------GLDDVVP-----VTLKLTLTNLIDLNEKEETLTTNVWVQIAWNDDRLV
GBRB3_DROME     ------------------------------EPLHVGMDLTIASFDAISEVNMDYTITMYLNQYWRDERLA
ACHG_TORCA      ----------------------------------------LTNLISLNEKEEALTTNVWIEIQWNDYRLS
ACHD_BOVIN      ----------------------------------------LSNLISLKEVEETLTTNVWIEQGWTDSRLQ
ACH2_DROME      ---------------------------------LVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFK
ACHD_MOUSE      ----------------------------------VALSLTLSNLISLKEVEETLTTNVWIDHAWVDSRLQ
ACHB_TORCA      ----------------------------------VRVGLTLTNLLILNEKIEEMTTNVFLNLAWTDYRLQ
ACH8_CAEEL      ----FTLILLVSIERVYSSDEEGYDPVERRKPVNVKLRLILQQLVDVDERNQVITLVVWNQYTWNDYKLR
ACR7_CAEEL      ----------------------------PKKALTVTMKVFIQQVLLVDAKHQMIEVNAWLKYIWTDFRLR
ACR2_CAEEL      ----------------------------------------------VDEKNQILQTNVWLTMKWNDFQLA
ACHA3_BOVIN     -------------------------------PVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLK
ACHG_RAT        ----------------------------------------LTNLISLNEREEALTTNVWIEMQWCDYRLR
ACHG_HUMAN      ----------------------------------------LTNLISLNEREEALTTNVWIEMQWCDYRLR
ACHE_HUMAN      ----------------------------PEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDWQDYRLN
ACHD_RAT        ----------------------------------VALSLTLSNLISLKEVEETLTTNVWIDHAWIDSRLQ
ACHA3_RAT       -------------------------------PVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLK
ACHA3_MOUSE     -------------------------------PVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLK
ACHA3_CHICK     -------------------------------PVIIQFEVSMSQLVKVDEVNQIMETNLWLKHIWNDYKLR
ACHA3_CARAU     -------------------------------PVTVEFEVSISQLVKVDEVNQIMETNLWLRHIWNDYKLK
YO99_CAEEL      ---------------------------PEAEGVNVTIELHVQGVSGISEITGDFSLDVMYSEIWQDPRLS
ACH1_CAEEL      ------------------------------EPVTVHLKVALQQIIDVDEKNQVVYVNAWLDYTWNDYNLV
ACHG_MOUSE      ----------------------------------------LTNLISLNEREEALTTNVWIEMQWCDYRLR
ACHA3_HUMAN     -------------------------------PVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLK
ACH1_SCHGR      ---------------------------------LVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFR
ACHE_MOUSE      ----------------------------PEDTVTITLKVTLTNLISLNEKEETLTTSVWIGIDWHDYRLN
LGC4_CAEEL      ------------------------------QPTNVTFGFLLNQIVEMDERNQALTTRSWLNINWMDPRLS
LGC4_CAEBR      ------------------------------QPTNVTFGFLLNQIVEMDERNQALTTRSWLNINWMDPRLS
ACHD_HUMAN      ----------------------------------------LSNLISLKEVEETLTTNVWIEHGWTDNRLK
ACH8_CAEBR      ------------------------------KPVNVKLRLILQQLVDVDEKNQVITLVVWTQYTWNDYKMK
LAR_DROME       ----------------------------------------------------------------------
ACHD_CHICK      ----------------------------------------LSNLISLKEVDETLTTNVWVEQSWTDYRLQ


                         .         .         *         .         .         .         .:140
query           FDKNEEKTPYKLYQGDFQYDEVFEGWKPQISIINEIGTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRL
ELIC_ERWCH      ----PRKTPKPLIVENTQIERWINNWVPALEFINVVGSPDTGNKRLMLFPDGRVIYNARFLGSFSNDMDF
GLUCL_DROME     FDDIQGRLKY------LTLTEANRVWMPDLFFSNEIIMPNV---YIRIFPNGSVLYSIRISLTLACPMNL
GLRA4_MOUSE     YRE------YXXXXXXXXXXXXXXIWKPDLFFANEKGANFHEVKLLRIFKNGNVLYSIRLTLILSCPMDL
GLRA3_RAT       YSE------YXXXXXXXXXXXXXXIWKPDLFFANEKGANFHEVKLLRIFKNGNVLYSIRLTLTLSCPMDL
GLRA3_MOUSE     YSE------YXXXXXXXXXXXXXXIWKPDLFFANEKGANFHEVKLLRIFKNGNVLYSIRLTLTLSCPMDL
GLRA3_HUMAN     YSE------YXXXXXXXXXXXXXXIWKPDLFFANEKGANFHEVKLLRIFKNGNVLYSIRLTLTLSCPMDL
GLRA1_DANRE     YSE------YXXXXXXXXXXXXXXIWKPDLFFANEKGANFHEVKLLRISKNGNVLYSIRITLVLACPMDL
GLRA4_HUMAN     YRE------YXXXXXXXXXXXXXXIWKPDLFFANEKGANFHEVKLLRIFKNGNVLYSIRLTLILSCLMDL
GLRA2_MOUSE     YSE------YXXXXXXXXXXXXXXIWKPDLFFANEKGANTTDNKLLRISKNGKVLYSIRLTLTLSCPMDL
GLRA2_HUMAN     YSE------YXXXXXXXXXXXXXXIWKPDLFFANEKGANTTDNKLLRISKNGKVLYSIRLTLTLSCPMDL
GLRA1_RAT       YNE------YXXXXXXXXXXXXXXIWKPDLFFANEKGAHTTDNKLLRISRNGNVLYSIRITLTLACPMDL
GLRA1_MOUSE     YNE------YXXXXXXXXXXXXXXIWKPDLFFANEKGAHTTDNKLLRISRNGNVLYSIRITLTLACPMDL
GLRA1_HUMAN     YNE------YXXXXXXXXXXXXXXIWKPDLFFANEKGAHTTDNKLLRISRNGNVLYSIRITLTLACPMDL
GLRA1_BOVIN     YNE------YXXXXXXXXXXXXXXIWKPDLFFANEKGAHTTDNKLLRISRNGNVLYSIRITLTLACPMDL
GBRG1_RAT       FNSTMKVLM-------LNSNMVGKIWIPDTFFRNSITTPN---RLLRIWSDGRVLYTLRLTINAECYLQL
GBRA3_HUMAN     FDGPMKILPLNLASKIWTPDTFFHNGKK--SVAHNMTTPN---KLLRLVDNGTLLYTMRLTIHAECPMHL
GBRA3_BOVIN     FDGPMKILPLNLASKIWTPDTFFHNGKK--SVAHNMTTPN---KLLRLVDNGTLLYTMRLTIHAECPMHL
GLRA2_RAT       YSE------YXXXXXXXXXXXXXXIWKPDLFFANEKGANTTDNKLLRISKNGKVLYSIRLTLTLSCPMDL
GBRA3_RAT       FDGPMKILPLNLASKIWTPDTFFHNGKK--SVAHNMTTPN---KLLRLVDNGTLLYTMRLTIHAECPMHL
GBRA3_MOUSE     FDGPMKILPLNLASKIWTPDTFFHNGKK--SVAHNMTTPN---KLLRLVDNGTLLYTMRLTIHAECPMHL
GBRG1_MOUSE     FNSTMKVLM-------LNSNMVGKIWIPDTFFRNSITTPN---RLLRIWSDGRVLYTLRLTINAECYLQL
GBRG1_HUMAN     FNSTMKVLM-------LNSNMVGKIWIPDTFFRNSITTPN---RLLRIWNDGRVLYTLRLTINAECYLQL
GBRA5_BOVIN     FKGPMQRLPLNLASKIWTPDTFFHNGKK--SIAHNMTTPN---KLLRLEDDGTLLYTMRLTISAECPMQL
GBRT_HUMAN      YYETTLNLTL-----DYRMHEKL--WVPDCYFLNSVHDVTVENRVFQLHPDGTVRYGIRLTTTAACSLDL
GBRA5_RAT       FKGPMQRLPLNLASKIWTPDTFFHNGKK--SIAHNMTTPN---KLLRLEDDGTLLYTMRLTISAECPMQL
GBRA5_MOUSE     FKGPMQRLPLNLASKIWTPDTFFHNGKK--SIAHNMTTPN---KLLRLEDDGTLLYTMRLTISAECPMQL
GBRA5_HUMAN     FKGPMQRLPLNLASKIWTPDTFFHNGKK--SIAHNMTTPN---KLLRLEDDGTLLYTMRLTISAECPMQL
GBRR3_HUMAN     FPSTANKSM------TFDHRLTRKIWVPDIFFVHSIHDTTMENIMLRVHPDGNVLLSLRITVSAMCFMDF
GBRR3_RAT       FPSTTNKSM------TFDRRLIQKIWVPDIFFVHSIHDTTVENIMLRVHPDGNVLFSLRITVSAMCFMDF
GBRG2_RAT       FN-----STIKVLR--LNSNMVGKIWIPDTFFRNSITTPN---RMLRIWNDGRVLYTLRLTIDAECQLQL
GBRG2_PONAB     FN-----STIKVLR--LNSNMVGKIWIPDTFFRNSITTPN---RMLRIWNDGRVLYTLRLTIDAECQLQL
GBRG2_MOUSE     FN-----STIKVLR--LNSNMVGKIWIPDTFFRNSITTPN---RMLRIWNDGRVLYTLRLTIDAECQLQL
GBRG2_HUMAN     FN-----STIKVLR--LNSNMVGKIWIPDTFFRNSITTPN---RMLRIWNDGRVLYTLRLTIDAECQLQL
GBRAL_DROME     FEGAQDTLALSVSM-------LARIWKPDTSYLHTITTPN---KFVRIYQNGRVLYSSRLTIKAGCPMNL
GBRG2_BOVIN     FN-----STIKVLR--LNSNMVGKIWIPDTFFRNSITTPN---RMLRIWNDGRVLYTLRLTIDAECQLQL
GBRA6_HUMAN     FGGPTEILSLNMVSKIWTPDTFFRNGKK--SIAHNMTTPN---KLFRIMQNGTILYTMRLTINADCPMRL
GBRA6_CHICK     FGGPTERLNNLMVSKIWTPDTFFRNGKK--SIAHNMTTPN---KLFRIMQNGTILYTMRLTINADCPMRL
GLRB_RAT        LPSDVDPTMYKCL------------WKPDLFFANEKSANFHDVTQLFIFRDGDVLVSMRLSITLSCPLDL
GLRB_MOUSE      LPSDVDPTMYKCL------------WKPDLFFANEKSANFHDVTQLFIFRDGDVLVSMRLSITLSCPLDL
GLRB_HUMAN      LPSDVDPTMYKCL------------WKPDLFFANEKSANFHDVTQLFIFRDGDVLVSMRLSITLSCPLDL
GLRB_BOVIN      LPSDVDPTMYKCL------------WKPDLFFANEKSANFHDVTQLFIFRDGDVLVSMRLSITLSCPLDL
GBRG2_CHICK     FN-----STIKVLR--LNSNMVGKIWIPDTFFRNSITTPN---RMLRIWNDGRVLYTLRLTIDAECQLQL
GBRB4_CHICK     YND----LPLNLTLDNRVADQL---WLPDTYFLNDLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDL
GBRR2_MOUSE     FPSSSNKSM------TFDGRLVKKIWVPDVSFIQDTTTDNI---MLRVFPDGHVLYSMRITVTAMCNMDF
GBRP_BOVIN      FEGN------KSFTLDARLVEFL--WVPDTYIVESLHEVTVGNRLIRLFSNGTVLYALRITTTVACNMDL
GBRG3_HUMAN     FNSTMKILTLNSNMVGLIWDTIFRNSK--TAEAHWITTPN---QLLRIWNDGKILYTLRLTINAECQLQL
GBRB2_RAT       YNV----IPLNLTLDNRVADQL---WVPDTYFLNDVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDL
