[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30570.1

[Show Plain Result]


## Summary of Sequence Search
    1::640
    1::640       0.0 100%  640 aa  GLGB_FRATM RecName: Full=1,4-alpha-glucan-branching enzyme;        
    1::640       0.0  99%  640 aa  GLGB_FRATW RecName: Full=1,4-alpha-glucan-branching enzyme;        
    1::640       0.0  99%  640 aa  GLGB_FRATT RecName: Full=1,4-alpha-glucan-branching enzyme;        
    1::640       0.0  99%  640 aa  GLGB_FRAT1 RecName: Full=1,4-alpha-glucan-branching enzyme;        
    1::640       0.0  99%  640 aa  GLGB_FRATO RecName: Full=1,4-alpha-glucan-branching enzyme;        
    1::640       0.0  99%  640 aa  GLGB_FRATF RecName: Full=1,4-alpha-glucan-branching enzyme;        
    1::640       0.0  99%  640 aa  GLGB_FRATH RecName: Full=1,4-alpha-glucan-branching enzyme;        
    1::640       0.0  98%  640 aa  GLGB_FRATN RecName: Full=1,4-alpha-glucan-branching enzyme;        
    1::640       0.0  86%  640 aa  GLGB_FRAP2 RecName: Full=1,4-alpha-glucan-branching enzyme;        
   41::658       0.0  64%  659 aa  GLGB_CLOP1 RecName: Full=1,4-alpha-glucan-branching enzyme;        
   20::657       0.0  62%  674 aa  GLGB1_CLOPE RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
   46::663       0.0  64%  664 aa  GLGB2_CLOPE RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
   23::658       0.0  63%  659 aa  GLGB2_CLOPS RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
   20::657       0.0  62%  674 aa  GLGB1_CLOPS RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
    4::627       0.0  51%  637 aa  GLGB_OCEIH RecName: Full=1,4-alpha-glucan-branching enzyme;        
    8::626       0.0  52%  630 aa  GLGB_HALOH RecName: Full=1,4-alpha-glucan-branching enzyme;        
  110::750       0.0  49%  766 aa  GLGB_THEEB RecName: Full=1,4-alpha-glucan-branching enzyme;        
  117::752       0.0  49%  770 aa  GLGB_SYNJA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  111::733       0.0  48%  745 aa  GLGB_SHESW RecName: Full=1,4-alpha-glucan-branching enzyme;        
  111::735       0.0  48%  745 aa  GLGB_SHEPC RecName: Full=1,4-alpha-glucan-branching enzyme;        
  113::755     e-180  48%  764 aa  GLGB_ANASP RecName: Full=1,4-alpha-glucan-branching enzyme;        
  111::732     e-180  48%  749 aa  GLGB_NITOC RecName: Full=1,4-alpha-glucan-branching enzyme;        
  111::731     e-180  47%  732 aa  GLGB_NITEC RecName: Full=1,4-alpha-glucan-branching enzyme;        
   14::620     e-180  48%  645 aa  GLGB_BACWK RecName: Full=1,4-alpha-glucan-branching enzyme;        
  113::755     e-180  48%  764 aa  GLGB_ANAVT RecName: Full=1,4-alpha-glucan-branching enzyme;        
   14::620     e-179  48%  645 aa  GLGB_BACC4 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  109::733     e-179  46%  746 aa  GLGB_SHEON RecName: Full=1,4-alpha-glucan-branching enzyme;        
  109::730     e-179  47%  734 aa  GLGB_NITEU RecName: Full=1,4-alpha-glucan-branching enzyme;        
   14::620     e-179  48%  645 aa  GLGB_BACCR RecName: Full=1,4-alpha-glucan-branching enzyme;        
  117::752     e-179  48%  763 aa  GLGB_SYNJB RecName: Full=1,4-alpha-glucan-branching enzyme;        
  109::733     e-179  46%  745 aa  GLGB_SHESR RecName: Full=1,4-alpha-glucan-branching enzyme;        
   14::620     e-179  48%  645 aa  GLGB_BACHK RecName: Full=1,4-alpha-glucan-branching enzyme;        
   14::620     e-179  48%  645 aa  GLGB_BACC3 RecName: Full=1,4-alpha-glucan-branching enzyme;        
   14::620     e-179  48%  645 aa  GLGB_BACC0 RecName: Full=1,4-alpha-glucan-branching enzyme;        
   14::620     e-178  48%  645 aa  GLGB_BACAN RecName: Full=1,4-alpha-glucan-branching enzyme;        
   14::620     e-178  48%  645 aa  GLGB_BACAC RecName: Full=1,4-alpha-glucan-branching enzyme;        
   14::620     e-178  48%  645 aa  GLGB_BACAA RecName: Full=1,4-alpha-glucan-branching enzyme;        
   14::620     e-178  48%  645 aa  GLGB_BACC2 RecName: Full=1,4-alpha-glucan-branching enzyme;        
    6::612     e-178  48%  637 aa  GLGB_BACCZ RecName: Full=1,4-alpha-glucan-branching enzyme;        
  109::733     e-178  46%  745 aa  GLGB_SHESM RecName: Full=1,4-alpha-glucan-branching enzyme;        
  102::729     e-178  49%  807 aa  GLGB_HAES1 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  108::752     e-178  47%  776 aa  GLGB_TRIEI RecName: Full=1,4-alpha-glucan-branching enzyme;        
    6::628     e-178  46%  631 aa  GLGB_MARAV RecName: Full=1,4-alpha-glucan-branching enzyme;        
  103::752     e-178  46%  755 aa  GLGB_PROMA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  102::729     e-178  48%  729 aa  GLGB_MANSM RecName: Full=1,4-alpha-glucan-branching enzyme;        
  117::759     e-178  47%  774 aa  GLGB_SYNP6 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  117::759     e-178  47%  774 aa  GLGB_SYNE7 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  102::729     e-178  49%  815 aa  GLGB_HAES2 RecName: Full=1,4-alpha-glucan-branching enzyme;        
   14::620     e-178  48%  645 aa  GLGB_BACCQ RecName: Full=1,4-alpha-glucan-branching enzyme;        
  109::733     e-178  47%  743 aa  GLGB_SHEB9 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  114::733     e-178  47%  746 aa  GLGB_NITMU RecName: Full=1,4-alpha-glucan-branching enzyme;        
  113::716     e-177  50%  770 aa  GLGB_SYNY3 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  104::687     e-177  49%  726 aa  GLGB_THICR RecName: Full=1,4-alpha-glucan-branching enzyme;        
  109::733     e-177  47%  743 aa  GLGB_SHEB8 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  115::725     e-177  48%  737 aa  GLGB_CELJU RecName: Full=1,4-alpha-glucan-branching enzyme;        
  109::733     e-177  47%  743 aa  GLGB_SHEB5 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  109::733     e-177  47%  743 aa  GLGB_SHEB2 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  106::749     e-177  46%  754 aa  GLGB_PROMP RecName: Full=1,4-alpha-glucan-branching enzyme;        
  116::737     e-176  47%  740 aa  GLGB_THIDA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  101::727     e-176  46%  733 aa  GLGB_GLOVI RecName: Full=1,4-alpha-glucan-branching enzyme;        
  108::734     e-176  46%  736 aa  GLGB_RHOBA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  110::731     e-176  45%  740 aa  GLGB_RHORT RecName: Full=1,4-alpha-glucan-branching enzyme;        
    5::627     e-176  46%  630 aa  GLGB_AQUAE RecName: Full=1,4-alpha-glucan-branching enzyme;        
  118::727     e-175  49%  777 aa  GLGB_ACTP2 RecName: Full=1,4-alpha-glucan-branching enzyme;        
    8::620     e-175  48%  645 aa  GLGB_BACCN RecName: Full=1,4-alpha-glucan-branching enzyme;        
    6::628     e-175  47%  632 aa  GLGB_DESHY RecName: Full=1,4-alpha-glucan-branching enzyme;        
   14::620     e-175  48%  645 aa  GLGB_BACC1 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  103::749     e-175  46%  765 aa  GLGB_SYNS3 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  118::727     e-175  49%  777 aa  GLGB_ACTPJ RecName: Full=1,4-alpha-glucan-branching enzyme;        
  102::726     e-175  47%  730 aa  GLGB_PASMU RecName: Full=1,4-alpha-glucan-branching enzyme;        
   14::620     e-175  48%  645 aa  GLGB_BACC7 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  118::727     e-175  49%  777 aa  GLGB_ACTP7 RecName: Full=1,4-alpha-glucan-branching enzyme;        
   99::718     e-175  46%  722 aa  GLGB_RUBXD RecName: Full=1,4-alpha-glucan-branching enzyme;        
   10::620     e-174  48%  639 aa  GLGB_BACST RecName: Full=1,4-alpha-glucan-branching enzyme;        
  102::727     e-174  47%  730 aa  GLGB_HAEIN RecName: Full=1,4-alpha-glucan-branching enzyme;        
  101::727     e-174  46%  729 aa  GLGB_SACD2 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  106::749     e-174  47%  754 aa  GLGB_PROM5 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  106::749     e-174  46%  765 aa  GLGB_SYNSC RecName: Full=1,4-alpha-glucan-branching enzyme;        
  102::727     e-174  47%  730 aa  GLGB_HAEIG RecName: Full=1,4-alpha-glucan-branching enzyme;        
  106::726     e-174  48%  727 aa  GLGB_PARUW RecName: Full=1,4-alpha-glucan-branching enzyme;        
  102::727     e-173  47%  730 aa  GLGB_HAEI8 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  106::749     e-173  45%  761 aa  GLGB_SYNPW RecName: Full=1,4-alpha-glucan-branching enzyme;        
  106::749     e-173  46%  759 aa  GLGB_PROM4 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  102::727     e-173  48%  829 aa  GLGB_ACTSZ RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::723     e-172  47%  740 aa  GLGB_METCA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  119::730     e-172  46%  732 aa  GLGB2_RHIEC RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
   10::620     e-172  47%  666 aa  GLGB_BACCL RecName: Full=1,4-alpha-glucan-branching enzyme;        
  101::727     e-172  45%  744 aa  GLGB_SHEFN RecName: Full=1,4-alpha-glucan-branching enzyme;        
  100::723     e-172  45%  725 aa  GLGB_METFK RecName: Full=1,4-alpha-glucan-branching enzyme;        
  106::749     e-171  45%  756 aa  GLGB_PROMM RecName: Full=1,4-alpha-glucan-branching enzyme;        
  114::732     e-171  46%  735 aa  GLGB1_RHIEC RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
  106::749     e-171  45%  756 aa  GLGB_PROM3 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  103::749     e-170  45%  764 aa  GLGB_SYNS9 RecName: Full=1,4-alpha-glucan-branching enzyme;        
    4::620     e-170  44%  625 aa  GLGB_RHOFD RecName: Full=1,4-alpha-glucan-branching enzyme;        
  114::732     e-170  45%  735 aa  GLGB1_RHIL3 RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
  109::734     e-170  45%  736 aa  GLGB_PSEPK RecName: Full=1,4-alpha-glucan-branching enzyme;        
  106::742     e-170  46%  755 aa  GLGB_PROMT RecName: Full=1,4-alpha-glucan-branching enzyme;        
    6::625     e-170  47%  636 aa  GLGB_AZOSE RecName: Full=1,4-alpha-glucan-branching enzyme;        
  115::734     e-170  45%  736 aa  GLGB_RHIME RecName: Full=1,4-alpha-glucan-branching enzyme;        
  104::711     e-169  46%  715 aa  GLGB_RHOP5 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  107::724     e-169  47%  732 aa  GLGB_CORDI RecName: Full=1,4-alpha-glucan-branching enzyme;        
  143::763     e-169  46%  764 aa  GLGB_STRAU RecName: Full=1,4-alpha-glucan-branching enzyme;        
  106::742     e-169  46%  755 aa  GLGB_PROM1 RecName: Full=1,4-alpha-glucan-branching enzyme;        
   98::700     e-169  48%  711 aa  GLGB_CORJK RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::721     e-169  44%  725 aa  GLGB_ERWCT RecName: Full=1,4-alpha-glucan-branching enzyme;        
   10::620     e-169  48%  627 aa  GLGB_BACSU RecName: Full=1,4-alpha-glucan-branching enzyme;        
  112::736     e-169  47%  741 aa  GLGB2_STRCO RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
  106::749     e-169  45%  772 aa  GLGB_SYNR3 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  111::734     e-169  43%  738 aa  GLGB_MESSB RecName: Full=1,4-alpha-glucan-branching enzyme;        
   66::689     e-169  44%  695 aa  GLGB_ALHEH RecName: Full=1,4-alpha-glucan-branching enzyme;        
  100::720     e-169  44%  724 aa  GLGB1_XANCP RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
  100::720     e-169  44%  724 aa  GLGB1_XANC8 RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
  216::836     e-168  44%  838 aa  GLGB1_STRAW RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
  115::732     e-168  47%  762 aa  GLGB_NEIDE RecName: Full=1,4-alpha-glucan-branching enzyme;        
  106::729     e-168  44%  734 aa  GLGB_MYXXD RecName: Full=1,4-alpha-glucan-branching enzyme;        
  100::720     e-168  44%  724 aa  GLGB1_XANAC RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
  114::732     e-168  45%  735 aa  GLGB_AGRT5 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  106::733     e-168  46%  775 aa  GLGB_SYNPX RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::723     e-168  44%  728 aa  GLGB_ECOL6 RecName: Full=1,4-alpha-glucan-branching enzyme;        
   15::630     e-168  46%  640 aa  GLGB_DESVV RecName: Full=1,4-alpha-glucan-branching enzyme;        
  106::731     e-167  47%  731 aa  GLGB_CORGL RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::723     e-167  44%  728 aa  GLGB_ECOUT RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::723     e-167  44%  728 aa  GLGB_ECOK1 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::723     e-167  44%  728 aa  GLGB_ECO57 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::723     e-167  44%  728 aa  GLGB_SHIF8 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  111::727     e-167  45%  731 aa  GLGB_ERWCH RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::723     e-167  44%  728 aa  GLGB_SHIFL RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::723     e-167  44%  728 aa  GLGB_ECOL5 RecName: Full=1,4-alpha-glucan-branching enzyme;        
   15::630     e-167  46%  640 aa  GLGB_DESVH RecName: Full=1,4-alpha-glucan-branching enzyme;        
  109::717     e-167  46%  721 aa  GLGB_BRAJA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  122::723     e-167  46%  728 aa  GLGB_RHOS1 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::723     e-166  44%  728 aa  GLGB_SHISS RecName: Full=1,4-alpha-glucan-branching enzyme;        
  106::749     e-166  45%  754 aa  GLGB_PROM9 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::723     e-166  44%  728 aa  GLGB_ECOLI RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::723     e-166  44%  728 aa  GLGB_ECOLC RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::723     e-166  44%  728 aa  GLGB_ECOHS RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::723     e-166  44%  728 aa  GLGB_ECO24 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  122::723     e-166  46%  728 aa  GLGB_RHOS4 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  106::723     e-166  46%  731 aa  GLGB_COREF RecName: Full=1,4-alpha-glucan-branching enzyme;        
  119::714     e-166  46%  736 aa  GLGB2_RHIL3 RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
  115::723     e-166  46%  727 aa  GLGB_YERPS RecName: Full=1,4-alpha-glucan-branching enzyme;        
  115::723     e-166  46%  727 aa  GLGB_YERPP RecName: Full=1,4-alpha-glucan-branching enzyme;        
  115::723     e-166  46%  727 aa  GLGB_YERPN RecName: Full=1,4-alpha-glucan-branching enzyme;        
  115::723     e-166  46%  727 aa  GLGB_YERPE RecName: Full=1,4-alpha-glucan-branching enzyme;        
  115::723     e-166  46%  727 aa  GLGB_YERPA RecName: Full=1,4-alpha-glucan-branching enzyme;        
   13::628     e-166  48%  644 aa  GLGB_PROAC RecName: Full=1,4-alpha-glucan-branching enzyme;        
    4::631     e-166  45%  649 aa  GLGB_LACS1 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::723     e-166  44%  728 aa  GLGB_SHIDS RecName: Full=1,4-alpha-glucan-branching enzyme;        
  115::723     e-166  46%  727 aa  GLGB_YERP3 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::723     e-166  44%  728 aa  GLGB_SHIBS RecName: Full=1,4-alpha-glucan-branching enzyme;        
   12::620     e-165  47%  627 aa  GLGB_BACLD RecName: Full=1,4-alpha-glucan-branching enzyme;        
  108::728     e-165  43%  732 aa  GLGB1_XANC5 RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
  102::713     e-165  46%  716 aa  GLGB_RHOP2 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  187::809     e-165  45%  812 aa  GLGB_FRASC RecName: Full=1,4-alpha-glucan-branching enzyme;        
  113::737     e-165  43%  741 aa  GLGB_PSE14 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  104::682     e-165  46%  716 aa  GLGB_RHOPB RecName: Full=1,4-alpha-glucan-branching enzyme;        
    6::611     e-165  48%  611 aa  GLGB_FUSNN RecName: Full=1,4-alpha-glucan-branching enzyme;        
  108::687     e-164  45%  732 aa  GLGB1_XANOR RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
  105::723     e-164  44%  728 aa  GLGB_SALAR RecName: Full=1,4-alpha-glucan-branching enzyme;        
  115::740     e-164  44%  743 aa  GLGB_PSEF5 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  109::729     e-164  46%  731 aa  GLGB_MYCPA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  113::737     e-164  44%  741 aa  GLGB_PSEU2 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  104::712     e-164  46%  716 aa  GLGB_RHOPS RecName: Full=1,4-alpha-glucan-branching enzyme;        
  106::734     e-164  45%  736 aa  GLGB_BURXL RecName: Full=1,4-alpha-glucan-branching enzyme;        
  107::686     e-164  45%  731 aa  GLGB2_XANOM RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
  115::705     e-164  47%  727 aa  GLGB_YERE8 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::723     e-164  43%  728 aa  GLGB_SALPB RecName: Full=1,4-alpha-glucan-branching enzyme;        
  107::723     e-164  43%  728 aa  GLGB_SALPA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  125::710     e-164  47%  749 aa  GLGB_THEFY RecName: Full=1,4-alpha-glucan-branching enzyme;        
  113::737     e-164  44%  741 aa  GLGB_PSESM RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::723     e-163  43%  728 aa  GLGB_SALTI RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::723     e-163  43%  728 aa  GLGB_SALCH RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::723     e-163  43%  728 aa  GLGB_SALTY RecName: Full=1,4-alpha-glucan-branching enzyme;        
  120::737     e-163  45%  759 aa  GLGB_MYCSS RecName: Full=1,4-alpha-glucan-branching enzyme;        
  120::737     e-163  45%  759 aa  GLGB_MYCSK RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::723     e-163  43%  728 aa  GLGB_CITK8 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  134::755     e-163  45%  755 aa  GLGB_VIBPA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  113::737     e-163  44%  740 aa  GLGB_MAGSA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  106::730     e-163  46%  732 aa  GLGB_RHOSR RecName: Full=1,4-alpha-glucan-branching enzyme;        
  120::737     e-163  45%  759 aa  GLGB_MYCSJ RecName: Full=1,4-alpha-glucan-branching enzyme;        
   18::636     e-163  44%  638 aa  GLGB_DESDG RecName: Full=1,4-alpha-glucan-branching enzyme;        
  103::711     e-163  44%  716 aa  GLGB_NITWN RecName: Full=1,4-alpha-glucan-branching enzyme;        
   98::708     e-163  46%  712 aa  GLGB_BRASO RecName: Full=1,4-alpha-glucan-branching enzyme;        
  108::734     e-162  46%  737 aa  GLGB_BIFLO RecName: Full=1,4-alpha-glucan-branching enzyme;        
  115::735     e-162  44%  737 aa  GLGB_RHILO RecName: Full=1,4-alpha-glucan-branching enzyme;        
  115::740     e-162  44%  743 aa  GLGB_PSEPF RecName: Full=1,4-alpha-glucan-branching enzyme;        
    8::621     e-162  46%  638 aa  GLGB_LACAC RecName: Full=1,4-alpha-glucan-branching enzyme;        
    7::619     e-162  44%  621 aa  GLGB_DECAR RecName: Full=1,4-alpha-glucan-branching enzyme;        
  115::723     e-162  43%  728 aa  GLGB_SERP5 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  107::731     e-162  42%  734 aa  GLGB_GRABC RecName: Full=1,4-alpha-glucan-branching enzyme;        
  109::728     e-162  45%  731 aa  GLGB_MYCBP RecName: Full=1,4-alpha-glucan-branching enzyme;        
  109::728     e-162  45%  731 aa  GLGB_MYCBO RecName: Full=1,4-alpha-glucan-branching enzyme;        
  109::723     e-162  43%  728 aa  GLGB_KLEP7 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  102::708     e-162  46%  712 aa  GLGB_BRASB RecName: Full=1,4-alpha-glucan-branching enzyme;        
  106::749     e-162  44%  754 aa  GLGB_PROM2 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  106::749     e-161  44%  754 aa  GLGB_PROM0 RecName: Full=1,4-alpha-glucan-branching enzyme;        
   10::620     e-161  45%  636 aa  GLGB_STRSV RecName: Full=1,4-alpha-glucan-branching enzyme;        
  100::712     e-161  44%  716 aa  GLGB_RHOPA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  106::749     e-161  44%  754 aa  GLGB_PROMS RecName: Full=1,4-alpha-glucan-branching enzyme;        
  101::714     e-161  44%  721 aa  GLGB_CHLFF RecName: Full=1,4-alpha-glucan-branching enzyme;        
  101::714     e-160  43%  720 aa  GLGB_CHLPN RecName: Full=1,4-alpha-glucan-branching enzyme;        
  107::714     e-160  47%  715 aa  GLGB_VIBF1 RecName: Full=1,4-alpha-glucan-branching enzyme;        
   10::613     e-160  46%  633 aa  GLGB_STRGC RecName: Full=1,4-alpha-glucan-branching enzyme;        
  109::728     e-160  45%  731 aa  GLGB_MYCTU RecName: Full=1,4-alpha-glucan-branching enzyme;        
  109::728     e-160  45%  731 aa  GLGB_MYCTA RecName: Full=1,4-alpha-glucan-branching enzyme;        
   10::620     e-160  46%  642 aa  GLGB_STRR6 RecName: Full=1,4-alpha-glucan-branching enzyme;        
   10::620     e-160  46%  642 aa  GLGB_STRP2 RecName: Full=1,4-alpha-glucan-branching enzyme;        
    6::590     e-160  47%  592 aa  GLGB2_STRAW RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
   10::620     e-160  46%  642 aa  GLGB_STRPN RecName: Full=1,4-alpha-glucan-branching enzyme;        
   10::622     e-160  45%  628 aa  GLGB_STRMU RecName: Full=1,4-alpha-glucan-branching enzyme;        
  114::731     e-160  44%  734 aa  GLGB_RHIRD RecName: Full=1,4-alpha-glucan-branching enzyme;        
  208::812     e-160  44%  834 aa  GLGB_BURTA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  115::730     e-159  44%  733 aa  GLGB_LEIXX RecName: Full=1,4-alpha-glucan-branching enzyme;        
    7::624     e-159  44%  639 aa  GLGB_BUTFI RecName: Full=1,4-alpha-glucan-branching enzyme;        
  109::729     e-159  44%  731 aa  GLGB_MYCUA RecName: Full=1,4-alpha-glucan-branching enzyme;        
   43::641     e-159  47%  652 aa  GLGB_DEIGD RecName: Full=1,4-alpha-glucan-branching enzyme;        
   99::711     e-159  43%  716 aa  GLGB_NITHX RecName: Full=1,4-alpha-glucan-branching enzyme;        
  101::717     e-159  44%  719 aa  GLGB_CHLCV RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::706     e-159  44%  728 aa  GLGB_ENT38 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  122::698     e-158  47%  744 aa  GLGB_NOCFA RecName: Full=1,4-alpha-glucan-branching enzyme;        
   47::659     e-158  44%  666 aa  GLGB_VIBCH RecName: Full=1,4-alpha-glucan-branching enzyme;        
    4::579     e-158  47%  622 aa  GLGB_STRA3 RecName: Full=1,4-alpha-glucan-branching enzyme;        
    4::579     e-158  47%  622 aa  GLGB_STRA5 RecName: Full=1,4-alpha-glucan-branching enzyme;        
    4::579     e-158  47%  622 aa  GLGB_STRA1 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  101::714     e-157  44%  721 aa  GLGB_CHLAB RecName: Full=1,4-alpha-glucan-branching enzyme;        
  180::764     e-157  46%  774 aa  GLGB1_STRCO RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
   97::724     e-157  44%  729 aa  GLGB_PSEA6 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  107::715     e-156  44%  715 aa  GLGB_VIBVU RecName: Full=1,4-alpha-glucan-branching enzyme;        
  124::744     e-156  42%  750 aa  GLGB_RALEJ RecName: Full=1,4-alpha-glucan-branching enzyme;        
  102::730     e-156  43%  733 aa  GLGB_BURCM RecName: Full=1,4-alpha-glucan-branching enzyme;        
  101::735     e-156  44%  738 aa  GLGB_CHLT2 RecName: Full=1,4-alpha-glucan-branching enzyme;        
   27::616     e-155  46%  705 aa  GLGB_DEIRA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  101::735     e-155  44%  738 aa  GLGB_CHLTB RecName: Full=1,4-alpha-glucan-branching enzyme;        
  101::735     e-155  44%  738 aa  GLGB_CHLTA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  107::714     e-155  44%  715 aa  GLGB_VIBVY RecName: Full=1,4-alpha-glucan-branching enzyme;        
  122::710     e-155  45%  716 aa  GLGB_PHOPR RecName: Full=1,4-alpha-glucan-branching enzyme;        
    6::596     e-155  47%  622 aa  GLGB_SALRD RecName: Full=1,4-alpha-glucan-branching enzyme;        
  110::714     e-155  42%  732 aa  GLGB_PSEA7 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  101::735     e-155  44%  738 aa  GLGB_CHLTR RecName: Full=1,4-alpha-glucan-branching enzyme;        