GBRB2_MOUSE     YNV----IPLNLTLDNRVADQL---WVPDTYFLNDVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDL
GBRB2_HUMAN     YNV----IPLNLTLDNRVADQL---WVPDTYFLNDVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDL
GBRB2_BOVIN     YNV----IPLNLTLDNRVADQL---WVPDTYFLNDVHGVTVKNRMIRLHPDGTVLYGLRITTTTACMMDL
GBRB_LYMST      FDLGENRSVTTMTLTGAFAEKI---WVPDTFLANDLHDITEKNKMVRLYGNGSLVYGMRFTTTLACMMDL
GBRA6_RAT       FKGPAEILSLNMVSKIWTPDTFFRNGKK--SIAHNMTTPN---KLFRLMHNGTILYTMRLTINADCPMRL
GBRA6_MOUSE     FKGPAEILSLNMVSKIWTPDTFFRNGKK--SIAHNMTTPN---KLFRLMQNGTILYTMRLTINADCPMRL
GBRA2_BOVIN     FKMNILRLNNLMASKIWTPDTFFHNGKK--SVAHNMTMPN---KLLRIQDDGTLLYTMRLTVQAECPMHL
GBRA1_RAT       F-----KGPMTVLRLNWTPDTFFHNGKK--SVAHNMTMPN---KLLRITEDGTLLYTMRLTVRAECPMHL
GBRA1_PONAB     F-----KGPMTVLRLNWTPDTFFHNGKK--SVAHNMTMPN---KLLRITEDGTLLYTMRLTVRAECPMHL
GBRA1_MOUSE     F-----KGPMTVLRLNWTPDTFFHNGKK--SVAHNMTMPN---KLLRITEDGTLLYTMRLTVRAECPMHL
GBRA1_MACFA     F-----KGPMTVLRLNWTPDTFFHNGKK--SVAHNMTMPN---KLLRITEDGTLLYTMRLTVRAECPMHL
GBRA1_HUMAN     F-----KGPMTVLRLNWTPDTFFHNGKK--SVAHNMTMPN---KLLRITEDGTLLYTMRLTVRAECPMHL
GBRA1_BOVIN     F-----KGPMTVLRLNWTPDTFFHNGKK--SVAHNMTMPN---KLLRITEDGTLLYTMRLTVRAECPMHL
GLUCB_CAEEL     YENLGFYNPPAFLTVPHVKKSL---WIPDTFFPTEKAAHRMENMFLRIYPDGKILYSSRISLTSSCPMRL
GBRG3_MOUSE     FNSTMKTLTLNSNMVGLIWDTIFRNSK--TAEAHWITTPN---QLLRIWNDGKILYTLRLTINAECQLQL
GBRA2_RAT       FKMNILRLNNSMASKIWTPDTFFHNGKK--SVAHNMTMPN---KLLRIQDDGTLLYTMRLTVQAECPMHL
GBRA2_PONAB     FKMNILRLNNLMASKIWTPDTFFHNGKK--SVAHNMTMPN---KLLRIQDDGTLLYTMRLTVQAECPMHL
GBRA2_MOUSE     FKMNILRLNNLMASKIWTPDTFFHNGKK--SVAHNMTMPN---KLLRIQDDGTLLYTMRLTVQAECPMHL
GBRA2_HUMAN     FKMNILRLNNLMASKIWTPDTFFHNGKK--SVAHNMTMPN---KLLRIQDDGTLLYTMRLTVQAECPMHL
GBRA1_CHICK     F-----KGPMTVLRLNWTPDTFFHNGKK--SVAHNMTMPN---KLLRITEDGTLLYTMRLTVRAECPMHL
GBRR2_RAT       FPSSSNRSM------TFDGRLVKKIWVPDVSFTHDTTTDNI---MLRVFPDGHVLYSMRITVTAMCNMDF
GBRR2_BOVIN     FPSASNKSM------TFDGRLVKKIWVPDVSFIHDTTTDNI---MLRVFPDGQVLYSMRITVTAMCNMDF
GBRG3_RAT       FNSTMKILTLNSNMVGLIWDTIFRNSK--TAEAHWITTPN---QLLRIWNDGKILYTLRLTINAECQLQL
GBRE_HUMAN      YNDTFESL---VLNGNV----VSQLWIPDTFFRNSKRTHEMPNQMVRIYKDGKVLYTIRMTIDAGCSLHM
GBRB3_RAT       YSG----IPLNLTLDNRVADQL---WVPDTYFLNDVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDL
GBRB3_MOUSE     YSG----IPLNLTLDNRVADQL---WVPDTYFLNDVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDL
GBRB3_HUMAN     YSG----IPLNLTLDNRVADQL---WVPDTYFLNDVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDL
GBRB3_CHICK     Y----AGIPLNLTLDNRVADQL---WVPDTYFLNDVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDL
GBRB1_RAT       YSG----IPLNLTLDNRVADQL---WVPDTYFLNDVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDL
GBRB1_MOUSE     YSG----IPLNLTLDNRVADQL---WVPDTYFLNDVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDL
GBRB1_HUMAN     YSG----IPLNLTLDNRVADQL---WVPDTYFLNDVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDL
GBRB1_BOVIN     YSG----IPLNLTLDNRVADQL---WVPDTYFLNDVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDL
GBRA4_HUMAN     YDGPIERLNNMMVTKVWTPDTFFRNGKKSVS--HNMTAPN---KLFRIMRNGTILYTMRLTISAECPMRL
GBRA4_BOVIN     YDGPIERLNNMMVTKVWTPDTFFRNGKKSVS--HNMTAPN---KLFRIMRNGTILYTMRLTISAECPMRL
GBRA4_RAT       YDGPIERLNNMMVTKVWTPDTFFRNGKKSVS--HNMTAPN---KLFRIMRNGTILYTMRLTISAECPMRL
GBRA4_MOUSE     YDGPIERLNNMMVTKVWTPDTFFRNGKKSVS--HNMTAPN---KLFRIMRNGTILYTMRLTISAECPMRL
GBRP_RAT        FEGN------KSFTLDARLVEFL--WVPDTYIVESLHEVTVGNRLIRLFSNGTVLYALRITTTVTCNMDL
ACHG_CHICK      WDPD-------------KYDDIQQVWLPDIVLENNIGTFEITLTNVLVYPDGSIYWLPPAIYRSSCSIHV
GBRT_MOUSE      YYETNLNLTL-----DYRMHEKL--WVPDCYFVNSVHDVTVENRVFQLHPDGTVRYGIRLTTTAACSLDL
GBRR1_MOUSE     FPSSNNLSM------TFDGRLVKKIWVPDMSFIHDTTTDNV---MLRVQPDGKVLYSLRVTVTAMCNMDF
GBRP_HUMAN      FEGN------KSFTLDARLVEFL--WVPDTYIVESLHEVTVGNRLIRLFSNGTVLYALRITTTVACNMDL
GBRR1_RAT       FPSTNNLSM------TFDGRLVKKIWVPDMSFIHDTTTDNV---MLRVQPDGKVLYSLRVTVTAMCNMDF
GBRR1_HUMAN     FPSTNNLSM------TFDGRLVKKIWVPDMSFIHDTTTDNV---MLRVQPDGKVLYSLRVTVTAMCNMDF
GBRP_MOUSE      FEGN------KSFTLDARLVEFL--WVPDTYIVESLHEVTVGNRLIRLFSNGTVLYALRITTTVTCNMDL
GBRE_RAT        YNDTFETL---ILHGNV----VSQLWIPDTFFRNSKRTQEIPNQMALIHKDGKVLYTVRMTIDARCSLHM
GLUCB_HAECO     YAHLGYHNPPKFLTVPHIKSNL---WIPDTFFPTEKAAHRTDNMFLRIHPDGKVLYSSRISITSSCHMQL
ACHA6_PANTR     WDPME-------YDGRIPADKI---WKPDIVLYNNVGDFQVEGKKALLKYNGMITWTPPAIFKSSCPMDI
ACHA6_HUMAN     WDPME-------YDGRVPADKI---WKPDIVLYNNVGDFQVEGKKALLKYNGMITWTPPAIFKSSCPMDI
GBRG4_CHICK     FNST-------LKALTLNTNMVSRIWIPDTFFRNSITTPN---QLLRIWNDGKVLYTLRLTIEAECLLQL
GBRD_RAT        YNHTNETLGL-----DSRF--VDKLWLPDTFIVNAKSAVTVENKLIRLQPDGVILYSIRITSTVACDMDL
GBRD_MOUSE      YNHTNETLGL-----DSRF--VDKLWLPDTFIVNAKSAVTVENKLIRLQPDGVILYSIRITSTVACDMDL
GBRD_HUMAN      YNHTNETLGL-----DSRF--VDKLWLPDTFIVNAKSAVTVENKLIRLQPDGVILYSIRITSTVACDMDL
GBRB_MUSDO      YRKRPGVETLSVGS-----EFIKNIWVPDTFFVNEIATTSNEF--IRVHHSGSITRSIRLTITASCPMNL
GBRB_DROSI      YRKRPGVETLSVGS-----EFIKNIWVPDTFFVNEIATTSNEF--IRVHHSGSITRSIRLTITASCPMNL
GBRB_CAEEL      WS-NEIPIDEMTLSGEFSQNI----WVPDTFLANDLHEVTERNKMLRINVDGKVAYGMRLTSTLSCSMNL
ACHG_XENLA      WDPND-------YHGSMMRIPSTSVWLPDVGLENNVGTFDIALTNTLVSSDGSMYWLPPAIYRSSCPVVV
ACHA6_MOUSE     WDPTE-------YDGRVPADNI---WKPDIVLYNNVGDFQVEGKKALLKYDGVITWTPPAIFKSSCPMDI
ACHA6_CHICK     RDPRE-------YDGEFVRVPADKIWKPDIVLYNNVGDFQVEGKKALLRYDGMITWTPPAIFKSSCPMDI
ACH3_DROME      WDEAD-------YGGRLPPDKV---WKPDIVLFNNAGNYEVRYKSVLIYPTGEVLWVPPAIYQSSCTIDV
GBRR2_HUMAN     FSSASNKSM------TFDGRLVKKIWVPDVSFTHDTTTDNI---MLRVFPDGHVLYSMRITVTAMCNMDF
ACHB_XENLA      WDPKQYGGIESLRISSSQV------WTPDIVLMNNNDGNFNFALQVDVLPNGNVTWHPPGLYVSSCSIEV
GLRB4_CAEEL     HNNTKRKDP-KLFGLLWHPDLYFAN--ARTASFHDVTQPNFL---VWIYPNGTVWYDCRISLTVLCMQDL
GBRB_DROME      YRKRPGVETLSVGS-----EFIKNIWVPDTFFVNEIATTSNEF--IRVHHSGSITRSIRLTITASCPMNL
ACHA6_RAT       WDPTE-------YDGRVPADNI---WKPDIVLYNNVGDFQVEGKKALLKYDGVITWTPPAIFKSSCPMDI
ACHE_RAT        FSKD-----------DFAGVEILHVWLPEIVLENNIDGQFGVAYNVLVYEGGSVSWLPPAIYRSTCAVEV
ACHG_BOVIN      WDPRDYGGLWVLRVPSTMV------WRPDIVLENNVGVFEVALYNVLVSPDGCVYWLPPAIFRSSCPVSV
ACHE_XENLA      WNVTD--------YGGIGFVPVPHDWLPDIVLENNIGNFEVAYANVLVYNTGYIYWLPPAIFRSTCNIEI
GBRB3_DROME     FDENDDGISDVLLSGDFAE----KIWVPDTFFANDLHDVTERNKLVRLGGDGAVTYGMRFTTTLACMMDL
ACHG_TORCA      WNTSE-------YEGDLVRIPSELLWLPDVVLENNVGQFEVAYANVLVYNDGSMYWLPPAIYRSTCPIAV
ACHD_BOVIN      WDAEDFGNISVLR---LPADMV---WLPEIVLENNNGSFQISSCNVLIYPSGSVYWLPPAIFRSSCPISV
ACH2_DROME      WDPSEYGGVTELYVPSEHI------WLPDIVLYNNADGEYVVTTMTKLHYTGKVVWTPPAIFKSSCEIDV
ACHD_MOUSE      WDANDFGNITVL---RLPPDMV---WLPEIVLNNNDGSFQISACNVLVYDSGYVTWLPPAIFRSSCPISV
ACHB_TORCA      WDP-------AAYEGDLRIPS-SDVWQPDIVLMNNDGSFEITLHNVLVQHTGAVSWQPSAIYRSSCTIKV
ACH8_CAEEL      WSPEE--------YGNITTLQIPHGWKPDILLFNSANEHFDASFPVHVSSNGDVLFAPPGIVSFSCSLSM
ACR7_CAEEL      WNPDYENITSVRFQGEDQI------WQPDILLYNRYIEDEQESFDITAYSDGVINWIPPGIFKLSCKMDI
ACR2_CAEEL      WNPAEYGNISNLHVPS---DRV---WLPDIVLFNNAGNYEVSFKSVFVDHHGDVTWVPPAMFKSSCRIDV
ACHA3_BOVIN     WNPSD-------YDGEFMRVPAEKIWKPDIVLYNNVGDFQVKTKALLKY-TGEVTWIPPAIFKSSCKIDV
ACHG_RAT        WDPKDYEGLWILRVPSTMV------WQPDIVLGNNVGVFEVALYNVLVSPDGCIYWLPPAIFRSSCSISV
ACHG_HUMAN      WDPRDYEGLWVLRVPSTMV------WRPDIVLENNVGVFEVALYNVLVSPDGCIYWLPPAIFRSACSISV