  110::714     e-154  42%  732 aa  GLGB_PSEAE RecName: Full=1,4-alpha-glucan-branching enzyme;        
    2::599     e-153  47%  621 aa  GLGB_RHOMR RecName: Full=1,4-alpha-glucan-branching enzyme;        
  127::729     e-153  41%  729 aa  GLGB2_XANCP RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
  127::729     e-153  41%  729 aa  GLGB2_XANC8 RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
  103::728     e-153  42%  731 aa  GLGB_ROSDO RecName: Full=1,4-alpha-glucan-branching enzyme;        
  100::718     e-153  42%  721 aa  GLGB_NOVAD RecName: Full=1,4-alpha-glucan-branching enzyme;        
  101::734     e-153  44%  737 aa  GLGB_CHLMU RecName: Full=1,4-alpha-glucan-branching enzyme;        
  122::713     e-153  44%  733 aa  GLGB_BURVG RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::716     e-152  42%  736 aa  GLGB_BURCH RecName: Full=1,4-alpha-glucan-branching enzyme;        
  105::716     e-152  42%  736 aa  GLGB_BURCA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  121::720     e-151  42%  720 aa  GLGB2_XANOR RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
  145::744     e-151  42%  744 aa  GLGB1_XANOM RecName: Full=1,4-alpha-glucan-branching enzyme 1;     
  156::757     e-151  43%  775 aa  GLGB_RALSO RecName: Full=1,4-alpha-glucan-branching enzyme;        
  121::719     e-151  41%  719 aa  GLGB2_XANAC RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
   13::625     e-150  42%  634 aa  GLGB_LACPL RecName: Full=1,4-alpha-glucan-branching enzyme;        
  124::727     e-149  43%  756 aa  GLGB_RALEH RecName: Full=1,4-alpha-glucan-branching enzyme;        
   82::683     e-149  44%  701 aa  GLGB_JANSC RecName: Full=1,4-alpha-glucan-branching enzyme;        
   99::695     e-145  42%  705 aa  GLGB_PICTO RecName: Full=1,4-alpha-glucan-branching enzyme;        
  136::736     e-145  42%  738 aa  GLGB_BURP6 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  145::743     e-145  40%  743 aa  GLGB2_XANC5 RecName: Full=1,4-alpha-glucan-branching enzyme 2;     
  136::736     e-145  42%  738 aa  GLGB_BURPS RecName: Full=1,4-alpha-glucan-branching enzyme;        
  136::736     e-145  42%  738 aa  GLGB_BURP1 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  136::736     e-145  42%  738 aa  GLGB_BURP0 RecName: Full=1,4-alpha-glucan-branching enzyme;        
  126::728     e-144  42%  731 aa  GLGB_BORBR RecName: Full=1,4-alpha-glucan-branching enzyme;        
  126::728     e-144  42%  731 aa  GLGB_BORPA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  126::728     e-142  41%  731 aa  GLGB_BORPE RecName: Full=1,4-alpha-glucan-branching enzyme;        
  113::715     e-141  41%  735 aa  GLGB_BURS3 RecName: Full=1,4-alpha-glucan-branching enzyme;        
   50::677     2e-53  30%  678 aa  GLGB_DICDI RecName: Full=1,4-alpha-glucan-branching enzyme;        
   66::682     6e-53  30%  682 aa  GLGB_CRYNE RecName: Full=1,4-alpha-glucan-branching enzyme;        
   73::696     1e-51  32%  702 aa  GLGB_HUMAN RecName: Full=1,4-alpha-glucan-branching enzyme;        
   26::681     4e-51  31%  691 aa  GLGB_YARLI RecName: Full=1,4-alpha-glucan-branching enzyme;        
   52::693     4e-51  31%  699 aa  GLGB_FELCA RecName: Full=1,4-alpha-glucan-branching enzyme;        
   73::696     1e-49  30%  702 aa  GLGB_MOUSE RecName: Full=1,4-alpha-glucan-branching enzyme;        
   70::693     2e-49  29%  699 aa  GLGB_HORSE RecName: Full=1,4-alpha-glucan-branching enzyme;        
   71::680     5e-49  30%  683 aa  GLGB_GLOIN RecName: Full=1,4-alpha-glucan-branching enzyme;        
   72::685     5e-48  31%  689 aa  GLGB_ASPOR RecName: Full=1,4-alpha-glucan-branching enzyme;        
   67::673     9e-48  29%  686 aa  GLGB_EMENI RecName: Full=1,4-alpha-glucan-branching enzyme;        
   60::702     2e-47  28%  706 aa  GLGB_CANGA RecName: Full=1,4-alpha-glucan-branching enzyme;        
   58::702     7e-46  29%  704 aa  GLGB_YEAST RecName: Full=1,4-alpha-glucan-branching enzyme;        
   62::706     1e-44  29%  711 aa  GLGB_DEBHA RecName: Full=1,4-alpha-glucan-branching enzyme;        
   57::699     3e-44  30%  703 aa  GLGB_ASHGO RecName: Full=1,4-alpha-glucan-branching enzyme;        
   63::711     2e-43  29%  719 aa  GLGB_KLULA RecName: Full=1,4-alpha-glucan-branching enzyme;        
  173::794     2e-40  26%  799 aa  GLGB_MAIZE RecName: Full=1,4-alpha-glucan-branching enzyme 2,
  152::750     1e-39  29%  861 aa  GLGB_SOLTU RecName: Full=1,4-alpha-glucan-branching enzyme;        
  134::707     2e-34  29%  820 aa  GLGB_ORYSJ RecName: Full=1,4-alpha-glucan-branching enzyme,
   18::449     5e-19  25%  598 aa  TREZ_ARTSQ RecName: Full=Malto-oligosyltrehalose trehalohydrolase; 
  117::419     4e-17  26%  718 aa  PULA_BACSU RecName: Full=Pullulanase;         EC=3.2.1.41;AltName:
   10::260     1e-15  26%  589 aa  TREZ_BREHE RecName: Full=Malto-oligosyltrehalose trehalohydrolase; 
  100::308     5e-15  30%  580 aa  TREZ_MYCTU RecName: Full=Malto-oligosyltrehalose trehalohydrolase; 
   84::429     2e-14  32%  783 aa  ISOA1_ARATH RecName: Full=Isoamylase 1, chloroplastic;       
   16::447     4e-14  24%  596 aa  TREZ_RHIS1 RecName: Full=Malto-oligosyltrehalose trehalohydrolase; 
  219::540     7e-14  30%  843 aa  PULA_THEMA RecName: Full=Pullulanase;         EC=3.2.1.41;AltName:
   13::333     9e-14  28%  659 aa  GLGX_HAEIN RecName: Full=Glycogen operon protein glgX homolog;     
    4::246     5e-12  30%  575 aa  TREZ_ARTRM RecName: Full=Malto-oligosyltrehalose trehalohydrolase; 
  184::333     4e-10  32%  588 aa  NEPU_BACST RecName: Full=Neopullulanase;         EC=3.2.1.135;
   35::367     8e-10  26%  721 aa  GLGX_MYCTU RecName: Full=Glycogen operon protein glgX homolog;     
   35::367     8e-10  26%  721 aa  GLGX_MYCBO RecName: Full=Glycogen operon protein glgX homolog;     
  180::490     3e-09  27%  574 aa  CDAS_THEP3 RecName: Full=Cyclomaltodextrinase;         Short=CDase;
  794::946     4e-09  32% 1196 aa  AMYB_PAEPO RecName: Full=Beta/alpha-amylase;Includes:  RecName:
   12::338     5e-09  29%  662 aa  GLGX_YERE8 RecName: Full=Glycogen debranching enzyme;       
  100::431     8e-09  27%  764 aa  ISOA3_ARATH RecName: Full=Isoamylase 3, chloroplastic;       
   11::204     2e-08  32%  554 aa  O16G3_BACSU RecName: Full=Probable oligo-1,6-glucosidase 3;        
    7::116     2e-08  29%  579 aa  MALT_SCHPO RecName: Full=Alpha-glucosidase;       
   19::339     2e-08  29%  657 aa  GLGX_ENT38 RecName: Full=Glycogen debranching enzyme;       
   27::120     3e-08  29%  577 aa  MAL2_DROME RecName: Full=Probable maltase H;       
   84::256     3e-08  30%  704 aa  CDGT_BACOH RecName: Full=Cyclomaltodextrin glucanotransferase;     
    7::353     3e-08  28%  586 aa  AMYM_BACAD RecName: Full=Maltogenic alpha-amylase;       
   34::258     7e-08  29%  655 aa  CDGT_KLEOX RecName: Full=Cyclomaltodextrin glucanotransferase;     
   26::124     9e-08  29%  579 aa  MALT_AEDAE RecName: Full=Probable maltase;       
   51::266     9e-08  28%  484 aa  AMYA_ASPNG RecName: Full=Acid alpha-amylase;       
   19::338     2e-07  28%  662 aa  GLGX_YERPB RecName: Full=Glycogen debranching enzyme;       
  186::332     2e-07  31%  588 aa  BBMA2_BACSU RecName: Full=Intracellular maltogenic amylase;        
  186::332     2e-07  31%  588 aa  BBMA1_BACSU RecName: Full=Intracellular maltogenic amylase;        
  239::404     2e-07  32%  776 aa  ISOA_PSEUM RecName: Full=Isoamylase;         EC=3.2.1.68;Flags:
  239::404     2e-07  32%  776 aa  ISOA_PSEAY RecName: Full=Isoamylase;         EC=3.2.1.68;Flags:
   19::338     2e-07  27%  662 aa  GLGX_YERPY RecName: Full=Glycogen debranching enzyme;       
   19::338     2e-07  27%  662 aa  GLGX_YERPS RecName: Full=Glycogen debranching enzyme;       
   19::338     2e-07  27%  662 aa  GLGX_YERPP RecName: Full=Glycogen debranching enzyme;       
   19::338     2e-07  27%  662 aa  GLGX_YERPN RecName: Full=Glycogen debranching enzyme;       
   19::338     2e-07  27%  662 aa  GLGX_YERPG RecName: Full=Glycogen debranching enzyme;       
   19::338     2e-07  27%  662 aa  GLGX_YERPE RecName: Full=Glycogen debranching enzyme;       
   19::338     2e-07  27%  662 aa  GLGX_YERPA RecName: Full=Glycogen debranching enzyme;       
   12::339     2e-07  28%  657 aa  GLGX_CITK8 RecName: Full=Glycogen debranching enzyme;       
   19::338     3e-07  27%  662 aa  GLGX_YERP3 RecName: Full=Glycogen debranching enzyme;       
  136::340     4e-07  28%  658 aa  GLGX_ERWT9 RecName: Full=Glycogen debranching enzyme;       
  174::309     6e-07  33%  562 aa  AMY2_DICT6 RecName: Full=Alpha-amylase 2;       
   19::336     8e-07  25%  657 aa  GLGX_SHIBS RecName: Full=Glycogen debranching enzyme;       
   19::336     8e-07  25%  657 aa  GLGX_SHIB3 RecName: Full=Glycogen debranching enzyme;       
   19::336     1e-06  25%  657 aa  GLGX_SHIFL RecName: Full=Glycogen debranching enzyme;       
   19::336     1e-06  25%  657 aa  GLGX_SHIF8 RecName: Full=Glycogen debranching enzyme;       
   19::336     1e-06  26%  657 aa  GLGX_SHIDS RecName: Full=Glycogen debranching enzyme;       
   19::336     1e-06  26%  657 aa  GLGX_ECOL6 RecName: Full=Glycogen debranching enzyme;       
   19::336     1e-06  25%  657 aa  GLGX_ECO81 RecName: Full=Glycogen debranching enzyme;       
   83::243     1e-06  29%  507 aa  AMY2_DEBOC RecName: Full=Alpha-amylase 2;       
   12::104     1e-06  33%  570 aa  MALT_CANAL RecName: Full=Alpha-glucosidase;       
   19::336     1e-06  25%  657 aa  GLGX_SHISS RecName: Full=Glycogen debranching enzyme;       
   19::336     1e-06  26%  657 aa  GLGX_ECOUT RecName: Full=Glycogen debranching enzyme;       
   19::336     1e-06  26%  657 aa  GLGX_ECOK1 RecName: Full=Glycogen debranching enzyme;       
   19::336     1e-06  26%  657 aa  GLGX_ECO45 RecName: Full=Glycogen debranching enzyme;       
   84::256     1e-06  28%  703 aa  CDGT_BACS2 RecName: Full=Cyclomaltodextrin glucanotransferase;     
   31::245     1e-06  32%  499 aa  AMY3_DICT6 RecName: Full=Alpha-amylase 3;       
   12::339     2e-06  30%  658 aa  GLGX_SALPK RecName: Full=Glycogen debranching enzyme;       
   12::339     2e-06  30%  658 aa  GLGX_SALPA RecName: Full=Glycogen debranching enzyme;       
  187::339     2e-06  30%  658 aa  GLGX_ESCF3 RecName: Full=Glycogen debranching enzyme;       
   19::336     2e-06  25%  657 aa  GLGX_ECOSM RecName: Full=Glycogen debranching enzyme;       
   19::336     2e-06  25%  657 aa  GLGX_ECOSE RecName: Full=Glycogen debranching enzyme;       
   19::336     2e-06  25%  657 aa  GLGX_ECOLI RecName: Full=Glycogen debranching enzyme;       
   19::336     2e-06  25%  657 aa  GLGX_ECOL5 RecName: Full=Glycogen debranching enzyme;       
   19::336     2e-06  25%  657 aa  GLGX_ECODH RecName: Full=Glycogen debranching enzyme;       
   19::336     2e-06  25%  657 aa  GLGX_ECOBW RecName: Full=Glycogen debranching enzyme;       
   19::336     2e-06  25%  657 aa  GLGX_ECO8A RecName: Full=Glycogen debranching enzyme;       
   19::336     2e-06  25%  657 aa  GLGX_ECO7I RecName: Full=Glycogen debranching enzyme;       
   19::336     2e-06  25%  657 aa  GLGX_ECO5E RecName: Full=Glycogen debranching enzyme;       
   19::336     2e-06  25%  657 aa  GLGX_ECO57 RecName: Full=Glycogen debranching enzyme;       
   19::336     2e-06  25%  657 aa  GLGX_ECO55 RecName: Full=Glycogen debranching enzyme;       
   19::336     2e-06  25%  657 aa  GLGX_ECO27 RecName: Full=Glycogen debranching enzyme;       
   19::336     2e-06  25%  657 aa  GLGX_ECO24 RecName: Full=Glycogen debranching enzyme;       
   12::339     2e-06  30%  658 aa  GLGX_SALPB RecName: Full=Glycogen debranching enzyme;       
   20::338     2e-06  24%  660 aa  GLGX_ENTS8 RecName: Full=Glycogen debranching enzyme;       
   19::336     2e-06  25%  657 aa  GLGX_ECOLU RecName: Full=Glycogen debranching enzyme;       
   19::336     2e-06  25%  657 aa  GLGX_ECOLC RecName: Full=Glycogen debranching enzyme;       
   19::336     2e-06  25%  657 aa  GLGX_ECOHS RecName: Full=Glycogen debranching enzyme;       
  111::261     2e-06  30%  712 aa  CDGT_BACS3 RecName: Full=Cyclomaltodextrin glucanotransferase;     
   11::267     3e-06  28%  963 aa  TRES_THETH RecName: Full=Trehalose synthase;       
  181::525     4e-06  24%  585 aa  NEPU2_THEVU RecName: Full=Neopullulanase 2;       
   73::231     4e-06  31%  513 aa  MDE5_SCHPO RecName: Full=Alpha-amylase mde5;       
   50::146     4e-06  29%  524 aa  MAL2_DROVI RecName: Full=Maltase 2;         EC=3.2.1.20;Flags:
   32::129     4e-06  29%  567 aa  MAL1_APIME RecName: Full=Alpha-glucosidase;       
   20::338     4e-06  26%  661 aa  GLGX_SERP5 RecName: Full=Glycogen debranching enzyme;       
   12::339     4e-06  31%  658 aa  GLGX_SALSV RecName: Full=Glycogen debranching enzyme;       
   12::339     4e-06  31%  658 aa  GLGX_SALA4 RecName: Full=Glycogen debranching enzyme;       
  133::339     4e-06  28%  658 aa  GLGX_KLEP7 RecName: Full=Glycogen debranching enzyme;       
  126::261     4e-06  32%  713 aa  CDGT_BACS0 RecName: Full=Cyclomaltodextrin glucanotransferase;     
   23::139     5e-06  27%  586 aa  MAL1_DROVI RecName: Full=Maltase 1;         EC=3.2.1.20;Flags:
   12::339     5e-06  30%  658 aa  GLGX_SALTY RecName: Full=Glycogen debranching enzyme;       
   12::339     5e-06  30%  658 aa  GLGX_SALPC RecName: Full=Glycogen debranching enzyme;       
   12::339     5e-06  30%  658 aa  GLGX_SALNS RecName: Full=Glycogen debranching enzyme;       
   12::339     5e-06  30%  658 aa  GLGX_SALHS RecName: Full=Glycogen debranching enzyme;       
   12::339     5e-06  30%  658 aa  GLGX_SALG2 RecName: Full=Glycogen debranching enzyme;       
   12::339     5e-06  30%  658 aa  GLGX_SALEP RecName: Full=Glycogen debranching enzyme;       
   12::339     5e-06  30%  658 aa  GLGX_SALCH RecName: Full=Glycogen debranching enzyme;       
   74::246     5e-06  28%  692 aa  CDGT_BREBE RecName: Full=Cyclomaltodextrin glucanotransferase;     
  182::332     5e-06  29%  591 aa  CDAS_BACSH RecName: Full=Cyclomaltodextrinase;         Short=CDase;
   78::149     5e-06  36%  494 aa  AMY1_SACFI RecName: Full=Alpha-amylase;         EC=3.2.1.1;Flags:
   12::339     7e-06  30%  658 aa  GLGX_SALDC RecName: Full=Glycogen debranching enzyme;       
   72::232     7e-06  30%  499 aa  AMY_ASPSH RecName: Full=Alpha-amylase;         EC=3.2.1.1;AltName:
   72::232     7e-06  30%  499 aa  AMYB_ASPAW RecName: Full=Alpha-amylase B;       
   72::232     7e-06  30%  498 aa  AMYA_ASPAW RecName: Full=Alpha-amylase A;       
   72::232     7e-06  30%  499 aa  AMYA1_ASPOR RecName: Full=Alpha-amylase A type-1/2;       
   12::339     9e-06  30%  654 aa  GLGX_SALTI RecName: Full=Glycogen debranching enzyme;       
  126::261     9e-06  28%  713 aa  CDGT2_PAEMA RecName: Full=Cyclomaltodextrin glucanotransferase;    
   60::380     9e-06  28%  719 aa  AMYM_BACST RecName: Full=Maltogenic alpha-amylase;       
   36::188     9e-06  31%  413 aa  AMY3_WHEAT RecName: Full=Alpha-amylase AMY3;       
  198::358     1e-05  31%  624 aa  AMY1_LIPKO RecName: Full=Alpha-amylase 1;       
    2::103     1e-05  25%  561 aa  O16G2_BACSU RecName: Full=Probable oligo-1,6-glucosidase 2;        
   72::232     1e-05  29%  499 aa  AMYA3_ASPOR RecName: Full=Alpha-amylase A type-3;       
  399::536     2e-05  28%  882 aa  ISOA2_ARATH RecName: Full=Isoamylase 2, chloroplastic;       
  187::339     2e-05  29%  658 aa  GLGX_KLEP3 RecName: Full=Glycogen debranching enzyme;       
  126::276     3e-05  29%  714 aa  CDGT1_PAEMA RecName: Full=Cyclomaltodextrin glucanotransferase;    
  123::195     3e-05  32%  636 aa  AMYS_NEIPO RecName: Full=Amylosucrase;         EC=2.4.1.4;
   55::134     3e-05  41%  445 aa  AMY2A_ORYSJ RecName: Full=Alpha-amylase isozyme 2A;       
   55::134     3e-05  41%  446 aa  AMY2A_ORYSI RecName: Full=Alpha-amylase isozyme 2A;       
   20::125     4e-05  24%  567 aa  MAL1_DROME RecName: Full=Probable maltase D;       
   31::89      6e-05  34%  442 aa  MGTA_THENE RecName: Full=4-alpha-glucanotransferase;       
  129::195     6e-05  32%  636 aa  AMYS_NEIME RecName: Full=Amylosucrase;         EC=2.4.1.4;
   36::146     6e-05  32%  438 aa  AMY1_HORVU RecName: Full=Alpha-amylase type A isozyme;       
   11::108     7e-05  23%  562 aa  O16G_BACTR RecName: Full=Oligo-1,6-glucosidase;       
   10::107     7e-05  27%  509 aa  O16G_BACF5 RecName: Full=Oligo-1,6-glucosidase;       
   30::121     7e-05  29%  574 aa  MAL3_DROME RecName: Full=Probable maltase L;       
   15::112     1e-04  27%  581 aa  MALX1_YEAST RecName: Full=Probable alpha-glucosidase YJL216C;      
   73::161     1e-04  32%  774 aa  AMY4_SCHPO RecName: Full=Alpha-amylase 4;       
   62::221     1e-04  28%  478 aa  YQ29_SCHPO RecName: Full=Uncharacterized glycosyl hydrolase
   14::106     1e-04  26%  561 aa  TREC_BACSU RecName: Full=Trehalose-6-phosphate hydrolase;       
  455::533     1e-04  33% 1481 aa  APU_THEP3 RecName: Full=Amylopullulanase;AltName:
  194::253     2e-04  38%  853 aa  TGS1_HUMAN RecName: Full=Trimethylguanosine synthase;       
   60::140     2e-04  29%  569 aa  AMY_STRVL RecName: Full=Alpha-amylase;         EC=3.2.1.1;AltName:
   10::264     2e-04  27%  555 aa  O16G_BACCO RecName: Full=Oligo-1,6-glucosidase;       
  126::261     2e-04  32%  713 aa  CDGT2_BACCI RecName: Full=Cyclomaltodextrin glucanotransferase;    
   86::261     3e-04  29%  711 aa  CDGT_BACST RecName: Full=Cyclomaltodextrin glucanotransferase;     
   87::247     3e-04  27%  512 aa  AMY1_DEBOC RecName: Full=Alpha-amylase 1;       
   10::107     5e-04  25%  561 aa  O16G1_BACSU RecName: Full=Oligo-1,6-glucosidase 1;       
  127::262     5e-04  29%  710 aa  CDGT_THETU RecName: Full=Cyclomaltodextrin glucanotransferase;     
   11::108     6e-04  25%  558 aa  O16G_BACCE RecName: Full=Oligo-1,6-glucosidase;       
   31::89      6e-04  32%  441 aa  MGTA_THEMA RecName: Full=4-alpha-glucanotransferase;       
   20::117     8e-04  27%  589 aa  MALX4_YEAST RecName: Full=Probable alpha-glucosidase YOL157C;      
   20::117     8e-04  27%  589 aa  MALX2_YEAST RecName: Full=Probable alpha-glucosidase
  126::261     8e-04  30%  713 aa  CDGT_BACS8 RecName: Full=Cyclomaltodextrin glucanotransferase;     
  126::261     8e-04  28%  713 aa  CDGT_BAC11 RecName: Full=Cyclomaltodextrin glucanotransferase;     
    1::640

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKNKNSEQNTHSTIGEQDIHYFHEGKHIYAYEFMGAHKACEEGIEGIRFTTWAPNAKSICVIGDFNYWQV
GLGB_FRATM      MKNKNSEQNTHSTIGEQDIHYFHEGKHIYAYEFMGAHKACEEGIEGIRFTTWAPNAKSICVIGDFNYWQV
GLGB_FRATW      MKNKNSEQNTHSTIGEQDIHYFHEGKHIYAYEFMGAHKACEEGIEGIRFTTWAPNAKSICVIGDFNYWQV
GLGB_FRATT      MKNKNSEQNTHSTIGEQDIHYFHEGKHIYAYEFMGAHKACEEGIEGIRFTTWAPNAKSICVIGDFNYWQV
GLGB_FRAT1      MKNKNSEQNTHSTIGEQDIHYFHEGKHIYAYEFMGAHKACEEGIEGIRFTTWAPNAKSICVIGDFNYWQV
GLGB_FRATO      MKNKNSEQNTHYTIGEQDIHYFHEGKHIYAYEFMGAHKACEEGIEGIRFTTWAPNAKSICVIGDFNYWQV
GLGB_FRATF      MKNKNSEQNTHYTIGEQDIHYFHEGKHIYAYEFMGAHKACEEGIEGIRFTTWAPNAKSICVIGDFNYWQV
GLGB_FRATH      MKNKNSEQNTHYTIGEQDIHYFHEGKHIYAYEFMGAHKACEEGIEGIRFTTWAPNAKSICVIGDFNYWQV
GLGB_FRATN      MKNKNSKQNTHSTIGEQDIHYFHEGKHIYAYEFMGAHKACEGGIEGIRFTTWAPNAKSICVIGDFNYWQV
GLGB_FRAP2      MKNVNSKQNNHSTIGEQDIHFFHEGKHIYAYEFMGAHKASEDGIDGIRFTTWAPNAKSICVIGDFNHWQV
GLGB_CLOP1      ---------------------FLEGKEHSAYKFMGAHFVTENRKRGVRFTTWAPRSSKIYVIGDFNNWEL
GLGB1_CLOPE     -KEKYKTQLKNKIFNEDDLYLFHEGRNYNAYNFMGAHFTSENRKRGVRFTLWAPRAKNIFLVGDFSNWET
GLGB2_CLOPE     ---------------------FLEGKEHSAYKFMGAHFITENRKRGVRFTTWAPRASKIYVIGDFNNWEL
GLGB2_CLOPS     -KGKSKKMSKDESLLSFDL--FLEGKEHSAYKFMGAHFITENRKRGVRFTTWSPRASKIYIIGDFNNWEL
GLGB1_CLOPS     -KEKYKAQLENKIFNEDELYLFHEGRNYNAYNFMGAHFTSENRKRGVRFTLWAPRAKNIFLVGDFSNWET
GLGB_OCEIH      -------------ISAEDIYLFHQGTNFESHQFLGCHEINWKGKRGYRFAVWAPNALKVCVVGDFNNWE-
GLGB_HALOH      ---------------DYDRYLFHQGSHYKSYEFLGAHPCEENGKTGVRFSVWAPNAAEVRVIGSFNNWD-
GLGB_THEEB      -----------------DIHLFAEGNHHRIYEKLGAHLLTVDGVEGVYFAVWAPNARNVSVIGDFNHW--
GLGB_SYNJA      -------------IGELDRYLFNEGNHHRIYEKLGAHPISVDGVQGVHFAVWAPNARNVSVIGDFNHWDG
GLGB_SHESW      -------------LNADDLYLFGEGSAERAYEFLGANWRDVEGIEGVHFCVWAPNAKRVSVVGDFNHWD-
GLGB_SHEPC      -------------LNADDLYLFGEGSAERAYKFLGANWRDVEGIEGVHFCVWAPNAKRVSVVGDFNHWD-
GLGB_ANASP      -----------------DLHLFAEGNHHRIYEKLGAHFTEVGGVKGVYFAVWAPNARNVSVLGDFNLWDG
GLGB_NITOC      -------------LSDYDLHLFGEGKHWHVYRILGSHPVIVDGTSGVLFATWAPEAERVSIVGDFNRWDG
GLGB_NITEC      -------------ISGHDLYLFNEGRLLQAYHMLGTHQVKNQGVTGTRFAVWAPNAERVSVVGDFNHWDG
GLGB_BACWK      ---------------------FHTEKYYDSYNIFGAHIVTEDGMRGVRCTVWAPHAKAMSVVGDFNEWDY
GLGB_ANAVT      -----------------DLHLFAEGNHHRIYEKLGAHFTEVDGVTGVYFAVWAPNARNVSVLGDFNLWDG
GLGB_BACC4      ---------------------FHTEKYYESYNIFGAHVVTEDEIQGVRFTVWAPHAKAMSVVGDFNEWDY
GLGB_SHEON      -----------SLLNREDLYLFGEGSSEQAYRFLGANWRQVDNVEGVHFCVWAPNAKRVSVVGDFNHWD-
GLGB_NITEU      -------------ISGHDLYLFNEGRLLQAYHMLGAHRVRNHGVTGTRFAVWAPNAERVSVVGDFNRW--
GLGB_BACCR      ---------------------FHTEKYYESYNIFGAHVVTEDEIQGVRFTVWAPHAKAMSVVGDFNEWDY
GLGB_SYNJB      -------------IGELDRYLFNEGNHHRIYDKLGAHLITVDGVKGVHFAVWAPNARNVSVIGDFNHWDG
GLGB_SHESR      -----------SLLDSQDLYLFGEGGSEQAYRFLGANWRQVDSVEGVHFCVWAPNAKRVSVVGDFNHWD-
GLGB_BACHK      ---------------------FHTEKYYESYNIFGAHIVTEDEMRGVRFTVWAPHAKAMSVVGDFNEWDY
GLGB_BACC3      ---------------------FHTEKYYESYNIFGAHIVTEDEMRGVRFTVWAPHAKAMSVVGDFNEWDY
GLGB_BACC0      ---------------------FHTEKYYESYNIFGAHIVTEDEMRGVRFTVWAPHAKAMSVVGDFNEWDY
GLGB_BACAN      ---------------------FHTEKYYESYNIFGAHIVTEDEMRGVRFTVWAPHAKAMSVVGDFNEWDY
GLGB_BACAC      ---------------------FHTEKYYESYNIFGAHIVTEDEMRGVRFTVWAPHAKAMSVVGDFNEWDY
GLGB_BACAA      ---------------------FHTEKYYESYNIFGAHIVTEDEMRGVRFTVWAPHAKAMSVVGDFNEWDY
GLGB_BACC2      ---------------------FHTEKYYESYNIFGAHVVTEDEIQGVRFTVWAPHAKAMSVVGDFNEWDY
GLGB_BACCZ      ---------------------FHTEKYYESYNIFGAHIVTEDEMRGVRFTVWAPHAKAMSVVGDFNEWDY
GLGB_SHESM      -----------SLLDSQDLYLFGEGSSEQAYRFLGANWRQVDSVEGVHFCVWAPNAKRVSVVGDFNHWD-
GLGB_HAES1      ----------HPMINELDNWLLAEGSHKRPYEILGAHFTECDNVAGVNFRLWAPNAKRVSVVGDFNYWDG
GLGB_TRIEI      ---------------EFDLQLFGEGNHHRIYEKLGAHITEVDGIKGVYFAVWAPNARNVSILGNFNYW--
GLGB_MARAV      -------------LSEFDLHLFAEGRHWHIYNVLGAHLVNHRGTEGTRFAVWAPNARAVSVIGDFNNWD-
GLGB_PROMA      ----------HEWMGEIDRHLFAEGNHHHIWRRMGAHQTKLDLVEGVMFCLWAPNARSVSVIGDMNSWDG
GLGB_MANSM      ----------HPMINELDNWLLAEGSHLRPYEVLGAHFVEYDNVAGVNFRVWAPNAKRVSVVGDFNYWDG
GLGB_SYNP6      ---------------DYDIHLFAEGNHHRIYEKLGAHPCELENVAGVNFAVWAPSARNVSILGDFNSW--
GLGB_SYNE7      ---------------DYDIHLFAEGNHHRIYEKLGAHPCELENVAGVNFAVWAPSARNVSILGDFNSW--
GLGB_HAES2      ----------HPMINELDNWLLAEGSHKRPYEILGAHFTECDNVAGVNFRLWAPNAKRVSVVGDFNYWDG
GLGB_BACCQ      ---------------------FHTEKYYESYNIFGAHIVTEDEMRGVRFTVWAPHAKAMSVVGDFNEWDY
GLGB_SHEB9      -----------SLLNSDDIYLFGEGSAERAYEFLGANWRQTQGVEGVHFCVWAPNAKRVSVVGDFNHWD-
GLGB_NITMU      -------------VSEHDLYLFNEGRLHQAYRMLGSHLVEMEGVAGVRFSVWAPNAERVSVVGSFNRWD-
GLGB_SYNY3      -----------------DLHVFGEGNHHRIYEKLGAHLMTVDGVKGVYFAVWAPNARNVSILGDFNNWQM
GLGB_THICR      -------------LGELDLHLYAEGRHWHVYDVLGAQVKEVDNISGVQFSVWAPAASRVSVVGDFNGWNG
GLGB_SHEB8      -----------SLLNSDDIYLFGEGSAERAYEFLGANWRQTQGVEGVHFCVWAPNAKRVSVVGDFNHWD-
GLGB_CELJU      -------------LGELDMHLFAEGQHWNIYNLLGAHPRQVDGINGVLFATWAPNAERISVVGNFNDWDG
GLGB_SHEB5      -----------SLLNSDDIYLFGEGSAERAYEFLGANWRQTQGVEGVHFCVWAPNAKRVSVVGDFNHWD-
GLGB_SHEB2      -----------SLLNSDDIYLFGEGSAERAYEFLGANWRQTQGVEGVHFCVWAPNAKRVSVVGDFNHWD-
GLGB_PROMP      -------------MGELDRHLFAEGNHHHIWEKMGAHIHEETNQQGVMFCIWAPNAKSISIIGDINSWDG
GLGB_THIDA      -------------LGEMDLYLFGEGRHFEIWKVLGARVKTVDGVTGCLFAVWAPAVLRVSVVGDFNDWDG
GLGB_GLOVI      -----------SLLSDLDGHLFAEGNHHRIYEKLGAHPAVFEGVAGVYFAVWAPSARNVSVLGDFNRWDG
GLGB_RHOBA      -----------SIFSDLDRYLIGEGRHNQLYERLGAQLREVDGVKGVNFAVWAPNARSVQVVGDFNGWDG
GLGB_RHORT      -------------LGELDRHLLGEGTHLDIYRKMGAHPMTRDGVRGTGFALWAPNATRVSVIGDFNGWDG
GLGB_AQUAE      -----------SLISDYDVYLFKEGTHTRLYDKLGSHVIELNGKRYTFFAVWAPHADYVSLIGDFNEWDK
GLGB_ACTP2      -----------------------EGTHLRPYEILGAHLKTQEGVSGVHFSVWAPNARRVSVVGDFNYWDG
GLGB_BACCN      ---------------EERLEQFHTEKCYESYQIFGAHLAVENGVHGVRFTVWAPRAKNLSVVGDFNEWN-
GLGB_DESHY      -------QKDSPLLTQEEMYLFNCGEFYYSYRKFGAHFLEHKGRWGTYFAVWAPQARQVSVVGDFNGWCG
GLGB_BACC1      ---------------------FHTEKYYESYNIFGAHIVTEDEMRGVRFTVWAPHAKAMSVVGDFNEWDY
GLGB_SYNS3      ----------HEWMGEMDRHLFAEGNHHHIWRRMGAHRCQQGGIQGVMFCLWAPNALTVSVIGNLNSWDG
GLGB_ACTPJ      -----------------------EGTHLRPYEILGAHLKTQEGVSGVHFSVWAPNARRVSVVGDFNYWDG