ACHE_HUMAN      YSKDDLRVPSELV------------WLPEIVLENNIDGQFGVAANVLVYEGGSVTWLPPAIYRSVCAVEV
ACHD_RAT        WNANEFGNITVL---RLPSDMV---WLPEIVLNNNDGSFQISACNVLVSDSGHVTWLPPAIFRSSCPISV
ACHA3_RAT       WKPSD-------YQGEFMRVPAEKIWKPDIVLYNNAGDFQVKTKALLKY-TGEVTWIPPAIFKSSCKIDV
ACHA3_MOUSE     WKPSD-------YQGEFMRVPAEKIWKPDIVLYNNAGDFQVKTKALLKY-TGEVTWIPPAIFKSSCKIDV
ACHA3_CHICK     WNPVD--------YGGAEFIRVPSGWKPDIVLYNNVGDFQVKTKALLKY-TGDVTWIPPAIFKSSCKIDV
ACHA3_CARAU     W------LPAEFDGIEFIRVPSNKIWRPDIVLYNNVGLVEDKTKALLKY-DGTITWVPPAIFKSSCPMDI
YO99_CAEEL      FKHNVCATNITLKVSDFRK----KIWTPDTCXXXXXXXXXXXXXXVILYENG-LVWSNFR-LNVKTPVNL
ACH1_CAEEL      WDKAENITDVRFPAGKI--------WKPDVLLYNSVDTNFDSTYQTNVYSTGLVHWVPPGIFKISCKIDI
ACHG_MOUSE      WDPKDYEGLWILRVPSTMV------WRPDIVLENNVGVFEVALYNVLVSPDGCIYWLPPAIFRSSCSISV
ACHA3_HUMAN     WNPSD-------YGGEFMRVPAQKIWKPDIVLYNNVGDFQVKTKALLKY-TGEVTWIPPAIFKSSCKIDV
ACH1_SCHGR      WDPAEYGGVTELYVPSEHI------WLPDIVLYNNADGEYVVTTMTKLHHTGKVVWTPPAIFKSSCEIDV
ACHE_MOUSE      YSKD-----------DFAGVGILHVWLPEIVLENNIDGQFGVASNVLVYEGGYVSWLPPAIYRSTCAVEV
LGC4_CAEEL      WNESLWSEIKAIYIPHARI------WKPDIILVNNAIRESLVSTDVMVTSDGNVTWLFSALFRSSCPIRV
LGC4_CAEBR      WNESLWSDIKAIYIPHARI------WKPDIILVNNAIRESLVSTDVMVTSDGNVTWLFSALFRSSCPIRV
ACHD_HUMAN      WNAEEFGNISVLR---LPPDMV---WLPEIVLENNNGSFQISSCNVLVYHYGFVYWLPPAIFRSSCPISV
ACH8_CAEBR      WSPEE--------YGNITSLQIPFGWKPDILLFNSANEHFDSSFPVNVSNDGNVLFAPPGIMQFSCSLSM
LAR_DROME       -------------------------FKNGLGRLSEKVTVRIKPEDVPLNLRAHDVSTHSMTLSWSPPIRL
ACHD_CHICK      WNTSERLLPEML-------------WLPEIVLENNNGLFEVAYYNVLVYNTGYVYWLPPAIFRSACPINV


                         +         .         .         .         .         *         .:210
query           EKFPFDKQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYYGK
ELIC_ERWCH      RLFPFDRQQFVLELEPFSYNNQQLRF-------SDIQVYTENIDNEEIDEWWIRKAS-THISDIRYDHLS
GLUCL_DROME     KLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQV-----------VKNLHLPRFTLEKF-LTDYCNSK
GLRA4_MOUSE     KNFPMDIQTCTMQLESFGYTMNDLMF-----------EWLEDAPAVQVAELTLPQFILRDEKDLGYKHYN
GLRA3_RAT       KNFPMDVQTCIMQLESFGYTMND--LIFE----------WQDEAPVQVAELTLPQFLLKEEKDLRYKHYN
GLRA3_MOUSE     KNFPMDVQTCIMQLESFGYTMND--LIFE----------WQDEAPVQVAELTLPQFLLKEEKDLRYKHYN
GLRA3_HUMAN     KNFPMDVQTCIMQLESFGYTMND--LIFE----------WQDEAPVQVAELTLPQFLLKEEKDLRYKHYN
GLRA1_DANRE     KNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLT-----------LPQFILKEEKDLRYKHYN
GLRA4_HUMAN     KNFPMDIQTCTMQLESVGYTMKDL-----------VFEWLEDAPAVQVAELTLPQFILRDEKDLKHY--N
GLRA2_MOUSE     KNFPMDVQTCTMQLESFGYTMNDL-----------IFEWLSDGP-VQVAELTLPQFILKEEKELGYKHYN
GLRA2_HUMAN     KNFPMDVQTCTMQLESFGYTMNDL-----------IFEWLSDGP-VQVAELTLPQFILKEEKELGYKHYN
GLRA1_RAT       KNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLT-----------LPQFILKEEKDLRYKHYN
GLRA1_MOUSE     KNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLT-----------LPQFILKEEKDLRYKHYN
GLRA1_HUMAN     KNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLT-----------LPQFILKEEKDLRYKHYN
GLRA1_BOVIN     KNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLT-----------LPQFILKEEKDLRYKHYN
GBRG1_RAT       HNFPMDEHSCPLEFSSYGYPKNEI-------------EYKWKKPSVEVADWRLYQFGLRNSTEISHTISG
GBRA3_HUMAN     EDFPMDVHACPLKFGSYAYTTAEV----------------------------------------------
GBRA3_BOVIN     EDFPMDVHACPLKFGSYAYTTAEV----------------------------------------------
GLRA2_RAT       KNFPMDVQTCTMQLESFEYTMNDL-----------IFEWLSDGP-VQVAELTLPQFILKEEKELGYKHYN
GBRA3_RAT       EDFPMDVHACPLKFGSYAYTKAEV----------------------------------------------
GBRA3_MOUSE     EDFPMDVHACPLKFGSYAYTKAEV----------------------------------------------
GBRG1_MOUSE     HNFPMDEHSCPLEFSSYGYPKNEI-------------EYKWKKPSVEVADWRLYQFGLRNSTEISHTISG
GBRG1_HUMAN     HNFPMDEHSCPLEFSSYGYPKNEI-------------EYKWKKPSVEVADWRLYQFGLRNSTEITHTISG
GBRA5_BOVIN     EDFPMDAHACPLKFGSYAYPNSEV-IYVWTNG--TAKSVVVAEDGSRLNQYHLMG-QTVGTENISTSTGE
GBRT_HUMAN      HKFPMDKQACNLVVESYGYTVEDIILFWDDN-----GNAIHMTEELHIPQFTFLGRTITSKE-VYFYTGS
GBRA5_RAT       EDFPMDAHACPLKFGSYAYPNSEVVYVWTNG---STKSVVVAEDGSRLNQYHLMGQTV-GTENISTSTGE
GBRA5_MOUSE     EDFPMDAHACPLKFGSYAYPNSEVVYVWTNG---STKSVVVAEDGSRLNQYHLMGQTV-GTENISTSTGE
GBRA5_HUMAN     EDFPMDAHACPLKFGSYAYPNSEVVYVWTNG---STKSVVVAEDGSRLNQYHLMGQTV-GTENISTSTGE
GBRR3_HUMAN     SRFPLDTQNCSLELESYAYNEDDLMLYWKHGNK-----SLNTEEHMSLSQFFIEDFSASS---GLAFYSS
GBRR3_RAT       SRFPLDTQNCSLELESYAYNEEDLMLYWKHGNK-----SLNTEEHISLSQFFIEEFSASS---GLAFYSS
GBRG2_RAT       HNFPMDEHSCPLEFSSYGYPREEI----------------------------------------------
GBRG2_PONAB     HNFPMDEHSCPLEFSSYGYPREEI----------------------------------------------
GBRG2_MOUSE     HNFPMDEHSCPLEFSSYGYPREEI----------------------------------------------
GBRG2_HUMAN     HNFPMDEHSCPLEFSSYGYPREEI----------------------------------------------
GBRAL_DROME     ADFPMDIQKCPLKFGSFGYTTSDV-----------IYRWNKERPPVAIAEMKLSQFDL------------
GBRG2_BOVIN     HNFPMDEHSCPLEFSSYGYPREEI----------------------------------------------
GBRA6_HUMAN     VNFPMDGHACPLKFGSYAYPKSEI--------IYTWKKGXXXXXXXXXXXXXXXQYDLVSSETIKSNTGE
GBRA6_CHICK     VNFPMDGHACPLKFGSYAYPKSEIIYTWKPLHSVEV-----PQESSSLLQYDLIGQTVSS-ETIKSNTGE
GLRB_RAT        TLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQLEKIA------------LPQFDIKKEDXXXXXXXX
GLRB_MOUSE      TLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQLEKIA------------LPQFDIKKEDXXXXXXXX
GLRB_HUMAN      TLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQLEKIA------------LPQFDIKKEDXXXXXXXX
GLRB_BOVIN      TLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQLEKIA------------LPQFDIKKEDXXXXXXXX
GBRG2_CHICK     HNFPMDAHSCPLEFSSYGYPREEI----------------------------------------------
GBRB4_CHICK     RRYPLDQQNCTLEIESYGYTVDDIVFFWQGNDSAVTGMEVLELPQFTIIEQRL-----------------
GBRR2_MOUSE     SHFPLDSQTCSLELESYAYTDEDLMLYWKNG-----DESLKTDEKISLSQFLIQKF---HTTSRLAFYSS
GBRP_BOVIN      SKYPMDTQTCKLQLESWGYDGNDVEF-----SWLRGNDSVRGLENLRLAQYTIQQY-FTSVTRSQQETGN
GBRG3_HUMAN     HNFPMDEHSCPLIFSSYGY-PKEEMIYRWRKNSVEAADQ---------KSWRLYQFDLRNTTEIVTTSAG
GBRB2_RAT       RRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLIT------KKVVFSTGS
GBRB2_MOUSE     RRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLIT------KKVVFSTGS
GBRB2_HUMAN     RRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLIT------KKVVFSTGS
GBRB2_BOVIN     RRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLIT------KKVVFSTGS
GBRB_LYMST      HNYPLDHQECTVEIESYGYTMDDIVL-----YWLNDRGAVTGVEDVSLPQFSITNYTINKIEELS--TGD
GBRA6_RAT       VNFPMDGHACPLKFGSYAYPKSEI----------------------------------------------
GBRA6_MOUSE     VNFPMDGHACPLKFGSYAYPKTEI----------------------------------------------
GBRA2_BOVIN     EDFPMDAHSCPLKFGSYAYTTSEVTYIWTYN----ASDSVQVAPDGS----RLNQYDLPGKETIKSSTGE
GBRA1_RAT       EDFPMDAHACPLKFGSYAYTRAEVEWTREPARSVVVAE--------------------------------
GBRA1_PONAB     EDFPMDAHACPLKFGSYAYTRAEVEWTREPARSVVVAE--------------------------------
GBRA1_MOUSE     EDFPMDAHACPLKFGSYAYTRAEVEWTREPARSVVVAE--------------------------------
GBRA1_MACFA     EDFPMDAHACPLKFGSYAYTRAEVEWTREPARSVVVAE--------------------------------
GBRA1_HUMAN     EDFPMDAHACPLKFGSYAYTRAEVEWTREPARSVVVAE--------------------------------