GLGB_PASMU      ----------HPMLADLDNWLLSEGSHLRPYEVLGAHFMECDGVSGVNFRLWAPNAKRVSIVGDFNYWDG
GLGB_BACC7      ---------------------FHTEKYYDSYNIFGAHIVTEDEMRGVRFTVWAPHAKAMSVVGDFNEWDY
GLGB_ACTP7      -----------------------EGTHLRPYEILGAHLKTQEGVSGVHFSVWAPNARRVSVVGDFNYWDG
GLGB_RUBXD      -------------LSDYDLYLFGEGNNHRIYRHLGAHPAEMDGVCGTAFAVWAPNARRVSVVGDFNLWD-
GLGB_BACST      -----------------EIYLFHEGSLYKSYELFGAHVIKKNGMVGTRFCVWAPHAREVRLVGSFNEWNG
GLGB_HAEIN      ----------HPMIDDLEQWLLSEGSMLRPYEVLGAHFMECDGVSGVNFRLWAPNARRVSIVGDFNYWDG
GLGB_SACD2      -----------STIPEGDLYLFGEGTYEQAYRLFGAHPTEVDGVPGCRFTVWAPNAKTVAVVGDFNFWQG
GLGB_PROM5      -------------MGEVDRHLFAEGNHHHIWKKMGAHISEDINQKGVMFCIWAPNAKSISIIGDINSWDG
GLGB_SYNSC      -------------MGEMDRHLFAEGNHHHIWQKMGAHLTERDGITGVMFCLWAPNALSVSVIGDLNSWDG
GLGB_HAEIG      ----------HPMIDDLEQWLLSEGSMLRPYEVLGAHFMECDGVSGVNFRLWAPNARRVSIVGDFNYWDG
GLGB_PARUW      ------------TFGEVDQYLFGKGVHYELYHQMGGRLATHQGIQGVKFAVWAPNAKSVSLIADFNHWDG
GLGB_HAEI8      ----------HPMIDDLEQWLLSEGSMLRPYEVLGAHFMECDGVSGVNFRLWAPNARRVSIVGDFNYWDG
GLGB_SYNPW      -------------MGEMDRHLFAEGNHHHIWRRMGAHHCEREGIPGVMFCLWAPHARSVSVIGDLNSWDG
GLGB_PROM4      -------------MGEIDTHLFAEGNHHHIWRRMGAHLSEMNGVCGVMFCLWAPNARSVSVIGEVNSW--
GLGB_ACTSZ      ----------HPMIQELDNWLLAEGSHLRPYEVLGAHFMECDHVSGVNFRLWAPNAKRVSVVGDFNYWDG
GLGB_METCA      -------------LSDFDLYLFGEGRHWNIYRVLGAHPHSVDGIDGILFATWAPNAERISVVGEFNGWDG
GLGB2_RHIEC     -----------------------EGTHYSLSRTLGAVEMAIDDVAGVRFAVWAPNARRVSVVGDFNAWDG
GLGB_BACCL      -----------------EVYLFHEGRLYQSYELFGAHVIRGGGAVGTRFCVWAPHAREVRLVGSFNDWNG
GLGB_SHEFN      ----NDPYQFDSLLNPDDVYLFGEGSQLQTYHFQGANWREHHGVKGVHFCVWAPNAKQVAVMGDFNLWD-
GLGB_METFK      -----------TTLSPEELYLFGEGRLKQAYRTFGAHLCEQQGVAGVRFVVWAPNAERVSVIGNFNHWDG
GLGB_PROMM      -------------MGEMDRHLFAEGNHHHIWQRMGAHLMEREGVEGVMFCLWAPHACSVAVLGELNGW--
GLGB1_RHIEC     -------------LGPMDDYFAREGSHLRLFDKMGAHLIKHEGAQGIHFAVWAPNAQRVSVVGDFNGWDG
GLGB_PROM3      -------------MGEMDRHLFAEGNHHHIWQRMGAHLMEREGVEGVMFCLWAPRACSVAVLGELNGW--
GLGB_SYNS9      ----------HEWMGEMDRHLFAEGNHHHIWQRMGAHLTQIDGISGVMFCLWAPNALTASVLGDLNSWDG
GLGB_RHOFD      ---------------DHDIYLFREGTHAKLYNKLGCHL---QSNGGANFAVWAPNAESVSVVGDWNYWSG
GLGB1_RHIL3     -------------LGPMDDYFAREGSHLRLFDKMGAHLIKHDGAQGIHFAVWAPNAQRVSVVGDFNNWDG
GLGB_PSEPK      -------------LGDMDLHLFAEGNHRDLSGRFGAQPTQVDGIDGVCFSVWAPNARRVSVVGDFNNWDG
GLGB_PROMT      -------------MGEIDRHLFAEGNHHHIWRKMGAHLTEIDKKKGVMFCLWAPHAKSVSVIGDLNSWDG
GLGB_AZOSE      ---------THSRLSEHDIYLFREGSHGRLYDKLG----CQLDEAGAHFAVWAPNARAVAVIGSFNAWR-
GLGB_RHIME      -------------LGPMDDYYIREGSHLRLFDKMGAHPIRHDGAEGFHFAVWAPNARRVSVVGSFNDWDG
GLGB_RHOP5      -----------------DLYLLGEGSHQRLYDKLGAHLMTLDGVEGVGFVVLAPNARRVSVVGDFNFW--
GLGB_CORDI      ------------TLGDLDLHLINEGRHERLWEVLGANPTAMGDVEGTAFAVWAPNASGVAVIGDFCGWN-
GLGB_STRAU      -------------LGELDLHLIGEGRHEELWTALGSQPMEHQGVAGTRFTVWAPNALGVRVTGDFSYWDA
GLGB_PROM1      -------------MGEIDRHLFAEGNHHHIWRKMGAHLTEINKKQGVMFCLWAPHAKSVSVIGDLNSWDG
GLGB_CORJK      ------------TVGDLDRYLIGEGRHEELWKVLGAHVV--DG--GVAFSVWAPHAAGVSVIGDFNGWNA
GLGB_ERWCT      ---------------DMDIWLLAEGTHLRPYERLGAHLETLDGVEGTRFAVWAPNAQRVSVVGQFNFWDG
GLGB_BACSU      -----------------DVYLFHEGSLFKSYQLFGSHYRELNGKSGYEFCVWAPHASEVRVAGDFNSWSG
GLGB2_STRCO     -------QETHDALGELDLHLIGEGRHEQLWQALGAEPMTHEGVTGTRFTVWAPNAQGVRVATDFTHWD-
GLGB_SYNR3      -------------MGAMDRHLFAEGNHHHIWQRMGAHPHLQDGVAGVQFCLWAPNARSVSVIGDCTNWDG
GLGB_MESSB      -----------STFGDLDLYLLGEGRHQRLYEKLGAHPMACDGVDGTRFAVWAPNASRVSVVGNFNNWDG
GLGB_ALHEH      ---------------DYDLHLFGEGRHYHAQRFLGAHPLEHEGVPGVRFAVWAPNAERVSVVGDFNRWDG
GLGB1_XANCP     -------------LSDFDLHLISEGHHLQLADALGANAVEVDGVRGTRFAVWAPNASRVAVVGDFNSWDA
GLGB1_XANC8     -------------LSDFDLHLISEGHHLQLADALGANAVEVDGVRGTRFAVWAPNASRVAVVGDFNSWDA
GLGB1_STRAW     -------------LGELDLHLINEGRHEELWTALGAEPMTHQGVPGTRFTVWAPNARGVRLAGTFNFWDA
GLGB_NEIDE      -----------SALQHTDAWLLGEGTHLRPYETLGAHFAEMDGVSGVRFAVWAPNARRVSVIGEFNGWDS
GLGB_MYXXD      ------------TLGEMDLYYAGEGRHERLWERMGAHLLHHHGVRGTSFAVWAPTAAGVSVVGDFNGWDG
GLGB1_XANAC     -------------LSDFDLHLISEGHHLQLADALGANVVEVEGVRGTRFAVWAPNASRVAVVGDFNSWDA
GLGB_AGRT5      -------------LGPMDDYFVREGSHLRLFDRMGAHPLKLEGVEGFHFAVWAPNARRVSVVGDFNNWDG
GLGB_SYNPX      -------------MGDMDRHLFAQGNHHHIWQRMGAHLTQRDGISGVMFCLWAPHALSVSILGDLNSWDG
GLGB_ECOL6      -------------IQEMDAWLLSEGTHLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
GLGB_DESVV      -----------------DLYLFGMGRHRHLYRILGAHPAVQDGEAGYRFAVWAPNARSVHLSGDCNGWRH
GLGB_CORGL      ------------TVGEMDIYLFSEGRHERLWEILGAYQTALGTVRGTAFTVWAPNAIGCAVVGGFNGWNA
GLGB_ECOUT      -------------IQEMDAWLLSEGTHLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
GLGB_ECOK1      -------------IQEMDAWLLSEGTHLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
GLGB_ECO57      -------------IQEMDAWLLSEGTHLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
GLGB_SHIF8      -------------IQEMDAWLLSEGTHLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
GLGB_ERWCH      ---------------ELDIWLLAEGRHLRPFETLGAHPSTLDGVVGTCFAVWAPNAQRVSVVGDFNFWDG
GLGB_SHIFL      -------------IQEMDAWLLSEGTHLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
GLGB_ECOL5      -------------IQEMDAWLLSEGTHLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
GLGB_DESVH      -----------------DLYLFGMGRHRHLYRILGAHPAVQDGEAGYRFAVWAPNARSVHLSGDCNGWRH
GLGB_BRAJA      -----------------DLYLLGEGTHQRLYDKLGAHPMTLDGVDGIGFVVLAPNARRVSVVGDFNFW--
GLGB_RHOS1      -------------------------RHYQLYTRLGAHPAEIEGVQGVSFAVWAPNARRVSVVGAFNAWDG
GLGB_SHISS      -------------IQEMDAWLLSEGTHLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
GLGB_PROM9      -------------MGEVDRHLFAEGNHHHIWEKMGAHLIEEKNQKGVMFCIWAPNAKSISIIGDINSWDG
GLGB_ECOLI      -------------IQEMDAWLLSEGTHLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
GLGB_ECOLC      -------------IQEMDAWLLSEGTHLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
GLGB_ECOHS      -------------IQEMDAWLLSEGTHLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
GLGB_ECO24      -------------IQEMDAWLLSEGTHLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
GLGB_RHOS4      -------------------------RHYQLYTRLGAHPAEIEGVQGVSFAVWAPNARRVSVVGAFNAWDG
GLGB_COREF      ------------TLGEMDTYLISEGRHERLWDVLGANVKTYETVRGTAFAVWAPNAIGVAVIGGFNGWNA
GLGB2_RHIL3     -----------------------EGTHYSLSRTLGAVAMSIDGISGVRFAVWAPNARRVSVVGDFNAWDG
GLGB_YERPS      -----------------------EGTHLRPYERLGAHLMSLDGVSGVSFAVWAPNAQRVSVVGDFNFWDG
GLGB_YERPP      -----------------------EGTHLRPYERLGAHLMSLDGVSGVSFAVWAPNAQRVSVVGDFNFWDG
GLGB_YERPN      -----------------------EGTHLRPYERLGAHLMSLDGVSGVSFAVWAPNAQRVSVVGDFNFWDG
GLGB_YERPE      -----------------------EGTHLRPYERLGAHLMSLDGVSGVSFAVWAPNAQRVSVVGDFNFWDG
GLGB_YERPA      -----------------------EGTHLRPYERLGAHLMSLDGVSGVSFAVWAPNAQRVSVVGDFNFWDG
GLGB_PROAC      -----------------DLEGFHSGGDTEVWKRLGSHVVTERGITGTRFAVWAPNAQAVEVISDFNWWTG
GLGB_LACS1      --------NTEERHGQESLHMFNQGVNYELYNFLGVHKISRDDESGYVFRVWAPHAKQVWVCGDFNNW--
GLGB_SHIDS      -------------IQEMDAWLLSEGTHLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
GLGB_YERP3      -----------------------EGTHLRPYERLGAHLMRLDGVPGVSFAVWAPNAQRVSVVGDFNFWDG
GLGB_SHIBS      -------------IQEMDAWLLSEGTHLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
GLGB_BACLD      -------------------HLFHEGRLYESYRFFGAHQTEQDGRQGFRFCVWAPHAKEVRIAGTFNGWSG
GLGB1_XANC5     -------------LSDFDLHLISEGHHLQLADALGANVVEVDGVRGTRFAVWAPNASRVAVVGDFNSWDA
GLGB_RHOP2      ---------------EFDLYLLGEGTDQRLYDKLGAHPMVLEGVRGVGFVVLAPNARRVSVVGDFNFWN-
GLGB_FRASC      ------------TLGEMDLHLIIEGRHEQLWKVLGAHPRAGATVTGVSFAVWAPSARGVRLVGDFDFW--
GLGB_PSE14      -------------LGEMDLYLFAEGNHRDLSSCLGAQVTKVDGVDGVRFAVWAPNARRVSVVGSFNSWDG
GLGB_RHOPB      -----------------DLYLLGEGTHQRLYDKLGAHPLTLDGVDGIAFVVLAPNAQRVSVVGDFNFWN-
GLGB_FUSNN      --------------GQMEQYLFHRGEFRQAYEYFGAHPTRSSTI----FRIWAPSAKSVAVVGDFNDWRA
GLGB1_XANOR     -------------LSDFDLHLISEGHHLQLADALGANVVEVDGVRGTRFAVWAPNASRVAVVGDFNSWDA
GLGB_SALAR      -------------IQEMDAWLLSEGTHLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
GLGB_PSEF5      -------------LGEMDLYLFAEGNHRDLSSCLGAQLTTVDGIDGVRFAVWAPNARRVSVVGDFNIWDG
GLGB_MYCPA      ------------TLGEVDLHLFGEGRHERLWEVLGAHPTADGVVTGVSFAVWAPNAKGISLIGEFNGWTG
GLGB_PSEU2      -------------LGEMDLYLFAEGNHRDLSSCLGAQVTSVDGVDGVRFAVWAPNARRVSVVGSFNSWDG
GLGB_RHOPS      -----------------DLYLLGEGTDQRLYDKLGAHPMALEGVNGVAFVVLAPNARRVSVVGDFNFWN-
GLGB_BURXL      -------------LGDEPLGRLAGGDPYAVLECLGARPMEVDGVPGVRFAVWAPNARRVSVVGDFNAWDG
GLGB2_XANOM     -------------LSDFDLHLISEGHHLQLADALGANVVEVDGVRGTRFAVWAPNASRVAVVGDFNSWDA
GLGB_YERE8      -----------------------EGTHLRPYERLGAHLMSLDEVPGVSFAVWAPNAQRVSVVGEFNFWDG
GLGB_SALPB      -------------IQEMDAWLLSEGTHLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
GLGB_SALPA      ---------------EMDAWLLSEGTHLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
GLGB_THEFY      ------------TLGELDIHLIQEGRHEELWRVLGAHTKRFPSVEGTAFTVWAPNARGVRVIGDFNHWDG
GLGB_PSESM      -------------LGEMDLYLFAEGNHRDLSSCLGAQVTSVDGVEGVRFAVWAPNARRVSVVGSFNGWDG
GLGB_SALTI      -------------IQEMDAWLLSEGTHLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
GLGB_SALCH      -------------IQEMDAWLLSEGTHLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
GLGB_SALTY      -------------IQEMDAWLLSEGTHLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
GLGB_MYCSS      ------------TLGEMDLHLFSEGRHERLWEVLGAHPRTFETVEGVSFAVWAPNANGVQLIGDFNHWDG
GLGB_MYCSK      ------------TLGEMDLHLFSEGRHERLWEVLGAHPRTFETVEGVSFAVWAPNANGVQLIGDFNHWDG
GLGB_CITK8      -------------IQEMDAWLLSEGTHLRPYETLGAHADTMDGVTGTRFSVWAPNAQRVSVVGQFNYWDG
GLGB_VIBPA      ----------------QEYEHLHTPKDMYHY--MGAHERGGENISGVRFLVYAPHASAVSLVGCFNQW--
GLGB_MAGSA      -------------LGDLDVHLLAEGTHLRTFEKLGAQVRIVDGVAGVDFALWAPNASRVSVVGDFNGWDG
GLGB_RHOSR      ------------TLGELDLHLFGEGRHERLWEILGAHRTPDGTVTGTSFAVWAPNARGVSVIGDFDGWS-
GLGB_MYCSJ      ------------TLGEMDLHLFSEGRHERLWEVLGAHPRTFETVEGVSFAVWAPNANGVQLIGDFNHWDG
GLGB_DESDG      -----------------DVYLFGRGEHWDIYRVLGAHAHAQDGETGYRFAVWAPNAHAVSLVGPFNDWRS
GLGB_NITWN      -----------------DLYLLGEGTHQRIYDKLGAHPMAMEGVDGAGFVVLAPNARAVAVVGDFNFW--
GLGB_BRASO      -------------LGDFDLHLLGEGNHERLYDKLGAHPMXXXXXXXXXXXXLAPNARRVSVVGDFNFWNA
GLGB_BIFLO      ------------TVGDMDTYLFGEGRHEKLWETLGAHVTPGEQVVGTAFSVWAPNAHAVRVVGNFNAWDG
GLGB_RHILO      -------------LGPMDDYYIAEGSHLRLFDKLGAHVIEHEGATGVHFAVWAPNAKRVSVVGDFNDWDG
GLGB_PSEPF      -------------LGEMDLYLFAEGNHRDLSSCLGAQLKTVDGVDGVRFAVWAPNARRVSVVGDFNVWDG
GLGB_LACAC      ---------------KQHIKKFAAGNELYLQEVLGCHY--ENDI--YTFRVWAPNAQKVWLVGDFNDW--
GLGB_DECAR      ------------------LYLFNEGRNNQAYRLLGAHA----DISGTTFRVWAPNASRVSVVGDFNGWH-
GLGB_SERP5      -----------------------EGTHLRPYERLGAHLSTLDDVEGVSFAVWAPNAQRVSVVGEFNFWDG
GLGB_GRABC      -------------LGDLDVYLLAEGRHEDLGRVLGAHVTTMHSVEGVRFAVWAPNATRASVIGSFNHWDG
GLGB_MYCBP      ------------TLGEVDLHLFAEGRHERLWEVLGAHPTADGVVSGVSFAVWAPNAKGVSLIGEFNGWNG
GLGB_MYCBO      ------------TLGEVDLHLFAEGRHERLWEVLGAHPTADGVVSGVSFAVWAPNAKGVSLIGEFNGWNG
GLGB_KLEP7      -----------------DVWLLSEGTHLRPYETLGAHAATMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
GLGB_BRASB      -----------------DLHLLGEGNHERLYDKLGAHPMXXXXXXXXXXXXXAPNARRVSVVGDFNFWNA
GLGB_PROM2      -------------MGEVDRHLFAEGNHHHIWEKMGAHLIEEKNQKGVMFCIWAPNAKSISIIGDINSWDG
GLGB_PROM0      -------------MGEVDRHLFAEGNHHHIWEKMGAHLIEDKNQKGVMFCIWAPNAKSISIIGDINSWDG
GLGB_STRSV      ---------------------FTTGENFHLQHYLGAHQDEVDGKSGYSFRVWAPNAQSVHLIGDFTNWYE
GLGB_RHOPA      -------------LSDFDLYLLGEGTDQRLYDKLGAHPMELEGVAGVGFVVLAPNARRVSVVGDFNFWN-
GLGB_PROMS      -------------MGEVDRHLFAEGNHHHIWEKMGAHLIEEKNQKGVMFCIWAPNAKSISIIGDINSWDG
GLGB_CHLFF      --------------GEIDSFLFHQGTHYKIYERMGAIPCDVRGISGVLFVVWAPHAQRVSVIGDFNFWNG
GLGB_CHLPN      --------------GEIDSFLFHRGTHYRIYERMGAIPMEVQGISGVLFVLWAPHAQRVSVVGDFNFWHG
GLGB_VIBF1      ------------------------------YNHLGAHNVVRDGIQGVRYLVFAPNASSASVIGDFNQW--
GLGB_STRGC      ---------------------FTTGENFHLQHYLGAHQEEVDGKVGYSFRVWAPNAQSVHLIGDFTNWY-
GLGB_MYCTU      ------------TLGEVDLHLFAEGRHERLWEVLGAHPTADGVVSGVSFAVWAPNAKGVSLIGEFNGWNG
GLGB_MYCTA      ------------TLGEVDLHLFAEGRHERLWEVLGAHPTADGVVSGVSFAVWAPNAKGVSLIGEFNGWNG
GLGB_STRR6      ---------------------FMTGENFYLQHYLGAHREELNGEHGYTFRVWAPNAQAVHLVGDFTNW-I
GLGB_STRP2      ---------------------FMTGENFYLQHYLGAHREELNGEHGYTFRVWAPNAQAVHLVGDFTNW-I
GLGB2_STRAW     ------------------------------------------GVLGTRFTVWAPNARGVRVCGNFCRWDG
GLGB_STRPN      ---------------------FMTGENFYLQHYLGAHREELNGEHGYTFRVWAPNAQAVHLVGDFTNW-I
GLGB_STRMU      ---------------------FGTGENFHAQHYFGFHETEKNGVKGYIFRVWAPNAEDLHLIGDFTGWF-
GLGB_RHIRD      -------------LGPMDDYFVREGS-ICGYSTGWARIPLKEGVEGFHFAVWAPNGRRVSVVGDFNNWDG
GLGB_BURTA      -------------LGSLDCHLLARGEHRDAYRRLGAHPCVHDGLEGTAFALWAPNASCVSVVGSFNGWDA
GLGB_LEIXX      ------------TIGELDLHLIREGRHERLWTALGARLRDLGGVTGTAFTVWAPHARAVRVVGDFNGWD-
GLGB_BUTFI      -------------ISEDDEYLFGQGTHYDIYDKLGAHPSEEKGKKGFFFAVWAPNAADVHVVGDFNGWD-
GLGB_MYCUA      ------------TLGEVDLHLFAEGRHERLWEALGAHPTADGVVHGVSFAVWAPNAEGVSLIGDFNGWSG
GLGB_DEIGD      ---------------------------------LGAHPVTENGVEGVRFAVWAPRAQHVSVVGDFNGWNG
GLGB_NITHX      -------------LSDFDLYLLGEGTDQRLYDKLGAHPITMDGVGGTGFVVLAPNARAVAVVGDFNCW--
GLGB_CHLCV      --------------GEMDSFLFHQGTHYKIYERMGAIPCDVGGILGVLFVVWAPHAQRVSVVGDFNYWNG
GLGB_ENT38      -------------IQEMDAWLLSEGTHLRPYETLGAHADTMDGITGTRFSVWAPNAQRVSVVGQFNYWDG
GLGB_NOCFA      ------------TLGELDLHLIGEGRHEHLWHVLGAHPTLDGPVSGTSFAVWAPNARGVTVIGDFDGWSG
GLGB_VIBCH      ----------------EDLHYHHMGAQFVTLERDG------KMVSGVRFLVYAPHAAACSLIGAFNHW--
GLGB_STRA3      ---------------KDELYTFGIGENFHLQNYLGVHSENES----FCFRVWAPNAENVQVIGDFTDWR-
GLGB_STRA5      ---------------KDELYTFGIGENFHLQNYLGVHS--ENG--SFCFRVWAPNAENVQVIGDFTDWR-
GLGB_STRA1      ---------------KDELYTFGIGENFHLQNYLGVHS--ENG--SFCFRVWAPNAENVQVIGDFTDWR-
GLGB_CHLAB      --------------GEVDSFLFHQGTHYKIYECMGAIPYNVQGISGVLFVVWAPHAQRVSVVGDFNFWNG
GLGB1_STRCO     ---------------------------------LGAHPTTHEGVAGTRFAVWAPNARGVRVAGGFNFWDG
GLGB_PSEA6      ---------------DQAFHAVHFVDHLNVYQQLGAQLGLKTPIAATRFAVFAPNASAVSVIGDFNYWDG
GLGB_VIBVU      --------------------YQHMGSQFMTLERDG------KSISGIRFLVYAPHATAVSLVGSFNDW--
GLGB_RALEJ      -----------------------EGRHFELGACLGAQWRNVDGVQGVRFAVWAPNARRVSVIGDFNGWQP
GLGB_BURCM      -------------LDEAALARFAAGDPAAVLDCLGATPTRVDGVDGVRFAVWAPNAQRVSVVGDFNMWDG
GLGB_CHLT2      --------------GEIDSFLFHEGTHQRIYERMGAIPCEIDGVPGVRFIVWAPHAQRVSVIGDFNGWHG
GLGB_DEIRA      ---------------------------------LGAHPTTEHGVQGVRFAVWAPNAQHVSVVGDFNDWNG
GLGB_CHLTB      --------------GEIDSFLFHEGTHQRIYERMGAIPCEIDGVPGVRFIVWAPHAQRVSVIGDFNGWHG
GLGB_CHLTA      --------------GEIDSFLFHEGTHQRIYERMGAIPCEIDGVPGVRFIVWAPHAQRVSVIGDFNGWHG
GLGB_VIBVY      --------------------YQHMGSQFMTLERDG------KSISGIRFLVYAPHATAVSLVGSFNDW--
GLGB_PHOPR      -------------------------------------------ISGVRFLTYAPNASAVSVIGEFNAW--
GLGB_SALRD      ---------------DDDIYYWRQGTHTHSYERMGAHP----NQRGTWFGVWAPNADRVEVTGDFNDWRV
GLGB_PSEA7      -------------LGELDLYLFAEGNHRQLASCLGAQLTRHEGVDGVRFAVWAPNAVRVSVVGDFNGWDG
GLGB_CHLTR      --------------GEIDSFLFHEGTHQRIYERMGAIPCEIDGVPGVRFIVWAPHAQRVSVIGDFNGWHG
GLGB_PSEAE      -------------LGELDLYLFAEGNHRQLASCLGAQLTRHEGVEGVRFAVWAPNAVRVSVVGDFNGWDG
GLGB_RHOMR      -----------SWLTEEDIRRWESGTFYDSYRKLGAHP----DDEGTWFCVWAPHADGVSVLGAFNDWNP
GLGB2_XANCP     ---------------------------------LGARHVQVGELPAVRFAVWAPHAQRVAVVGDFNGW--
GLGB2_XANC8     ---------------------------------LGARHVQVGELPAVRFAVWAPHAQRVAVVGDFNGW--
GLGB_ROSDO      -------------IGDIDEYLLGEGSHRRLWSVLGAHVITHEGVAGTHFAVWAPNAQRVSVVGEFNVWDG
GLGB_NOVAD      -------------LGPLDDFLIAEGTHLRLFDKMGAHLIEHEGARGVHFAVWAPNARLVSVVGDFNDWD-
GLGB_CHLMU      --------------GEIDSFLFHEGTHQHIYDRMGAIPCEIGGVPGVRFVIWAPHAQRVSVVGDFNCWHG
GLGB_BURVG      ---------------------------------LGATPIRVDGVDGVRFAVWAPNAQRVSVVGNFNSWDG
GLGB_BURCH      -------------LDEAALARFSAGDPEAVLDCLGATPVRIDDTDGVRFAVWAPSAQRVSVVGDFNAWDG
GLGB_BURCA      -------------LDEAALARFSAGDPEAVLDCLGATPVRIDDTDGVRFAVWAPSAQRVSVVGDFNAWDG
GLGB2_XANOR     ------------------------------------HVQCGE-VPGVRFAVWAPHAQRVAVVGDFNGWDV
GLGB1_XANOM     ------------------------------------HVQCGE-VPGVRFAVWAPHAQRVAVVGDFNGWDV
GLGB_RALSO      -----------------------EGRHWELARCLGAQAMRQDDVAGVRFAVWAPNARRVSVVGDFNQWDG
GLGB2_XANAC     ------------------------------------HLHCGD-VPGVRFALWAPHAQRVAVVGDFNGWDV
GLGB_LACPL      -------------------YLFNTGAGFNSQDYLGCHLAASGRAV---FRVWAPHAKAVGVVGDFNDWQ-
GLGB_RALEH      -----------------------EGRHFELGACLGAQWQRVDGIDGVRFAVWAPNARRVSVIADFNGWHP
GLGB_JANSC      -------------ITDFDQYLLGEGTHRQLWRVLGAHVQDD----ATHFAVWAPNARAVSVTGDFNGWSG
GLGB_PICTO      -------------ISDYDIYLYGTGRLFEAYKTFGAHLKTIKDVSGCNFVVWAPSALSVSVVGNFNHW-T
GLGB_BURP6      -----------------------------------------DGVPGVRFAVWAPGASRVSVVGDFNGWDA
GLGB2_XANC5     ------------------------------------HVHCGD-VPGVRFAVWAPHAQRVAVVGDFNGWDV
GLGB_BURPS      -----------------------------------------DGVPGVRFAVWAPGASRVSVVGDFNGWDA
GLGB_BURP1      -----------------------------------------DGVPGVRFAVWAPGASRVSVVGDFNGWDA
GLGB_BURP0      -----------------------------------------DGVPGVRFAVWAPGASRVSVVGDFNGWDA
GLGB_BORBR      ----------------------------YLAGLLGAHAASVDGCAGTRFALWAPNARRVAVVGDFNGWDG
GLGB_BORPA      ----------------------------YLAGLLGAHAASVDGCAGTRFALWAPNARRVAVVGDFNGWDG
GLGB_BORPE      ----------------------------YLAGLLGAHAASVDGCAGTRFALWAPNARRVAVVGDFNGWDG
GLGB_BURS3      ---------------------FSAGDPAAVLDCLGATPARIDDTDGVRFAVWAPNAQRVSVVGDFNGWDG
GLGB_DICDI      -------------------------KFSQGYEYFGFNVTKD----GVNYREWLPSAHEVYLVGDFNQWNL
GLGB_CRYNE      ---------------------------------------------GVRYREWASNATEARLIGEFNNWS-
GLGB_HUMAN      ------------------------------YESFGVHR-CADG--GLYCKEWAPGAEGVFLTGDFNGWNP
GLGB_YARLI      -------------VGQWKDHFAKEGEFAASYKRYGLHVNKDNSVT---YREWAPGASEAVLTGDFNGW--
GLGB_FELCA      ---------TLNNIGENEIDKFSRG-----YESFGVHR-CADG--GLYCKEWAPGAEGVFLTGDFNDWNP
GLGB_MOUSE      ------------------------------YESFGIHR-CSDG--GIYCKEWAPGAEGVFLTGEFSGWNP
GLGB_HORSE      ------------------------------YESFGVHR-CADG--GLYCKEWAPGAEGVFLTGDFNDWNP
GLGB_GLOIN      ----------------------------------------------IIYREWAPNAVAASLIGEFNDWD-
GLGB_ASPOR      ----------------------------------------------IIYREWAPNAVQAQLVGEFNNWDV
GLGB_EMENI      ----------------------------------------------ITYREWAPNAIEAALVGDFNNWDT
GLGB_CANGA      -----------------------------AYKTYGLH--ANQQTKEIVYREWAPNAQRAFLVGEFNNWN-
GLGB_YEAST      -----------------------------SYKSYGLHANPET--KEITYKEWAPNAERAFLVGDFNNWDT
GLGB_DEBHA      -----------------------------AYEKYGLHANWDT--KEVFINEYIPNVVEVSLVGDFNNWDT
GLGB_ASHGO      -----------------------------AYKSYGLHADAQS--KSITYREWAPNATRAFLVGDFNGWD-
GLGB_KLULA      -----------------------------AYKSFGLH--ADPGSLEIRYKEWAPNAVRAFLIGEFNSWN-
GLGB_MAIZE      --------------------------------------------EGITYREWAPGAFSAALVGDVNNWDP
GLGB_SOLTU      ----------------------------------------------IVYREWAPAAQEDEVIGDFNGWN-
GLGB_ORYSJ      ------------------------------------------------YREWAPAAQEAQLIGEFNNWNG
TREZ_ARTSQ      -----------------------------------------------RYDVWAPNAESVTLLAGGERYAM
PULA_BACSU      ------------------------------------------------FKVWAPAATSAAV--KLSHPNK
TREZ_BREHE      -----------------------------------------------RFDVWAPDVSSVVLVADGRQYPM
TREZ_MYCTU      ----------------------------------------------------------------------
ISOA1_ARATH     --------------------------------------------DGVNFSVYSTNSVSICLISDLRQNKV
TREZ_RHIS1      -----------------------------------------------RFDIWAPEAGTVTLLAGGERYEM
PULA_THEMA      --------------------YYYDGE-------LGAVYSPEKTI----FRVWSPVSKWVKVLEDTEPYQV
GLGX_HAEIN      ---------------------------------MGYSQAVENNVQITNFALFSAAAIGVCLFDEQN----
TREZ_ARTRM      -----------------------------------------------RFPVWAPQAAQVTLV-------V
NEPU_BACST      ----------------------------------------------------------------------
GLGX_MYCTU      ---------------------------------------------GTNFSLFSEIAEKVCLIDEDG---V
GLGX_MYCBO      ---------------------------------------------GTNFSLFSEIAEKVCLIDEDG---V
CDAS_THEP3      ----------------------------------------------------------------------
AMYB_PAEPO      ----------------------------------------------------------------------
GLGX_YERE8      ---------------------------------MGAHF---DGV-GINFTLFSAHAEQVCLFDDNN----
ISOA3_ARATH     --------------------------------------------KGINFALFSQNATSVTLLSQSGKDDT
O16G3_BACSU     ----------------------------------------------------------------------
MALT_SCHPO      ----------------------------------------------------------------------
GLGX_ENT38      --------------------------------------------KGVNFTLFSAHAERVCVFDR----EG
MAL2_DROME      ----------------------------------------------------------------------
CDGT_BACOH      ----------------------------------------------------------------------
AMYM_BACAD      ---------------------YHRPKDNYAY-------ACANGELHIRIRTKKDDMKEVTLVYDDNKWTY
CDGT_KLEOX      ----------------------------------------------------------------------
MALT_AEDAE      ----------------------------------------------------------------------
AMYA_ASPNG      ----------------------------------------------------------------------
GLGX_YERPB      --------------------------------------------KGINFTLFSAHAEQVCLFDE----QG
BBMA2_BACSU     ----------------------------------------------------------------------
BBMA1_BACSU     ----------------------------------------------------------------------
ISOA_PSEUM      ----------------------------------------------------------------------
ISOA_PSEAY      ----------------------------------------------------------------------
GLGX_YERPY      --------------------------------------------KGINFTLFSAHAEQVCLFDE----QG
GLGX_YERPS      --------------------------------------------KGINFTLFSAHAEQVCLFDE----QG
GLGX_YERPP      --------------------------------------------KGINFTLFSAHAEQVCLFDE----QG
GLGX_YERPN      --------------------------------------------KGINFTLFSAHAEQVCLFDE----QG
GLGX_YERPG      --------------------------------------------KGINFTLFSAHAEQVCLFDE----QG
GLGX_YERPE      --------------------------------------------KGINFTLFSAHAEQVCLFDE----QG
GLGX_YERPA      --------------------------------------------KGINFTLFSAHAEQVCLFDE----QG
GLGX_CITK8      ------------------------------------HGATYDG-HGVNFTLFSAHAERVCVFDALG----
GLGX_YERP3      --------------------------------------------KGINFTLFSAHAEQVCLFDE----QG
GLGX_ERWT9      ----------------------------------------------------------------------
AMY2_DICT6      ----------------------------------------------------------------------
GLGX_SHIBS      --------------------------------------------QGVNFTLFSAHAERVCVF-DANG---
GLGX_SHIB3      --------------------------------------------QGVNFTLFSAHAERVCVF-DANG---
GLGX_SHIFL      --------------------------------------------QGVNFTLFSAHAERVCVF-DANG---
GLGX_SHIF8      --------------------------------------------QGVNFTLFSAHAERVCVF-DANG---
GLGX_SHIDS      --------------------------------------------QGVNFTLFSAHAERVCVFDANGH---
GLGX_ECOL6      --------------------------------------------QGVNFTLFSAHAERVCVF-DANG---
GLGX_ECO81      --------------------------------------------QGVNFTLFSAHAERVCVF-DANG---
AMY2_DEBOC      ----------------------------------------------------------------------
MALT_CANAL      ----------------------------------------------------------------------
GLGX_SHISS      --------------------------------------------QGVNFTLFSAHAERVCVF-DANG---
GLGX_ECOUT      --------------------------------------------QGVNFTLFSAHAERVCVF-DANG---
GLGX_ECOK1      --------------------------------------------QGVNFTLFSAHAERVCVF-DANG---
GLGX_ECO45      --------------------------------------------QGVNFTLFSAHAERVCVF-DANG---
CDGT_BACS2      ----------------------------------------------------------------------
AMY3_DICT6      ----------------------------------------------------------------------
GLGX_SALPK      ------------------------------------HGATYDG-HGVNFTLFSAHAERVCVFDS----RG
GLGX_SALPA      ------------------------------------HGATYDG-HGVNFTLFSAHAERVCVFDS----RG
GLGX_ESCF3      ----------------------------------------------------------------------
GLGX_ECOSM      --------------------------------------------QGVNFTLFSAHAERVCVF-DANG---
GLGX_ECOSE      --------------------------------------------QGVNFTLFSAHAERVCVF-DANG---
GLGX_ECOLI      --------------------------------------------QGVNFTLFSAHAERVCVF-DANG---