GBRA1_BOVIN     EDFPMDAHACPLKFGSYAYTRAEVEWTREPARSVVVAE--------------------------------
GLUCB_CAEEL     QLYPLDYQSCNFDLVSYAHTMNDIMYEWDPSTPVQLKPGVSDLPNF-ILKNYTTNADCTSHTNTGSY---
GBRG3_MOUSE     HNFPMDAHACPLTFSSYGY-PKEEMIYRWRKNSVEAADQ---------KSWRLYQFDLRNTTEIVTTSAG
GBRA2_RAT       EDFPMDAHSCPLKFGSYAYTTSEVTYIWTYN----PSDSVQVAPDGS----RLNQYDLLGKETIKSSTGE
GBRA2_PONAB     EDFPMDAHSCPLKFGSYAYTTSEVTYIWTYN----ASDSVQVAPDGS----RLNQYDLLGKETIKSSTGE
GBRA2_MOUSE     EDFPMDAHSCPLKFGSYAYTTSEVTYIWTYN----ASDSVQVAPDGS----RLNQYDLLGKETIKSSTGE
GBRA2_HUMAN     EDFPMDAHSCPLKFGSYAYTTSEVTYIWTYN----ASDSVQVAPDGS----RLNQYDLLGKETIKSSTGE
GBRA1_CHICK     EDFPMDVHACPLKFGSYAYTRAEVEWTREPARSVVVAE--------------------------------
GBRR2_RAT       SHFPLDSQTCSLELESYAYTDEDLMLYWKNG-----DESLKTDEKISLSQFLIQKF---HTTSRLAFYSS
GBRR2_BOVIN     SHFPLDSQTCSLELESYAYTDEDLMLYWKNG-----DESLKTDEKISLSQFLIQKF---HTTSRLAFYSS
GBRG3_RAT       HNFPMDAHACPLTFSSYGY-PKEEMIYRWRKNSVEAADQ---------KSWRLYQFDLRNTTEIVTTSAG
GBRE_HUMAN      LRFPMDSHSCPLXXXXXXYPENEM-IYKWENFKLEINE---------KNSWKLFQFDFTGVSNKTEIITT
GBRB3_RAT       RRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVS------RNVVFATGA
GBRB3_MOUSE     RRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVS------RNVVFATGA
GBRB3_HUMAN     RRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVS------RNVVFATGA
GBRB3_CHICK     RRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDNAVTGVERIELPQFSIVEYRLVS---KN---VVFATGA
GBRB1_RAT       RRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVS------KKVEFTTGA
GBRB1_MOUSE     RRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVS------KKVEFTTGA
GBRB1_HUMAN     RRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVS------KKVEFTTGA
GBRB1_BOVIN     RRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVS------KKVEFTTGA
GBRA4_HUMAN     VDFPMDGHACPLKFGSYAYPKSE---MIYTWTKGXXXXXXXXXXXXXLVQYDLIGQTVSS-ETIKSITGE
GBRA4_BOVIN     VDFPMDGHACPLKFGSYAYPKSE---MIYTWTKGXXXXXXXXXXXXXLVQYDLIGQTVSS-ETIKSITGE
GBRA4_RAT       VDFPMDGHACPLKFGSYAYPKSEM----------------------------------------------
GBRA4_MOUSE     VDFPMDGHACPLKFGSYAYPKSEM----------------------------------------------
GBRP_RAT        SKYPMDTQTCKLQLESWGYDGNDVEF-----SWLRGNDSVRGLENLRLAQYTIQQY----FTLVTVSQQE
ACHG_CHICK      TYFPFDWQNCTMVFQSQTYSANEINLLLTVEEGQTIEIFIDPEAFTENGEWAIKHRPARKIINSGRFTPD
GBRT_MOUSE      QKFPMDKQSCKLEVESYGYTVEDIVLSWEDDNAIHITD------GLHIPQYTYLGRTITSKE-VYFYTGS
GBRR1_MOUSE     SRFPLDTQTCSLEIESYAYTEDDLMLYWKKGN-----DSLKTDERISLSQFLIQEF---HTTTKLAFYSS
GBRP_HUMAN      SKYPMDTQTCKLQLESWGYDGNDVE---------------------------------------------
GBRR1_RAT       SRFPLDTQTCSLEIESYAYTEDDLMLYWKKGN-----DSLKTDERISLSQFLIQEF---HTTTKLAFYSS
GBRR1_HUMAN     SRFPLDTQTCSLEIESYAYTEDDLMLYWKKGN-----DSLKTDERISLSQFLIQEF---HTTTKLAFYSS
GBRP_MOUSE      SKYPMDTQTCKLQLESWGYDGNDVEF-----SWLRGNDSVRGLENLRLAQYTIQQY----FTLVTVSQQE
GBRE_RAT        LNFPMDSHSCPLXXXXXXYDEHEM-IYKWENFKLKI-----DAKN----TWKLLEFDFTGVNNKTEIIST
GLUCB_HAECO     QLYPLDLQFCDFDLVSYAHTMKDIVYEWDPLAPVQLKPGVGS---------DLPNFQLTNITTNDTSHTN
ACHA6_PANTR     TFFPFDHQNCSLKFGSWTYDKAEIDLLI-IGSKVDMNDFWEN------SEWEI-----------------
ACHA6_HUMAN     TFFPFDHQNCSLKFGSWTYDKAEIDLLI-IGSKVDMNDFWEN------SEWEI-----------------
GBRG4_CHICK     QNFPMDTHSCPLVFSSYGYPREEI-VYRWRRYSIEVSDQ---------RTWRLYQFDFTGLEVLRTGAGE
GBRD_RAT        AKYPMDEQECMLDLESYGYSSEDI----------------------------------------------
GBRD_MOUSE      AKYPLDEQECMLDLESYGYSSEDI----------------------------------------------
GBRD_HUMAN      AKYPMDEQECMLDLESYGYSSEDI----------------------------------------------
GBRB_MUSDO      QYFPMDRQLCHIEIESFGYTMRDIR---------------------------------------------
GBRB_DROSI      QYFPMDRQLCHIEIESFGYTMRDIR---------------------------------------------
GBRB_CAEEL      RNFPLDSQNCTVEIESYGYTTSEV--LMKWNYPLAVHGVEQDVPQFTITGFHTED------SIVSTATGS
ACHG_XENLA      TYFPFDWQNCSIVFQSQTYSANEIELLLTVDEQTIEWIEIDPEAFTENGEWAIKHMPAKRI--INHRLPR
ACHA6_MOUSE     TFFPFDHQNCSLKFGSWTYDKAEIDLLI-IGSKVDMNDFWEN------SEWEI-----------------
ACHA6_CHICK     TFFPFDHQNCSLKFGSWTYDKAKIDLLI------------------------------------------
ACH3_DROME      TYFPFDQQTCIMKFGSWTFNGDQVSLALYNNKNVDLSDYWK-----------------------------
GBRR2_HUMAN     SHFPLDSQTCSLELESYAYTDEDLMLYWKNG-----DESLKTDEKISLSQFLIQKF---HTTSRLAFYSS
ACHB_XENLA      QYYPFDWQNCSMVFRSYTYGADEVTLV-------------------------------------------
GLRB4_CAEEL     ARYPLDSQNCGLRILSYAYD--EEQLIIRWNG----GNPVEVNRGIRMPDMHLKH--------IKFYTKR
GBRB_DROME      QYFPMDRQLCHIEIESFGYTMRDIR---------------------------------------------
ACHA6_RAT       TFFPFDHQNCSLKFGSWTYDKAEIDLLI-IGSKVDMNDFWEN------SEWEI-----------------
ACHE_RAT        TYFPFDWQNCSLIFRSQTYNAEEVELI-------------------------------------------
ACHG_BOVIN      TFFPFDWQNCSLIFQSQTYSTNEINLQLSQEDGQTIEIFIDPEAFTENGEWAIRHRPAKMLEAAPAEEAG
ACHE_XENLA      TYFPFDWQNCSLVFRSKTYSANEIQLVTDDETGLPFDQVDIDREAFTEGEWAIMHRPARKILNPK-YSKE
GBRB3_DROME     HYYPLDSQNCTVEIESYGYTVSDVVMYWKPTPVRGVED--AELPQFTIIGYE------TNDRKERLATGV
ACHG_TORCA      TYFPFDWQNCSLVFRSQTYNAHEVNLQLSAEEGEAVEIHIDPEDFTENGEWTIRH------RPAKKNYND
ACHD_BOVIN      TYFPFDWQNCSLKFSSLKYTTKEITL--------------------------------------------
ACH2_DROME      RYFPFDQQTCFMKFGSWTYDGDQIDLISQKNDKIDLREY---YPSV---EWDILGVPAERHE--KYYPCC
ACHD_MOUSE      TYFPFDWQNCSLKFSSLKYTAKEITLSLEENNRSYPIEWIIIDPETENGEWEIVHRAAKNVDP-------
ACHB_TORCA      MYFPFDWQNCTMVFKSYTYDTSEVTL--------------------------------------------
ACH8_CAEEL      TWFPYDQQVCYLKFGSWTYGKKDLQIDLPDGHKMDLQYYI------------------------------
ACR7_CAEEL      TLFPFDEQICFMKFGSWTYHGFALDLRLEPSADLST--------YITNGEWHLLSAPARREE--KFYKCC
ACR2_CAEEL      EWFPFDEQCCTLVFGSWTYNSEEVRL--------------------------------------------
ACHA3_BOVIN     TYFPFDYQNCTMKFGSWSYDKAKIDLVL-IGSSMNLKDY-------------------------------
ACHG_RAT        TYFPFDWQNCSLVFQSQTYSTSEINLQLSQEDGQAIEIFIDPEAFTENGEWAIRHRPAKMLDPVT--PAE
ACHG_HUMAN      TYFPFDWQNCSLIFQSQTYSTNEIDLQLSQEDGQTIEIFIDPEAFTENGEWAIQHRPAKMLDPAA--PAQ
ACHE_HUMAN      TYFPFDWQNCSLIFRSQTYNAEEVEFAVDNDGKTINKIDIDTEAYTENGEWAIDFCP----GVIRRHHGG
ACHD_RAT        TYFPFDWQNCSLKFSSLKYTAKEIRLSLEDNRSYPIEWIIIDPEGFTEGEWEIVHRAAKNVDP-------
ACHA3_RAT       TYFPFDYQNCTMKFGSWSYDKAKIDLVL-IGSSMNLKDY-------------------------------
ACHA3_MOUSE     TYFPFDYQNCTMKFGSWSYDKAKIDLVL-IGSSMNLKDY-------------------------------
ACHA3_CHICK     TYFPFDYQNCTMKFGSWSYDKAKIDLVL-IGSTMNLKDY-------------------------------
ACHA3_CARAU     TYFPFDYQNCSMKFGSWTYDKAKIDLVL-IGSKVNLKDF-------------------------------
YO99_CAEEL      KMFPFDSLSCEIVLESYSFNTDEVRLMWH-DVPITMMEKV-ELPDFDLIGWSTDH------QRLEYPNGI
ACH1_CAEEL      QWFPFDEQ--------------------------------------------------------------
ACHG_MOUSE      TYFPFDWQNCSLIFQSQTYSTSEINLQLSQEDGQAIEIFIDPEAFTENGEWAIAKMLLDSVAP-----AE
ACHA3_HUMAN     TYFPFDYQNCTMKFGSWSYDKAKIDLVL-IGSSMNLKDY-------------------------------
ACH1_SCHGR      RYFPFDQQTCFMKFGSWTYDGDQIDLINQKYDDNKVKDLREYYPSV---EWDILGVPAERHE--KYYPCC
ACHE_MOUSE      TYFPFDWQNCSLIFRSQTYNAEEVEFI-------------------------------------------
LGC4_CAEEL      RYYPFDDQQCDLKFASWSHDITEINL--------------------------------------------
LGC4_CAEBR      RYYPFDDQQCDLKFASWSHDITEINL--------------------------------------------
ACHD_HUMAN      TYFPFDWQNCSLKFSSLKYTAKEITLSLKQDAK-------------------------------------