GLGX_ECOL5      --------------------------------------------QGVNFTLFSAHAERVCVF-DANG---
GLGX_ECODH      --------------------------------------------QGVNFTLFSAHAERVCVF-DANG---
GLGX_ECOBW      --------------------------------------------QGVNFTLFSAHAERVCVF-DANG---
GLGX_ECO8A      --------------------------------------------QGVNFTLFSAHAERVCVF-DANG---
GLGX_ECO7I      --------------------------------------------QGVNFTLFSAHAERVCVF-DANG---
GLGX_ECO5E      --------------------------------------------QGVNFTLFSAHAERVCVF-DANG---
GLGX_ECO57      --------------------------------------------QGVNFTLFSAHAERVCVF-DANG---
GLGX_ECO55      --------------------------------------------QGVNFTLFSAHAERVCVF-DANG---
GLGX_ECO27      --------------------------------------------QGVNFTLFSAHAERVCVF-DANG---
GLGX_ECO24      --------------------------------------------QGVNFTLFSAHAERVCVF-DANG---
GLGX_SALPB      ------------------------------------HGATYDG-HGVNFTLFSAHAERVCVFDS----RG
GLGX_ENTS8      ---------------------------------------------GVNFTLFSAHAEKVCLFDESG----
GLGX_ECOLU      --------------------------------------------QGVNFTLFSAHAERVCIF-DANG---
GLGX_ECOLC      --------------------------------------------QGVNFTLFSVHAERVCVF-DANG---
GLGX_ECOHS      --------------------------------------------QGVNFTLFSVHAERVCVF-DANG---
CDGT_BACS3      ----------------------------------------------------------------------
TRES_THETH      ----------------------------------------------------------------------
NEPU2_THEVU     ----------------------------------------------------------------------
MDE5_SCHPO      ----------------------------------------------------------------------
MAL2_DROVI      ----------------------------------------------------------------------
MAL1_APIME      ----------------------------------------------------------------------
GLGX_SERP5      ---------------------------------------------GINFSLYSAHATGV----ELCLFDE
GLGX_SALSV      ------------------------------------HGATYDG-HGVNFTLFSAHAERVCVFDS----RG
GLGX_SALA4      ------------------------------------HGATYDG-HGVNFTLFSAHAERVCVFDS----RG
GLGX_KLEP7      ----------------------------------------------------------------------
CDGT_BACS0      ----------------------------------------------------------------------
MAL1_DROVI      ----------------------------------------------------------------------
GLGX_SALTY      ------------------------------------HGATYDG-HGVNFTLFSAHAERVCVFDS----RG
GLGX_SALPC      ------------------------------------HGATYDG-HGVNFTLFSAHAERVCVFDS----RG
GLGX_SALNS      ------------------------------------HGATYDG-HGVNFTLFSAHAERVCVFDS----RG
GLGX_SALHS      ------------------------------------HGATYDG-HGVNFTLFSAHAERVCVFDS----RG
GLGX_SALG2      ------------------------------------HGATYDG-HGVNFTLFSAHAERVCVFDS----RG
GLGX_SALEP      ------------------------------------HGATYDG-HGVNFTLFSAHAERVCVFDS----RG
GLGX_SALCH      ------------------------------------HGATYDG-HGVNFTLFSAHAERVCVFDS----RG
CDGT_BREBE      ----------------------------------------------------------------------
CDAS_BACSH      ----------------------------------------------------------------------
AMY1_SACFI      ----------------------------------------------------------------------
GLGX_SALDC      ------------------------------------HGATYDG-HGVNFTLFSAHAERVCVFDS----RG
AMY_ASPSH       ----------------------------------------------------------------------
AMYB_ASPAW      ----------------------------------------------------------------------
AMYA_ASPAW      ----------------------------------------------------------------------
AMYA1_ASPOR     ----------------------------------------------------------------------
GLGX_SALTI      ------------------------------------HGATYDG-HGVNFTLFSAHAERVCVFDS----RG
CDGT2_PAEMA     ----------------------------------------------------------------------
AMYM_BACST      ----------------------------------------------------------------------
AMY3_WHEAT      ----------------------------------------------------------------------
AMY1_LIPKO      ----------------------------------------------------------------------
O16G2_BACSU     ----------------------------------------------------------------------
AMYA3_ASPOR     ----------------------------------------------------------------------
ISOA2_ARATH     ----------------------------------------------------------------------
GLGX_KLEP3      ----------------------------------------------------------------------
CDGT1_PAEMA     ----------------------------------------------------------------------
AMYS_NEIPO      ----------------------------------------------------------------------
AMY2A_ORYSJ     ----------------------------------------------------------------------
AMY2A_ORYSI     ----------------------------------------------------------------------
MAL1_DROME      ----------------------------------------------------------------------
MGTA_THENE      ----------------------------------------------------------------------
AMYS_NEIME      ----------------------------------------------------------------------
AMY1_HORVU      ----------------------------------------------------------------------
O16G_BACTR      ----------------------------------------------------------------------
O16G_BACF5      ----------------------------------------------------------------------
MAL3_DROME      ----------------------------------------------------------------------
MALX1_YEAST     ----------------------------------------------------------------------
AMY4_SCHPO      ----------------------------------------------------------------------
YQ29_SCHPO      ----------------------------------------------------------------------
TREC_BACSU      ----------------------------------------------------------------------
APU_THEP3       ----------------------------------------------------------------------
TGS1_HUMAN      ----------------------------------------------------------------------
AMY_STRVL       ----------------------------------------------------------------------
O16G_BACCO      ----------------------------------------------------------------------
CDGT2_BACCI     ----------------------------------------------------------------------
CDGT_BACST      ----------------------------------------------------------------------
AMY1_DEBOC      ----------------------------------------------------------------------
O16G1_BACSU     ----------------------------------------------------------------------
CDGT_THETU      ----------------------------------------------------------------------
O16G_BACCE      ----------------------------------------------------------------------
MGTA_THEMA      ----------------------------------------------------------------------
MALX4_YEAST     ----------------------------------------------------------------------
MALX2_YEAST     ----------------------------------------------------------------------
CDGT_BACS8      ----------------------------------------------------------------------
CDGT_BAC11      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EDKNYMEPITDAGLWSVFIPNAKNGDKYKFVVTNKDTNNYVYKSDPYAFFSELRPNTASIITTETQYTWS
GLGB_FRATM      EDKNYMEPITDAGLWSVFIPNAKNGDKYKFVVTNKDTNNYVYKSDPYAFFSELRPNTASIITTETQYTWS
GLGB_FRATW      EDKNYMEPITDAGLWSVFIPNAKNGDKYKFVVTNKDTNHYVYKSDPYAFFSELRPNTASIITTETQYTWS
GLGB_FRATT      EDKNYMEPITDAGLWSVFIPNAKNGDKYKFVVTNKDTNHYVYKSDPYAFFSELRPNTASIITTETQYTWS
GLGB_FRAT1      EDKNYMEPITDAGLWSVFIPNAKNGDKYKFVVTNKDTNHYVYKSDPYAFFSELRPNTASIITTETQYTWS
GLGB_FRATO      EDKNYMEPITDAGLWSVFIPNAKNGDKYKFVVTNKDTSHYVYKSDPYAFFSELRPNTASIITTETQYTWS
GLGB_FRATF      EDKNYMEPITDAGLWSVFIPNAKNGDKYKFVVTNKDTSHYVYKSDPYAFFSELRPNTASIITTETQYTWS
GLGB_FRATH      EDKNYMEPITDAGLWSVFIPNAKNGDKYKFVVTNKDTSHYVYKSDPYAFFSELRPNTASIITTETQYTWS
GLGB_FRATN      EDKNYMEPITDAGLWSVFIPNAKNGDKYKFVVTNKDTNHYVYKSDPYAFFSELRPNTASIITTETQYTWS
GLGB_FRAP2      EDKNHMKRITDAGLWSVFIADVKDGDKYKFVVTNKDTNHYVYKSDPYAFFSELRPNTASVISTQTTYKWH
GLGB_CLOP1      KEEYSMKKINERGIWSLFLPKLEEGIKYKFAVVNECGNNTVYKADPYAFKSELRPNTASVLTKIKSFRWG
GLGB1_CLOPE     KEENKLERINETGLWSIFIPRLKEGIKYKYYIEQED-GKAVLKADPYGIYSEVRPNTASILCEKTKIRWS
GLGB2_CLOPE     KEEYSMKKINERGIWSLFLPKLEEGIKYKFAVVNECGNNTVYKADPYAFKSELRPNTASVLTKIKSFRWG
GLGB2_CLOPS     KEEYSMKKINERGIWSLFIPKLEEGIKYKFAVENECGNNTVYKSDPYAFKSELRPNTASVLTKIKSFRWG
GLGB1_CLOPS     KEENKLNRINETGLWSIFIPRLKEGIKYKYYIEQED-GKAVLKADPYGIYSEVRPNTASILCEKTKIRWS
GLGB_OCEIH      ENSHPLEKFTDEGLWGGFIADIPPATSYKYICSSEDTS--ILKADPFATQAERRPKTASVIPAANGYQWS
GLGB_HALOH      GNINPMERINDSGIWTTFIPEAKKGDLYKYEILTKYGDTRI-KSDPYAFYAERKPKTASIVYSLXXXXXX
GLGB_THEEB      DGRKHQMARRGNGIWELFIPGLSVGERYKYEIKNQEGHIYE-KSDPYGFYQEPRPKTASIVTDLNSYEWG
GLGB_SYNJA      R-QHQMKRLGESGIWAVFIPGVGPGAVYKYEVKTAWGDIYE-KSDPYGFQQEVRPKTGSIVADLHTYTWH
GLGB_SHESW      DTRHVMRQHMANGLWEIFLPNVAEGAHYKFDLVHPNGERHA-KSDPMATQMECAPHNASIVPKKSKHSWK
GLGB_SHEPC      DTQHVMRQHMANGLWEIFLPNVAEGAHYKFDLVHPNGERHA-KSDPMATQMECAPHNASIVPKKSKHSWK
GLGB_ANASP      RKHQMRKGAT--GVWELFIPEIGVGEHYKYEIKNFAGHIYE-KSDPFGFQQEPRPKTASIVSNLNSYNWS
GLGB_NITOC      RC-HPMQLRGLTGVWELFIPGLKPGTLYKYELRNRNRGSIHLKSDPYGQRFEQRPHTASIVAAKTNYLWQ
GLGB_NITEC      RVCPMMAR-DHSGVWELFIPDLPGGTLYKYEIRNHSTGEILLKTDPYATRYELRPNNAALTPVESRYEWQ
GLGB_BACWK      EQHKMLQ-VTEEGIWSLFVPHIEENEIYKYAIETMD-GDVILKADPYAVYAEVRPNTASVVFDIEGYEWN
GLGB_ANAVT      RKHQMRKGAT--GVWELFIPEIGVGEHYKYEIKNFAGHIYE-KSDPFGFQQEPRPKTASIVSNLNSYNWS
GLGB_BACC4      EQHKMLQ-VTEEGIWSLFIPHIEEGEIYKYAIETL-AGDVILKADPYAVYAEVRPNTASVVFDIKGYEWN
GLGB_SHEON      DTRHVMRQHVANGLWEIFLPGVVEGSHYKFDLVYQNGERHA-KSDPMATQMECAPHNASIVPKKQQHQWA
GLGB_NITEU      DGRVYMMVHGHSGVWELFIPDLPEGAIYKYEIRNRISGEILLKTDPYATTYELRPNNAALTPIEQKYDWK
GLGB_BACCR      EQHKMLQ-VTEEGIWSLFIPHIEEGEIYKYAIETL-AGDVILKADPYAVYAEVRPNTASVVFDIKGYEWN
GLGB_SYNJB      R-QHQMKRLGESGIWAVFIPGIGPGAIYKYEVKTSWGDIYE-KSDPYGFQQEVRPKTGSIVADLNTYTWH
GLGB_SHESR      DTRHVMRQHMANGLWEIFLPDVAEGAHYKFDLVYQNGERHA-KSDPMATQMECAPNNASIVPKKHQHPWA
GLGB_BACHK      EQHKMLQ-VTEEGIWSLFIPHIEEREIYKYAIETM-AGDVIFKADPYAVYAEVRPNTASVVFDIKGYEWN
GLGB_BACC3      EQHKMLQ-VTEEGIWSLFIPHIEEREIYKYAIETM-AGDVIFKADPYAVYAEVRPNTASVVFDIKGYEWN
GLGB_BACC0      EQHKMLQ-VTEEGIWSLFIPHIEEREIYKYAIETM-AGDVIFKADPYAVYAEVRPNTASVVFDIKGYEWN
GLGB_BACAN      EQHKMLQ-VTEEGIWSLFIPHIEEREIYKYAIETM-AGDVIFKADPYAVYAEVRPNTASVVFDIKGYEWN
GLGB_BACAC      EQHKMLQ-VTEEGIWSLFIPHIEEREIYKYAIETM-AGDVIFKADPYAVYAEVRPNTASVVFDIKGYEWN
GLGB_BACAA      EQHKMLQ-VTEEGIWSLFIPHIEEREIYKYAIETM-AGDVIFKADPYAVYAEVRPNTASVVFDIKGYEWN
GLGB_BACC2      EQHKMLQ-VTEEGIWSLFIPHIEEGEIYKYAIETL-AGDVILKADPYAIYAEVRPNTASVVFDIKGYEWN
GLGB_BACCZ      EQHKMLQ-VTEEGIWSLFIPHIEEREIYKYAIETM-AGDVIFKADPYAVYAEVRPNTASVVFDIKGYEWN
GLGB_SHESM      DTRHVMRQHMANGLWEIFLPDVAEGTHYKFDLVYQNGERHA-KSDPMATQMECAPHNASIVPKKHQHPWA
GLGB_HAES1      R-RHPMRFHQSSGIWELFLPKVSLGQLYKFELLDCH-NQLRLKADPYAFSSQLRPDTASQIGALPEIV--
GLGB_TRIEI      DGRKHQMRKGHTGVWELFIPDIGPGESYKYEVKNWEGHIYE-KSDPYGYQQEVRPKTASIVVDLDSYTWN
GLGB_MARAV      SGRHAMAVNNGYGVWSLFIPGVKAGHLYKFAITTRN-GHHITKTDPYGQAFEHRPSNAAVVTERGHYAWG
GLGB_PROMA      RHHPMQKRL--GGIWELFIPHIKKGDLYKYEIRSQEGHCYE-KADPYGFQHEVRPAQSSIVSTLDSYKWK
GLGB_MANSM      R-RHPMRFHPASGIWELFLPKVALGQLYKFELI--DSNNQLLKADPYAFAAQLRPDTASQVSALPEIV--
GLGB_SYNP6      DGRKHQMARRSNGIWELFIPELTVGAAYKYEIKNYDGHIYE-KSDPYGFQQEVRPKTASIVADLDRYTWG
GLGB_SYNE7      DGRKHQMARRSNGIWELFIPELTVGAAYKYEIKNYDGHIYE-KSDPYGFQQEVRPKTASIVADLDRYTWG
GLGB_HAES2      R-RHPMRFHQSSGIWELFLPKVSLGQLYKFELLDCH-NQLRLKADPYAFSSQLRPDTASQIGALPEIV--
GLGB_BACCQ      EQHKMLQ-VTEEGIWSLFIPHIEEREIYKYAIETM-AGDVILKADPYAVYAEVRPNTASVVFDIKGYEWN
GLGB_SHEB9      DTRHVMRQHLANGLWELFLPNVVEGAHYKFDLVYQNGERHT-KSDPMATQMECAPHNASIVPPKAHHSWN
GLGB_NITMU      ---GRIHPMVSSGVWELFIPGVPTDSFYKYEIRNRDTGAILLKTDPYARHYEVRPGTAARAPSASRMTWG
GLGB_SYNY3      RKRNNM-------VWELFIPELGVGTSYKYEIKNWEGHIYE-KTDPYGFYQEVRPKTASIVADLDGYQWH
GLGB_THICR      L-RHPMRTNGQSGVWELFIPGMVSGDIYKFEIRNYQTDQLLVKTDPYAKAMEFRPQTGSIVYDST-FQWQ
GLGB_SHEB8      DTRHVMRQHLANGLWELFLPNVVEGAHYKFDLVYQNGERHT-KSDPMATQMECAPHNASIVPPKAHHSWN
GLGB_CELJU      RH-HPMRVRGSSGLWELFIPGVQPGDLYKFEIRNRQTGAVFLKSDPYGQSFEHRPSTSSIITADSAFAWQ
GLGB_SHEB5      DTRHVMRQHLANGLWELFLPNVVEGAHYKFDLVYQNGERHT-KSDPMATQMECAPHNASIVPPKAHHSWN
GLGB_SHEB2      DTRHVMRQHLANGLWELFLPNVVEGAHYKFDLVYQNGERHA-KSDPMATQMECAPHNASIVPPKAHHSWN
GLGB_PROMP      RHHPMQKRL--GGIWELFMPIMKEGDAYKYEIRTQEGHIYE-KADPYGFLHEIRPQNGSIVSKLNNFDWE
GLGB_THIDA      R-RHPMRCRGVSGVWELFIPGLEAGHAYKYEILGRHGER-VTKTDPYARQMFLRPETTSRVPDERPYAWG