ACH8_CAEBR      TWFPYDEQVCYLKFGSWTY-GKKLDLRIDEGHKMDLQYYV------------------------------
LAR_DROME       TKISFD--AMKVFVDSQGFSQTQIV----PKREIILKHYVKTHTINELSPFTTYNVNVSAI-PSDYSYRP
ACHD_CHICK      NFFPFDWQNCTLKFSSLAYNAQEINMLKEESDPETEKNYIDPEGFTENGEWEIIHRPAKNIHP--SYPTE


                         .         .         .         +         .         .         .:280
query           PQRISMLEFSISLERKPTNXXXXXXXXXXXXXXAMWAIFWMDTKALSDRLNIAFIGILSVIAYQFLIEGE
ELIC_ERWCH      SVQPNQNEFSIDAVRNPSYYLWSFILPLGLIIAASWSVFWLE--SFSERLQTSFTLMLTVVAYAFYTSNI
GLUCL_DROME     TNEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINAS
GLRA4_MOUSE     TGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRAS
GLRA3_RAT       TGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRAS
GLRA3_MOUSE     TGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRAS
GLRA3_HUMAN     TGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRAS
GLRA1_DANRE     TGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRAS
GLRA4_HUMAN     TGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRAS
GLRA2_MOUSE     TGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRAS
GLRA2_HUMAN     TGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRAS
GLRA1_RAT       TGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRAS
GLRA1_MOUSE     TGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRAS
GLRA1_HUMAN     TGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRAS
GLRA1_BOVIN     TGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRAS
GBRG1_RAT       DYIIMTIFFDLS--RRMGYFTIQTYIPCILTVVLSWVSFWINKDAVPARXXXXXXXXXXXXXXXXXARKS
GBRA3_HUMAN     ----------------------------------------------------------------------
GBRA3_BOVIN     ----------------------------------------------------------------------
GLRA2_RAT       TGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRAS
GBRA3_RAT       ----------------------------------------------------------------------
GBRA3_MOUSE     ----------------------------------------------------------------------
GBRG1_MOUSE     DYIIMTIFFDLS--RRMGYFTIQTYIPCILTVVLSWVSFWINKDAVPARXXXXXXXXXXXXXXXXXARKS
GBRG1_HUMAN     DYVIMTIFFDLS--RRMGYFTIQTYIPCILTVVLSWVSFWINKDAVPARXXXXXXXXXXXXXXXXXARKS
GBRA5_BOVIN     ---YTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNS
GBRT_HUMAN      YIRL-ILKFQV--QREVNSYLVQVYWPTVLTTITSWISFWMNYDSSAARVTIGLTSMLILTTIDSHLRDK
GBRA5_RAT       ---YTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNS
GBRA5_MOUSE     ---YTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNS
GBRA5_HUMAN     ---YTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNS
GBRR3_HUMAN     TGWYNRLFINXXXXXXXXXXXXQTYFPAILMVMLSWVSFWIDRRAVPARVSLGITTVLTMSTIITAVSAS
GBRR3_RAT       TGWYYRLFINFVLRRHIFFFVLQTYFPAMLMVMLSWVSFWIDRRAVPARVSLGITTVLTMSTIVTGVSAS
GBRG2_RAT       ----------------------------------------------------------------------
GBRG2_PONAB     ----------------------------------------------------------------------
GBRG2_MOUSE     ----------------------------------------------------------------------
GBRG2_HUMAN     ----------------------------------------------------------------------
GBRAL_DROME     ----------------------------------------------------------------------
GBRG2_BOVIN     ----------------------------------------------------------------------
GBRA6_HUMAN     ---YVIMTVYFHLQRKMGYFMIQIYTPCIMTVILSQVSFWINKESVPARTVFGITTVLTMTTLSISARHS
GBRA6_CHICK     ---YVIMTVYFHLQRKMGYFMIQIYTPCIMTVILSQVSFWINKESVPARTVFGITTVLTMTTLSISARHS
GLRB_RAT        XXXXXXVEVIFTLRRQVGFYMMGVYAPTLLIVVLSWLSFWINPDASAARVPLGIFSVLSLASECTTLAAE
GLRB_MOUSE      XXXXXXVEVIFTLRRQVGFYMMGVYAPTLLIVVLSWLSFWINPDASAARVPLGIFSVLSLASECTTLAAE
GLRB_HUMAN      XXXXXXVEVIFTLRRQVGFYMMGVYAPTLLIVVLSWLSFWINPDASAARVPLGIFSVLSLASECTTLAAE
GLRB_BOVIN      XXXXXXVEVIFTLRRQVGFYMMGVYAPTLLIVVLSWLSFWINPDASAARVPLGIFSVLSLASECTTLAAE
GBRG2_CHICK     ----------------------------------------------------------------------
GBRB4_CHICK     ----------------------------------------------------------------------
GBRR2_MOUSE     TGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDHRAVPARVSLGIMTVLTMSTIITGVNAS
GBRP_BOVIN      YTRL-VLQF--ELQRNVLYFILETYVPSTFLVVLSWVSFWISLDSVPARTCIGVTTVLSM----------
GBRG3_HUMAN     DYVVMTIYFELS--RRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARXXXXXXXXXXXXXXXXIARKS
GBRB2_RAT       YPRLSL---SFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGIXXXXXXXXXXXHLRET
GBRB2_MOUSE     YPRLSL---SFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGIXXXXXXXXXXXHLRET
GBRB2_HUMAN     YPRLSL---SFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGIXXXXXXXXXXXHLRET
GBRB2_BOVIN     YPRLSL---SFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGIXXXXXXXXXXXHLRET
GBRB_LYMST      YQRLSLI---FQLQRNIGYFIFQTYLPSILIVMLSWVSFWINHEATSARVALGITTVLTMTTISNGVRSS
GBRA6_RAT       ----------------------------------------------------------------------
GBRA6_MOUSE     ----------------------------------------------------------------------
GBRA2_BOVIN     ---YTVMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNS
GBRA1_RAT       ----------------------------------------------------------------------
GBRA1_PONAB     ----------------------------------------------------------------------
GBRA1_MOUSE     ----------------------------------------------------------------------
GBRA1_MACFA     ----------------------------------------------------------------------
GBRA1_HUMAN     ----------------------------------------------------------------------
GBRA1_BOVIN     ----------------------------------------------------------------------
GLUCB_CAEEL     ----GCLRMQLLFKRQFSYYLVQLYAPTTMIVIVSWVSFWIDLHSTAGRVALGVXXXXXXXXXQSAINAK
GBRG3_MOUSE     DYVVMTIYFELS--RRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARXXXXXXXXXXXXXXXXIARKS
GBRA2_RAT       ---YTVMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNS
GBRA2_PONAB     ---YTVMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNS
GBRA2_MOUSE     ---YTVMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNS
GBRA2_HUMAN     ---YTVMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNS
GBRA1_CHICK     ----------------------------------------------------------------------
GBRR2_RAT       TGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDHRAVPARVSLGIMTVLTMSTIITGVNAS
GBRR2_BOVIN     TGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDRRAVPARVSLGITTVLTMSTIITGVNAS
GBRG3_RAT       DYVVMTIYFELS--RRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARXXXXXXXXXXXXXXXXIARKS
GBRE_HUMAN      PGDFMVMTIFFNVSRRFGYVAFQNYVPSSVTTMLSWVSFWIKTESAPARTSLGITSVLTMTTLGTFSRKN
GBRB3_RAT       YPRLSL---SFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGIXXXXXXXXXXXHLRET
GBRB3_MOUSE     YPRLSL---SFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGIXXXXXXXXXXXHLRET
GBRB3_HUMAN     YPRLSL---SFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGIXXXXXXXXXXXHLRET
GBRB3_CHICK     YPRLSL---SFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGIXXXXXXXXXXXHLRET
GBRB1_RAT       YPRLSL---SFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGIXXXXXXXXXXXHLRET
GBRB1_MOUSE     YPRLSL---SFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGIXXXXXXXXXXXHLRET
GBRB1_HUMAN     YPRLSL---SFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGIXXXXXXXXXXXHLRET
GBRB1_BOVIN     YPRLSL---SFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGIXXXXXXXXXXXHLRET
GBRA4_HUMAN     ---YIVMTVYFHLRRKMGYFMIQTYIPCIMTVILSQVSFWINKESVPARTVFGITTVLTMTTLSISARHS
GBRA4_BOVIN     ---YIVMTVYFHLRRKMGYFMIQTYIPCIMTVILSQVSFWINKESVPARTVFGITTVLTMTTLSISARHS
GBRA4_RAT       ----------------------------------------------------------------------
GBRA4_MOUSE     ----------------------------------------------------------------------
GBRP_RAT        TGNYTRLVLQFELRRNVLYFILETYVPSTFLVVLSWVSFWISLESVPARTCIGVTTVLSM----------
ACHG_CHICK      DIQYQQVIFYLIIQRKPLFYIINIIVPCVLISSMAVLVYFLPAKAGGQKCTVSINVLLAQTVFLFLIAQK
GBRT_MOUSE      YMRL-IVKFQV--QREVRSYLVQVYWPTVLTTILSWISFWMNYDSSAARVTIGLTSILVLTTIDSHMRDK
GBRR1_MOUSE     TGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDRRAVPARVPLGITTVLTMSTIITGVNAS
GBRP_HUMAN      ----------------------------------------------------------------------
GBRR1_RAT       TGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDRRAVPARVPLGITTVLTMSTIITGVNAS
GBRR1_HUMAN     TGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDRRAVPARVPLGITTVLTMSTIITGVNAS
GBRP_MOUSE      TGNYTRLVLQFELRRNVLYFILETYVPSTFLVVLSWVSFWISLDSVPARTCIGVTTVLSM----------
GBRE_RAT        PGDFMVMTFFFNVSRRFGFIVFQNYIPSSVTTMLSWVSFWIKIEXXXXXXXXXXXXXLTMATLGTFSRKN
GLUCB_HAECO     TGSYACLRMQLTLKRQFSYYLVQLYGPTTMIVIVSWVSFWIDMHSTAGRVALGVXXXXXXXXXQAAINAK
ACHA6_PANTR     ----------------------------------------------------------------------
ACHA6_HUMAN     ----------------------------------------------------------------------
GBRG4_CHICK     ---YMVMTVSFDLSRRMGYFAIQTYIPCILTVVLSWVSFWIKRDSTPARXXXXXXXXXXXXXXXXXXRKH
GBRD_RAT        ----------------------------------------------------------------------
GBRD_MOUSE      ----------------------------------------------------------------------
GBRD_HUMAN      ----------------------------------------------------------------------
GBRB_MUSDO      ----------------------------------------------------------------------
GBRB_DROSI      ----------------------------------------------------------------------
GBRB_CAEEL      YQRLSLV---FQLRRSVGYFIFQTYLPCVLIVMLSWVSFWINHEATSARVAXXXXXXXXXXXXXXXXRQS
ACHG_XENLA      DDNYQQIVFYLIIQRKPLFYIINIIVPCVLISFVSILVYFLPAKAGGQKCTVSINILLAQTVFLFLVAQK
ACHA6_MOUSE     ----------------------------------------------------------------------
ACHA6_CHICK     ----------------------------------------------------------------------
ACH3_DROME      ----------------------------------------------------------------------
GBRR2_HUMAN     TGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDRRAVPARVSXXXXXXXXXXXXXXXXNAS
ACHB_XENLA      ----------------------------------------------------------------------
GLRB4_CAEEL     DKYATGIWSSFHVDREITHHIIQSYIPTSLIVIISWFSFWLDVEAVPGRV--------------------
GBRB_DROME      ----------------------------------------------------------------------
ACHA6_RAT       ----------------------------------------------------------------------
ACHE_RAT        ----------------------------------------------------------------------
ACHG_BOVIN      HQKV---VFYLLIQRKPLFYVINIIAPCVLISSVAILIYFLPAKAGGQKCTVAINVLLAQTVFLFLVAKK
ACHE_XENLA      DLRYQEIVFNLIIQRKPLFYIINIIVPCVLISFLVVLVYFLPAKAGGQKCTVSISVLLAQTVFLFLIAQM
GBRB3_DROME     YQRLSL---SFKLQRNIGYFVFQTYLPSILIVMLSWVSFWINHEATSARVAXXXXXXXXXXXXXXXXRSS
ACHG_TORCA      DTDFQEIIFFLIIQRKPLFYIINIIAPCVLISSLVVLVYFLPAQAGGQKCTLSISVLLAQTIFLFLIAQK
ACHD_BOVIN      ----------------------------------------------------------------------
ACH2_DROME      AEPYPDIFFNITLRRK------------------------------------------------------
ACHD_MOUSE      ----------------------------------------------------------------------
ACHB_TORCA      ----------------------------------------------------------------------
ACH8_CAEEL      ----------------------------------------------------------------------
ACR7_CAEEL      KEPYPTVKFYLHLRRRTFYYVFNVVLPTLLVSFMSLLAFCLPATDLSEKIGLQTTILLSVCFFLTILSEM
ACR2_CAEEL      ----------------------------------------------------------------------
ACHA3_BOVIN     ----------------------------------------------------------------------
ACHG_RAT        EAGHQKVVFYLLIQRKPLFYVINIIVPCVLISSVAILIYFLPAKAGGQKCTVATNVLLAQTVFLFLVAKK
ACHG_HUMAN      EAGHQKVVFYLLIQRKPLFYVINIIAPCVLISSVAILIHFLPAKAGGQKCTVAINVLLAQTVFLFLVAKK
ACHE_HUMAN      PGETDVI-YSLIIRRKPLFYVINIIVPCVLISGLVLLAYFLPAQAGGQKCTVSINVLLAQTVFLFLIAQK
ACHD_RAT        ----------------------------------------------------------------------
ACHA3_RAT       ----------------------------------------------------------------------
ACHA3_MOUSE     ----------------------------------------------------------------------
ACHA3_CHICK     ----------------------------------------------------------------------
ACHA3_CARAU     ----------------------------------------------------------------------
YO99_CAEEL      WDRAKV---KFTFARRYGFYLFQSYFPTSLTVISSWVGFFFDVRSVSARITLGVSSLLA-LTFQFNVLRH
ACH1_CAEEL      ----------------------------------------------------------------------
ACHG_MOUSE      EAGHQKVVFYLLIQRKPLFYVINIIAPCVLISSVAILIYFLPAKAGGQKCTVATNVLLAQTVFLFLVAKK
ACHA3_HUMAN     ----------------------------------------------------------------------
ACH1_SCHGR      AEPYPDIFFNITLRRK------------------------------------------------------
ACHE_MOUSE      ----------------------------------------------------------------------
LGC4_CAEEL      ----------------------------------------------------------------------
LGC4_CAEBR      ----------------------------------------------------------------------
ACHD_HUMAN      ----------------------------------------------------------------------
ACH8_CAEBR      ----------------------------------------------------------------------
LAR_DROME       PTKITV----------------------------------------------------------------
ACHD_CHICK      SSEHQDITFYLIIKRKP-----------------------------------------------------


                         .         *         .         .         .         .         +:350
query           MPDIDYLTFTDGXXXXXXXXXXXTVLESLAVYWLIKLNKDKLARKMDIFSRxxxxxxxxxxxxxxxxxxx
ELIC_ERWCH      LPRLPYTTVID-----------------------------------------------------------
GLUCL_DROME     LPPVSYTKAID-----------------------------------------------------------
GLRA4_MOUSE     LPKVSYVKAID-----------------------------------------------------------
GLRA3_RAT       LPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELL----------------------------
GLRA3_MOUSE     LPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELL----------------------------
GLRA3_HUMAN     LPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELL----------------------------
GLRA1_DANRE     LPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELL----------------------------
GLRA4_HUMAN     LPKVSYVKAID-----------------------------------------------------------
GLRA2_MOUSE     LPKVSYVKAID-----------------------------------------------------------
GLRA2_HUMAN     LPKVSYVKAID-----------------------------------------------------------
GLRA1_RAT       LPKVSYVKAID-----------------------------------------------------------
GLRA1_MOUSE     LPKVSYVKAID-----------------------------------------------------------
GLRA1_HUMAN     LPKVSYVKAID-----------------------------------------------------------
GLRA1_BOVIN     LPKVSYVKAID-----------------------------------------------------------
GBRG1_RAT       LPKVSYVTAMDLFVSVCFIFVFAALMEYGTLHYFTSNNKGKTTRDRKLKSK-------------------
GBRA3_HUMAN     ----------------------------------------------------------------------
GBRA3_BOVIN     ----------------------------------------------------------------------
GLRA2_RAT       LPKVSYVKAID-----------------------------------------------------------
GBRA3_RAT       ----------------------------------------------------------------------
GBRA3_MOUSE     ----------------------------------------------------------------------
GBRG1_MOUSE     LPKVSYVTAMDLFVSVCFIFVFAALMEYGTLHYFTSNNKGKTTR--------------------------
GBRG1_HUMAN     LPKVSYVTAMDLFVSVCFIFVFAALMEYGTLHYFTSNQKGKTATK-------------------------
GBRA5_BOVIN     LPKVAYATAMD-----------------------------------------------------------
GBRT_HUMAN      LPNISCIKAID-----------------------------------------------------------
GBRA5_RAT       LPKVAYATAMD-----------------------------------------------------------
GBRA5_MOUSE     LPKVAYATAMD-----------------------------------------------------------
GBRA5_HUMAN     LPKVAYATAMD-----------------------------------------------------------
GBRR3_HUMAN     MPQVSYLKAVDVYLWVSSLFVFLSVIEYAAVNYLTTVEERKQFKKTGKISR-------------------
GBRR3_RAT       MPQVSYVKAVDVYMWVSSLFVFLSVIEYAAVNYLTTVEEWK-----------------------------
GBRG2_RAT       ----------------------------------------------------------------------
GBRG2_PONAB     ----------------------------------------------------------------------
GBRG2_MOUSE     ----------------------------------------------------------------------
GBRG2_HUMAN     ----------------------------------------------------------------------
GBRAL_DROME     ----------------------------------------------------------------------
GBRG2_BOVIN     ----------------------------------------------------------------------
GBRA6_HUMAN     LPKVSYATAMDWFIAVCFAFVFSALIEFAAVNYFTNLQTQKAKRK-------------------------
GBRA6_CHICK     LPKVSYATAMDWFIAVCFAFVFSALIEFAAVNYFTNL---------------------------------
GLRB_RAT        LPKVSYVKALD-----------------------------------------------------------
GLRB_MOUSE      LPKVSYVKALD-----------------------------------------------------------
GLRB_HUMAN      LPKVSYVKALD-----------------------------------------------------------
GLRB_BOVIN      LPKVSYVKALD-----------------------------------------------------------
GBRG2_CHICK     ----------------------------------------------------------------------
GBRB4_CHICK     ----------------------------------------------------------------------
GBRR2_MOUSE     MPRVSYIRAVDIYLWXXXXXXXXXXXEYAAVNYLTTLQEQK-----------------------------
GBRP_BOVIN      ----------------------------------------------------------------------
GBRG3_HUMAN     LPRVSYVTAMD-----------------------------------------------------------
GBRB2_RAT       LPKIPYVKAID-----------------------------------------------------------
GBRB2_MOUSE     LPKIPYVKAID-----------------------------------------------------------
GBRB2_HUMAN     LPKIPYVKAID-----------------------------------------------------------
GBRB2_BOVIN     LPKIPYVKAID-----------------------------------------------------------
GBRB_LYMST      LPRISYVKAIDIYLVMCFVFVFAALLEYAAVYW-------------------------------------
GBRA6_RAT       ----------------------------------------------------------------------
GBRA6_MOUSE     ----------------------------------------------------------------------
GBRA2_BOVIN     LPKVAYATAMD-----------------------------------------------------------
GBRA1_RAT       ----------------------------------------------------------------------
GBRA1_PONAB     ----------------------------------------------------------------------
GBRA1_MOUSE     ----------------------------------------------------------------------
GBRA1_MACFA     ----------------------------------------------------------------------
GBRA1_HUMAN     ----------------------------------------------------------------------
GBRA1_BOVIN     ----------------------------------------------------------------------
GLUCB_CAEEL     LPPVSYVKVVD-----------------------------------------------------------
GBRG3_MOUSE     LPRVSYVTAMD-----------------------------------------------------------
GBRA2_RAT       LPKVAYATAMD-----------------------------------------------------------
GBRA2_PONAB     LPKVAYATAMD-----------------------------------------------------------
GBRA2_MOUSE     LPKVAYATAMD-----------------------------------------------------------
GBRA2_HUMAN     LPKVAYATAMD-----------------------------------------------------------
GBRA1_CHICK     ----------------------------------------------------------------------
GBRR2_RAT       MPRVSYIRAVDIYLWXXXXXXXXXXXEYAAVNYLTTVQEQKERKLRDKF---------------------
GBRR2_BOVIN     MPRVSYIKAVD-----------------------------------------------------------
GBRG3_RAT       LPRVSYVTAMD-----------------------------------------------------------
GBRE_HUMAN      FPRVSYITALDFYIAICFVFCFCALLEFAVLNFLI-----------------------------------
GBRB3_RAT       LPKIPYVKAID-----------------------------------------------------------
GBRB3_MOUSE     LPKIPYVKAID-----------------------------------------------------------
GBRB3_HUMAN     LPKIPYVKAID-----------------------------------------------------------
GBRB3_CHICK     LPKIPYVKAID-----------------------------------------------------------
GBRB1_RAT       LPKIPYVKAID-----------------------------------------------------------
GBRB1_MOUSE     LPKIPYVKAID-----------------------------------------------------------
GBRB1_HUMAN     LPKIPYVKAID-----------------------------------------------------------
GBRB1_BOVIN     LPKIPYVKAID-----------------------------------------------------------
GBRA4_HUMAN     LPKVSYATAMDWFIAVCFAFVFSALIEFAAVNYFTNIQMEKAKRK-------------------------
GBRA4_BOVIN     LPKVSYATAMDWFIAVCFAFVFSALIEFAAVNYFTNVQMEKAKRK-------------------------
GBRA4_RAT       ----------------------------------------------------------------------
GBRA4_MOUSE     ----------------------------------------------------------------------
GBRP_RAT        ----------------------------------------------------------------------
ACHG_CHICK      VPETSYLTF-------------------------------------------------------------
GBRT_MOUSE      LPHISCIKAID-----------------------------------------------------------
GBRR1_MOUSE     MPRVSYIKAVD-----------------------------------------------------------
GBRP_HUMAN      ----------------------------------------------------------------------
GBRR1_RAT       MPRVSYIKAVD-----------------------------------------------------------
GBRR1_HUMAN     MPRVSYIKAVD-----------------------------------------------------------
GBRP_MOUSE      ----------------------------------------------------------------------
GBRE_RAT        FPRVSYLTALDFYIAICFVLCFCTLLEFTVLNFLTYNNIERQA---------------------------
GLUCB_HAECO     LPPVSYVKVVD-----------------------------------------------------------
ACHA6_PANTR     ----------------------------------------------------------------------
ACHA6_HUMAN     ----------------------------------------------------------------------
GBRG4_CHICK     LPRVSYITAMD-----------------------------------------------------------
GBRD_RAT        ----------------------------------------------------------------------
GBRD_MOUSE      ----------------------------------------------------------------------
GBRD_HUMAN      ----------------------------------------------------------------------
GBRB_MUSDO      ----------------------------------------------------------------------
GBRB_DROSI      ----------------------------------------------------------------------
GBRB_CAEEL      LPRISYVKSIDIYLVMCFVFVFAALLEYAAVYW-------------------------------------
ACHG_XENLA      IPEVKYLTF-------------------------------------------------------------
ACHA6_MOUSE     ----------------------------------------------------------------------
ACHA6_CHICK     ----------------------------------------------------------------------
ACH3_DROME      ----------------------------------------------------------------------
GBRR2_HUMAN     MPRVSYVKAVD-----------------------------------------------------------
ACHB_XENLA      ----------------------------------------------------------------------
GLRB4_CAEEL     ----------------------------------------------------------------------
GBRB_DROME      ----------------------------------------------------------------------
ACHA6_RAT       ----------------------------------------------------------------------
ACHE_RAT        ----------------------------------------------------------------------
ACHG_BOVIN      VPE-------------------------------------------------------------------
ACHE_XENLA      VPE-------------------------------------------------------------------
GBRB3_DROME     LPRISYVKAIDIYLVMCFVFVFAALLEYAAVYW-------------------------------------
ACHG_TORCA      VPE-------------------------------------------------------------------
ACHD_BOVIN      ----------------------------------------------------------------------
ACH2_DROME      ----------------------------------------------------------------------
ACHD_MOUSE      ----------------------------------------------------------------------
ACHB_TORCA      ----------------------------------------------------------------------
ACH8_CAEEL      ----------------------------------------------------------------------
ACR7_CAEEL      TP--------------------------------------------------------------------
ACR2_CAEEL      ----------------------------------------------------------------------
ACHA3_BOVIN     ----------------------------------------------------------------------
ACHG_RAT        VPETSYLTF-------------------------------------------------------------
ACHG_HUMAN      VPE-------------------------------------------------------------------
ACHE_HUMAN      IPE-------------------------------------------------------------------
ACHD_RAT        ----------------------------------------------------------------------
ACHA3_RAT       ----------------------------------------------------------------------
ACHA3_MOUSE     ----------------------------------------------------------------------
ACHA3_CHICK     ----------------------------------------------------------------------
ACHA3_CARAU     ----------------------------------------------------------------------
YO99_CAEEL      LPRVSYIKCLDVWMIFSVIFIFCTLVELAIVCQLNRWERER-----------------------------
ACH1_CAEEL      ----------------------------------------------------------------------
ACHG_MOUSE      VPETSYLTF-------------------------------------------------------------
ACHA3_HUMAN     ----------------------------------------------------------------------
ACH1_SCHGR      ----------------------------------------------------------------------
ACHE_MOUSE      ----------------------------------------------------------------------
LGC4_CAEEL      ----------------------------------------------------------------------
LGC4_CAEBR      ----------------------------------------------------------------------
ACHD_HUMAN      ----------------------------------------------------------------------
ACH8_CAEBR      ----------------------------------------------------------------------
LAR_DROME       ----------------------------------------------------------------------
ACHD_CHICK      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           x
ELIC_ERWCH      -
GLUCL_DROME     -
GLRA4_MOUSE     -
GLRA3_RAT       -
GLRA3_MOUSE     -
GLRA3_HUMAN     -
GLRA1_DANRE     -
GLRA4_HUMAN     -
GLRA2_MOUSE     -
GLRA2_HUMAN     -
GLRA1_RAT       -
GLRA1_MOUSE     -
GLRA1_HUMAN     -
GLRA1_BOVIN     -
GBRG1_RAT       -
GBRA3_HUMAN     -
GBRA3_BOVIN     -
GLRA2_RAT       -
GBRA3_RAT       -
GBRA3_MOUSE     -
GBRG1_MOUSE     -
GBRG1_HUMAN     -
GBRA5_BOVIN     -
GBRT_HUMAN      -
GBRA5_RAT       -
GBRA5_MOUSE     -
GBRA5_HUMAN     -
GBRR3_HUMAN     -
GBRR3_RAT       -
GBRG2_RAT       -
GBRG2_PONAB     -
GBRG2_MOUSE     -
GBRG2_HUMAN     -
GBRAL_DROME     -
GBRG2_BOVIN     -
GBRA6_HUMAN     -
GBRA6_CHICK     -
GLRB_RAT        -
GLRB_MOUSE      -
GLRB_HUMAN      -
GLRB_BOVIN      -
GBRG2_CHICK     -
GBRB4_CHICK     -
GBRR2_MOUSE     -
GBRP_BOVIN      -
GBRG3_HUMAN     -
GBRB2_RAT       -
GBRB2_MOUSE     -
GBRB2_HUMAN     -
GBRB2_BOVIN     -
GBRB_LYMST      -
GBRA6_RAT       -
GBRA6_MOUSE     -
GBRA2_BOVIN     -
GBRA1_RAT       -
GBRA1_PONAB     -
GBRA1_MOUSE     -
GBRA1_MACFA     -
GBRA1_HUMAN     -
GBRA1_BOVIN     -
GLUCB_CAEEL     -
GBRG3_MOUSE     -
GBRA2_RAT       -
GBRA2_PONAB     -
GBRA2_MOUSE     -
GBRA2_HUMAN     -
GBRA1_CHICK     -
GBRR2_RAT       -
GBRR2_BOVIN     -
GBRG3_RAT       -
GBRE_HUMAN      -
GBRB3_RAT       -
GBRB3_MOUSE     -
GBRB3_HUMAN     -
GBRB3_CHICK     -
GBRB1_RAT       -
GBRB1_MOUSE     -
GBRB1_HUMAN     -
GBRB1_BOVIN     -
GBRA4_HUMAN     -
GBRA4_BOVIN     -
GBRA4_RAT       -
GBRA4_MOUSE     -
GBRP_RAT        -
ACHG_CHICK      -
GBRT_MOUSE      -
GBRR1_MOUSE     -
GBRP_HUMAN      -
GBRR1_RAT       -
GBRR1_HUMAN     -
GBRP_MOUSE      -
GBRE_RAT        -
GLUCB_HAECO     -
ACHA6_PANTR     -
ACHA6_HUMAN     -
GBRG4_CHICK     -
GBRD_RAT        -
GBRD_MOUSE      -
GBRD_HUMAN      -
GBRB_MUSDO      -
GBRB_DROSI      -
GBRB_CAEEL      -
ACHG_XENLA      -
ACHA6_MOUSE     -
ACHA6_CHICK     -
ACH3_DROME      -
GBRR2_HUMAN     -
ACHB_XENLA      -
GLRB4_CAEEL     -
GBRB_DROME      -
ACHA6_RAT       -
ACHE_RAT        -
ACHG_BOVIN      -
ACHE_XENLA      -
GBRB3_DROME     -
ACHG_TORCA      -
ACHD_BOVIN      -
ACH2_DROME      -
ACHD_MOUSE      -
ACHB_TORCA      -
ACH8_CAEEL      -
ACR7_CAEEL      -
ACR2_CAEEL      -
ACHA3_BOVIN     -
ACHG_RAT        -
ACHG_HUMAN      -
ACHE_HUMAN      -
ACHD_RAT        -
ACHA3_RAT       -
ACHA3_MOUSE     -
ACHA3_CHICK     -
ACHA3_CARAU     -
YO99_CAEEL      -
ACH1_CAEEL      -
ACHG_MOUSE      -
ACHA3_HUMAN     -
ACH1_SCHGR      -
ACHE_MOUSE      -
LGC4_CAEEL      -
LGC4_CAEBR      -
ACHD_HUMAN      -
ACH8_CAEBR      -
LAR_DROME       -
ACHD_CHICK      -