GLGB_GLOVI      RFHQMRRVERSTGIWELFIPELGEGTVYKFEIKNGFGHIYE-KSDPYAFQQELRPKSGSVVADLDRYSWN
GLGB_RHOBA      RG-HVAQPVESTGIWELFLPGATVGQKYKFRIQTQH-GHWMDKCDPMAFAAELPPLTANIITDINTYSWN
GLGB_RHORT      R-LHPMRAHPGSGVWDIFLPGVVEGHLYKYELLGPDGSLLPAKADPYAFQAEKPPHTASVVRGLGTYAWN
GLGB_AQUAE      GSTPMVKREDGSGIWEVLLEGDLTGSKYKYFI--KNGNYEVDKSDPFAFFCEQPPGNASVVW-KLNYRWN
GLGB_ACTP2      R-VNPMRFHAESGIWDIFLPNVEKGALYKFEILDSN-GNIRLKSDPYAFASQFRPDTASVVTGLPEKIEV
GLGB_BACCN      EKQHRMQKVTEAGIWSLFIPQXXXXXXXXXXXXXXN-GEVILKADPYATYAEVRPNTASVILDIEGYEWN
GLGB_DESHY      MNHS-LQKWEEQGIWTLFIPGLPTGEIYKYEILTSSGES-VLKADPYAFFSEVRPHTASVIYSLEDYSWG
GLGB_BACC1      EQHKMLQ-VTEEGIWSLFIPHXXXXXXXXXXXXTM-AGDVIFKADPYAVYAEVRPNTASVVFDIKGYEWN
GLGB_SYNS3      RYHPMQQRL--GGIWELFVPELEEGHFYKYEIRTQDGHCY-QKADPYGFQHEVRPDTSSIVSHLDGFQWN
GLGB_ACTPJ      R-VNPMRFHAESGIWDIFLPNVEKGALYKFEILDSN-GNIRLKSDPYAFASQFRPDTASVVTGLPEKIEV
GLGB_PASMU      R-RHPMRFHQKSGVWELFLPKASLGQLYKFELIDCH-GQLRLKADPYAFSSQLRPDTASQISALPEIV--
GLGB_BACC7      EQHKMLQ-VTEEGIWSLFIPHXXXXXXXXXXXXTT-AGDVIFKADPYAVYAEVRPNTASVVFDIKGYEWN
GLGB_ACTP7      R-VNPMRFHAESGIWDIFLPNVEKGALYKFEILDSN-GNIRLKSDPYAFASQFRPDTASVVTGLPEKIEV
GLGB_RUBXD      ---GRRHPMRNRGVWEIFLPGVGPGALYKYEIKDAGGSLLPLKADPYGFFAEQYPGTASIVWDLSRHRWE
GLGB_BACST      TNFNLMK-VSNQGVWMIFIPENLEGHLYKYEITTND-GNVLLKSDPYAFYSELRPHTASIVYNIKGYQWN
GLGB_HAEIN      R-RHPMRFHSKSGVWELFLPKASLGQLYKFELIDCH-GNLRLKADPFAFSSQLRPDTASQVSALPNVV--
GLGB_SACD2      R-AHVMRKHIPSGIWELFIPYLGEGALYKYEIRNHSGDCLPHKADPYGFAAQKPPEQASVVSVLDRYEWN
GLGB_PROM5      RHHPMQKRL--GGVWELFMPILKEGDVYKYEIRTQQGHIYE-KADPYGFLHEVRPQNGSIISKLNNFNWE
GLGB_SYNSC      RHHPMQQRV--GGIWELFVPGLEEGHLYKYEIRTQDGHCY-QKADPYGFQHEVRPDNSSVVARLNGFQWS
GLGB_HAEIG      R-RHPMRFHSKSGVWELFLPKASLGQLYKFELIDCH-GNLRLKADPFAFSSQLRPDTASQVSALPNVV--
GLGB_PARUW      K-VNPMRIMGYSGVWELFVPGLQEGEKYKFEIHTQQGER-ILKSDPYALSSELRPATASKIANIERFQWQ
GLGB_HAEI8      R-RHPMRFHPKSGVWELFLPKASLGQLYKFELIDC-YGNLRLKADPYAFSSQLRPDTASQISALPNVV--
GLGB_SYNPW      RHHPMQQRL--GGIWELFVPGLAEGQLYKYEIRTQEGHCY-QKADPYGFQHEVRPDTSSVVSHLDGFHWT
GLGB_PROM4      DGRHHPMQKRMGGIWELFIPGLKEGALYKYEIRTQNGHCYE-KSDPYGFEHEVRPAQSSKVSRIDNFKWS
GLGB_ACTSZ      R-RHPMRFHQASGVWELFIPKVALGDLYKFELLDNN-NRLRLKSDPYAFAAQLRPDTASQISVLPEI---
GLGB_METCA      R-RHPMRVRGASGVWELFIPELQPGLLYKFEIRNRAHGTIHLKSDPYGRQFELRPNTASIITRESGYAWN
GLGB2_RHIEC     R-RNPMRLRQSAGVWELFMPRLAPGERYKFEIIDPHGNCLPQKADPVARASEAAPSTASIVASSTRFRWT
GLGB_BACCL      TNSP-LTKVNDEGVWTIVVPENLEGHLYKYEIITPD-GRVLLKADPYAFYSELRPHTASIVYDLKGYEWN
GLGB_SHEFN      NKRHILRHHPASGLWDIFIAEVEPEQHYKYAISDMH-GNQVIKSDPYAVAMQPSPHNASKIPHVERYDWQ
GLGB_METFK      R-MHQMRVHGSSGVWEIFIPGLTSSDLYKFEIRNRQTGQILVKTDPYGFSFEQRPGTAARVTAHGHYAWQ
GLGB_PROMM      DGRHHPMQRRQGGLWELFIPGFKEGTLYKYEIRTQEGHCY-QKADPYGFQHEVRPATSSVVARLDRYQWQ
GLGB1_RHIEC     R-RHVMRFRADSGIWEIFAPDVPLGVAYKFEIRGHDGVLLPLKADPFARRSELRPKTASIAAAELEQVWE
GLGB_PROM3      DGRHHPMQRRQGGLWELFIPGFKEGTLYKYEIRTQDGHCY-QKADPYGFQHEVRPATSSVVARLDRYQWQ
GLGB_SYNS9      RHHPMQKRL--GGIWELFVPGLDAGTLYKYEIRSQEGHCY-QKADPYGFQHEVRPDNSSVVARLEGYSWS
GLGB_RHOFD      NVDRLDLRDDGSGIWQGFVENAVRGQGYKYRIQSSHGSYGVDKADPFAFYAEPPPATASRVWS-LEHDWK
GLGB1_RHIL3     R-RHVMRFRSDSGIWEIFAPDVPIGVAYKFEIRGQDGVLLPLKADPFARRSELRPKTASVTAAELEQEWE
GLGB_PSEPK      R-RHPMRLRHGAGVWELFIPRLGVGETYKFEVLGKD-GILPLKADPLARATELPPSTASKVAGELSHAWQ
GLGB_PROMT      RHHPMQKRL--GGIWELFIPGLSEGDLYKYEIRTEKGHCYE-KADPYGFQHEVRPAKSSVISKIDSFQWS
GLGB_AZOSE      DDAAVLRPRDDSGIWEGFVAGVAAGDVYKYSIVCQD-GRVAEKADPFAQYAEVPPATGSR-AWRSAHRWA
GLGB_RHIME      R-RHVMRLRVDTGIWEIFIPGVPVGTPYKYEIVDSNGTLLPLKADPFARRSELRPDTASMTADEIAQNWE
GLGB_RHOP5      DSRRHPMRVRGSGYWELFIPRATAGDHYKFEIVSAQGHLLPLKSDPMAFAAEMRPSTASIVLDPERVPHP
GLGB_CORDI      PSQYPMRSLGSTGIWELFIPNIGVGTVYKFAIHTHEGHR-LDKADPMAKRAEVAPATGSIIASSS-YTWN
GLGB_STRAU      VAYP-MRSLGASGVWELFLPGVAEGALYKYEITRPDGGRTL-RADPMARYAEVPPANASIVTA-SRYEWQ
GLGB_PROM1      RHHPMQKRL--GGIWELFIPGLSEGDLYKYEIRTEKGHCYE-KADPYGFQHEVRPAKSSVISKIDSFQWN
GLGB_CORJK      -NQHPLRALGSSGIWELWIPSVSAGAHYKFSITTGDGVR-LDKADPMARLAEPAPATASIVVADSDYAWG
GLGB_ERWCT      R-RHPMRLRKENGIWELFLPDVKAGQLYKYEMIDSH-GSVRLKADPYAFEAQMRPDTASLITPLPEKVPT
GLGB_BACSU      EE-HVMHRVNDNGIWTLFIPGIGEKERYKYIVTNN--GEIRLKADPYAIYSEVRPNTASLTYDLEGYSXX
GLGB2_STRCO     GTAFPMRSLGSSGVWELFLPGVGEGTRYKFEIHSRYGHRFL-KADPMARAAEEPPNTASVVTA-SRYEWG
GLGB_SYNR3      RHLPMQQRI--GGIWELFVPGLGAGAHYKYEIHTQQGHCYE-KADPYGFQHEVRPAQASVVASLKGYQWG
GLGB_MESSB      R-RHQMRLHPGIGVWEIFVPGAKPGNLYKYEIIGRNGELLPPKADPVGFRAEVPPATASVVNGLPQMEWG
GLGB_ALHEH      RC-HPMRVRGGSGVWELFIPGLPDGSLYKFELRNRDSGAVLVKTDPYGRRYQLRPDSAAVVEPPADYAWN
GLGB1_XANCP     R-RHPMRLRHQAGVWELFVPDVGPGAHYKYQLRGPHGHELPAKADPVARRAELAPGTASIVADPTPHQWS
GLGB1_XANC8     R-RHPMRLRHQAGVWELFVPDVGPGAHYKYQLRGPHGHELPAKADPVARRAELAPGTASIVADPTPHQWS
GLGB1_STRAW     TAFP-LRSLGSSGVWELFVPGVGEGELYKFEITRPDGSKTL-RADPVARRTEAPPRTSSIVHA-SHYAWA
GLGB_NEIDE      R-RHAMRPHTGNGLWDIFIPGVGLNALYKFSVLDAN-GNIREKADPYAFGAELRPTTASVVRGLPAKAEA
GLGB_MYXXD      R-LHSMRRMGSSGIWELFVPEVGEGTRYKFEIRPGQGGPNVLKADPFAFRTEVPPATASVVHDLARYTWG
GLGB1_XANAC     R-RHPMRLRHQSGVWELFVPDVGPGAHYKYQLRGPHGHELPAKADPVARRAELAPGTASIVADPTPHQWS
GLGB_AGRT5      R-RHVMRFRKDTGIWEIFAPDVYAGCAYKFEILGANGELLPLKADPYARRGELRPKNASVTAPELTQKWE
GLGB_SYNPX      RHHPMQQRL--GGIWELFIPGLAEGSLYKYEIRTQDGHCY-QKADPYGFQHEVRPDNSSVVARLDGFQWS
GLGB_ECOL6      R-RHPMRLRKESGIWELFIPGAHNGQLYKYEMIDAN-GNLRLKSDPYAFEAQMRPETASLICSLPEKVVQ
GLGB_DESVV      EGCPLF-PVGVSGVWAAFVPGVRRGSLYKFVVRGAD-GRQEQKADPFALWAEMRPGVASVAWDIDNHAWG
GLGB_CORGL      S-QHPMRSMGGSGLWELFIPGIEEGEVYKFAVQTREGQRRD-KADPMARRAELAPATGSIVAS-SEYQWQ
GLGB_ECOUT      R-RHPMRLRKESGIWELFIPGAHNGQLYKYEMIDAN-GNLRLKSDPYAFEAQMRPETASLICGLPEKVVQ
GLGB_ECOK1      R-RHPMRLRKESGIWELFIPGAHNGQLYKYEMIDAN-GNLRLKSDPYAFEAQMRPETASLICGLPEKVVQ
GLGB_ECO57      R-RHPMRLRKESGIWELFIPGAHNGQLYKYEMIDAN-GNLRLKSDPYAFEAQMRPETASLICGLPEKVVQ
GLGB_SHIF8      R-RHPMRLRKESGIWELFIPGAHNGQLYKYEMIDAN-GNLRLKSDPYAFEAQMRPETASLICGLPEKVVQ
GLGB_ERWCH      R-RHPMRRRRENGVWELFVPGVGPGQLYKFEIIDC-YGNVLVKSDPYAFESQMRPDTASVVSRLPPALPV
GLGB_SHIFL      R-RHPMRLRKESGIWELFIPGAHNGQLYKYEMIDAN-GNLRLKSDPYAFEAQMRPETASLICGLPEKVVQ
GLGB_ECOL5      R-RHPMRLRKESGIWELFIPGAHNGQLYKYEMIDAN-GNLRLKSDPYAFEAQMRPETASLICGLPEKVVQ
GLGB_DESVH      EGCPLF-PVGVSGVWAAFVPGVRRGSLYKFVVRGAD-GRQEQKADPFALWAEMRPGVASVAWDIDNHAWG
GLGB_BRAJA      DSRRHPMRVRGSGYWELFIPHAKRGDHYKFDIVGPHGHQLPLKSDPMAFASEVRPKTASIVFDEAHLP--
GLGB_RHOS1      R-RHPMRKRIGVGVWELFVPGLHTGDLYKYEILGPSGERLPLKSDPLSFAQEAPPATASVVHGLPEAEWH
GLGB_SHISS      R-RHPMRLRKESGIWELFIPGAHNGQLYKYEMIDAN-GNLRLKSDPYAFEAQMRPETASLICGLPEKVVQ
GLGB_PROM9      RHHPMQKRL--GGIWELFMPTMEEGDTYKYEIRTQQGHIYE-KADPYGFLHEIRPQNGSIVSKLKNFNWN
GLGB_ECOLI      R-RHPMRLRKESGIWELFIPGAHNGQLYKYEMIDAN-GNLRLKSDPYAFEAQMRPETASLICGLPEKVVQ
GLGB_ECOLC      R-RHPMRLRKESGIWELFIPGAHNGQLYKYEMIDAN-GNLRLKSDPYAFEAQMRPETASLICGLPEKVVQ
GLGB_ECOHS      R-RHPMRLRKESGIWELFIPGAHNGQLYKYEMIDAN-GNLRLKSDPYAFEAQMRPETASLICGLPEKVVQ
GLGB_ECO24      R-RHPMRLRKESGIWELFIPGAHNGQLYKYEMIDAN-GNLRLKSDPYAFEAQMRPETASLICGLPEKVVQ
GLGB_RHOS4      R-RHPMRKRIGVGVWELFVPGLHTGDLYKYELLGPSGERLPLKSDPLSFAQEAPPATASVVHGLPEAEWH
GLGB_COREF      S-QHAMRSLGGSGIWELFIPNIGPGEVYKFAIQTREGHRRD-KADPMARLAELPPATGSIVV-ESDYQWQ
GLGB2_RHIL3     R-RNPMRLRPSAGVWELFIPRLAPGERYKFEIVDAEGTCLPQKADPVARASEAAPSTASIVASSTPFRWT
GLGB_YERPS      R-RHPMRLRRENGIWELFLPGIEAGQLYKFEII--DCHGQVLKADPYAFEAQMRPETASLISPLPDVVKS
GLGB_YERPP      R-RHPMRLRRENGIWELFLPGIEAGQLYKFEII--DCHGQVLKADPYAFEAQMRPETASLISPLPDVVKS
GLGB_YERPN      R-RHPMRLRRENGIWELFLPGIEAGQLYKFEII--DCHGQVLKADPYAFEAQMRPETASLISPLPDVVKS
GLGB_YERPE      R-RHPMRLRRENGIWELFLPGIEAGQLYKFEII--DCHGQVLKADPYAFEAQMRPETASLISPLPDVVKS
GLGB_YERPA      R-RHPMRLRRENGIWELFLPGIEAGQLYKFEII--DCHGQVLKADPYAFEAQMRPETASLISPLPDVVKS
GLGB_PROAC      DR---MRLIPGSGVWGTFVEGVDEGTLYKFRIQDQ-WGTWHEKVDPMARYSEQAPQNASIVT-ETHYEWN
GLGB_LACS1      -DKSHPMILDESGIWSIEVKESRENQYYKYLVKQANGRE-IMKTDPMAQVYEKRPETAAVVKELEPFKWN
GLGB_SHIDS      R-RHPMRLRKESGIWELFIPGAHNGQLYKYEMIDAN-GNLRLKSDPYAFEAQMRPETASLICGLPEKVVQ
GLGB_YERP3      R-RHPMRLRRENGIWELFLPGIEAGQLYKFEII--DCHGQVLKADPYAFEAQMRPETASLISPLPDVVKS
GLGB_SHIBS      R-RHPMRLRKESGIWELFIPGAHNGQLYKYEMIDAN-GNLRLKSDPYAFEAQMRPETASLICGLPEKVVQ
GLGB_BACLD      V-LHRMEKRHQEGIWELFIPGIGEGELYKYEMITA-ANETKLKADPYAFFSEVRPKTASVTYQLAGYQWG
GLGB1_XANC5     R-RHPMRLRHQAGVWELFVPDVGPGAHYKYQLRGPHGHELPAKADPVARRAELAPGTASIVADPTPHQWS
GLGB_RHOP2      -PRRHQMRVRGNGYWELFIPGATAGDHYKFDMTGPNGETLPQKSDPMAFAAEMRPKTASIVVDQTRLP--
GLGB_FRASC      DGRAFMRSLGRSGIWELFVPGAGTGARYKYEILGFD-GIWRQKADPLAFHTEVPPATASVVFA-SDFTWN
GLGB_PSE14      R-RHPMRLRHPTGVWEIFVPRLQPGEVYKYEILGAH-GILPLKSDPMALATTLPPDTASKVSAPLQFEWN
GLGB_RHOPB      -PRRHPMRVRGSGYWELFVPRALAGDHYKFDIIGPHGQQLPLKSDPLAFAAEMRPDTASVVVDPARLSHP
GLGB_FUSNN      REEDYCHKLTNEGIWEVEIKKIKKGNLYKYQIETS-WGEKILKSDPYAFYSELRPQTASIVNGKPKFRWA
GLGB1_XANOR     R-RHPMRLRHQSGVWELFVPDVGPGAHYKYQLRGPHGHELPAKADPVARRAELAPGTASIVADPTPYQWS
GLGB_SALAR      R-RHPMRLRKESGIWELFIPGAHNGQLYKFELLDANGNLRI-KADPYAFEAQMRPETASMICGLPEKVTQ
GLGB_PSEF5      R-RHPMRLRHPSGVWELFIPRLQAGEAYKYEILGPQ-GILPLKADPMALATQLPPDTASRVAPPLTIDWQ
GLGB_MYCPA      TEAP-MRVLGSSGVWELFWPDFPIGGLYKFKVHGAD-GVVTERADPMAFATEVPPHTASRVTLSS-YTWG
GLGB_PSEU2      R-RHPMRMRHPTGVWEIFVPRLQPGEVYKYEILGAH-GILPLKSDPMALSTTLPPDTASKIAAPLQFEWN
GLGB_RHOPS      -PRRHQMRVRGNGYWELFVPGAAAGDHYKFDVVGPHGEQLPQKSDPMAFAAELRPKTASIVVDQTRLPQP
GLGB_BURXL      R-RHPMRLRHQAGVWELFVPRVGPGTRYKYELLSRDGHPLPLKADPCAMQTEKPPGTASIVAEVEQFPWS
GLGB2_XANOM     R-RHPMRLRHQSGVWELFVPDVGPGAHYKYQLRGPHGHELPAKADPVARRAELAPGTASIVADPTPYQWS
GLGB_YERE8      R-RHPMRLRRENGIWELFLPGVQAGQLYKFEII--DCHGQVLKADPYAFKAQMRPETASLISPLPDVVEN
GLGB_SALPB      R-RHPMRLRKESGIWELFIPGAHNGQLYKFELLDANGNLRI-KADPYAFEAQMRPETASMICGLPEKVTP
GLGB_SALPA      R-RHPMRLRKESGIWELFIPGAHNGQLYKFELLDANGNLRI-KADPYAFEAQMRPETASMICGLPEKVTP
GLGB_THEFY      TG-HPMRSLGSCGVWELFIPGVGDGTRYKYQVLGAD-GVWREKADPVAFATQAPPETASVVFT-SRYTWQ
GLGB_PSESM      R-RHPMRLRHPTGVWEIFVPRLQPGEVYKYEILGAH-GILPLKSDPMALATTLPPDTASKISAPLKFEWH
GLGB_SALTI      R-RHPMRLRKESGIWELFIPGAHNGQLYKFELLDANGNLRI-KADPYAFEAQMRPETASMICGLPEKVTP
GLGB_SALCH      R-RHPMRLRKESGIWELFIPGAHNGQLYKFELLDANGNLRI-KADPYAFEAQMRPETASMICGLPEKVTP
GLGB_SALTY      R-RHPMRLRKESGIWELFIPGAHNGQLYKFELLDANGNLRI-KADPYAFEAQMRPETASMICGLPEKVTP
GLGB_MYCSS      NEAQ-LRVLGSTGVWELFWPDFPVDGLYKFRIHGAD-GVVSERADPMAFATEVPPQTASRVTTSS-YTWN
GLGB_MYCSK      NEAQ-LRVLGSTGVWELFWPDFPVDGLYKFRIHGAD-GVVSERADPMAFATEVPPQTASRVTTSS-YTWN
GLGB_CITK8      R-RHPMRLRKESGIWELFIPGAQHGQLYKFEMIDAHGKLRI-KADPYAFEAQMRPETASLICGLPEKVVQ
GLGB_VIBPA      DGRRHPMQRLDYGIWGLFIPGLEEGVQYKFELKGPNGEGLPHKQDPWGFYSEQYPSFASITYDHKRYQWQ
GLGB_MAGSA      R-RHPMRLRHEAGMWEIFIPGLGQGAVYKYEIVASDGRLLPLKADPYGHFAEVPPKTASVVWELGXXXXX
GLGB_RHOSR      -GRNYMRVLGSTGVWELFVPGIEAGDLYKFRVHGPD-GSVRDKADPMAFATEVPPATASRVSVST-YEWN
GLGB_MYCSJ      NEAQ-LRVLGSTGVWELFWPDFPVDGLYKFRIHGAD-GVVSERADPMAFATEVPPQTASRVTTSS-YTWN
GLGB_DESDG      GDFPLF-PVGTSGIWAGFVAGMEYGRLYKFAVQGAD-GTVRLKTDPYALYCEMRPGTASFTWSLDSYAWN
GLGB_NITWN      DRRRHPMRVRGNGYWELFIPGARAGDRYKFAITAQDGSLLPLKSDPMAFAAEVRPNTASIIFDQARLP--
GLGB_BRASO      --RRHPMRVRGNGYWELFIPRARAGDHYKFDIIGPQGEHLPLKSDPMAFAAEMRPKTASIVVDETRLP--
GLGB_BIFLO      R-RHAMRELGSSGVWEIFIPGIGAGETYKFQILNA---NYTWKADPMERQHEVPPSTASIVT-ESTYKWN
GLGB_RHILO      R-RHTMRDRRDTGIWEVFIPDIGAGRPYKYEIIGPDGVRLPLKADPFAFKSELRXXXXXXXXXXXXHDWG
GLGB_PSEPF      R-RHPMRLRHPSGVWELFIPRLQAGELYKYEILGAH-GILPLKADPMALATSLPPDTASKVASPLQIDWQ
GLGB_LACAC      -DKSLEMSQTLDGVWEIKTSLPKEGQLYKFLVKQADGRE-VMKIDPMAFELEPRPGSAAVIVKLPNKKWL
GLGB_DECAR      GDVHQLHPLGESGVWEIAVAEAHTGNLYRFEITNRHTGDKLIKSDPYGRGFELRPGSAAYVVPPSMHVWG
GLGB_SERP5      R-RHPMRLRRENGIWELFLPGVKAGQLYKYEIIDCYGNTQL-KADPYAFEAQMRPDTASLVTPLPEVVEN
GLGB_GRABC      RC-HPMRKRVEAGVWELFIPGLTAGTIYKYXXXXXXXXXXXXKADPVAWYAEIPPATASIVASPAPFQWT
GLGB_MYCBP      HEAP-MRVLGPSGVWELFWPDFPCDGLYKFRVHGAD-GVVTDRADPFAFGTEVPPQTASRVTS-SDYTWG
GLGB_MYCBO      HEAP-MRVLGPSGVWELFWPDFPCDGLYKFRVHGAD-GVVTDRADPFAFGTEVPPQTASRVTS-SDYTWG
GLGB_KLEP7      R-RHPMRFRKESGIWELFVPGAHNGQLYKFELIDAHGNLRV-KADPYAFESQMRPESASLICDLPPKV--
GLGB_BRASB      --RRHPMRVRGNGYWELFIPRAKAGDHYKFDIIGPQGEHLPLKSDPMAFAAEMRPKTASIVVDETRLP--
GLGB_PROM2      RHHPMQKRL--GGIWELFMPTMKEGDTYKYEIRTQQGHIYE-KADPYGFLHEIRPQNGSIVSKLKNFXXX
GLGB_PROM0      RHNPMQKRL--GGIWELFMPMMKEGDKYKYEIRTQQGHIYE-KADPYGFLHEVRPQNGSIVSKLKNFXXX
GLGB_STRSV      EQIPMVR--NEAGVWEVFTELPKEGDIYKYNI-KRSSGQEILKIDPLAIYLEERPGTGAVIRTISEKKWK
GLGB_RHOPA      -PLRHQMRVRGSGYWELFVPGARAGDHYKFDLAGPNGEQLPQKADPLAFAAELRPKTASIVVDATTLP--
GLGB_PROMS      RHHPMQKRL--GGIWELFMPSMQEGDTYKYEIRTQQGHIYE-KADPYGFLHEIRPQNGSIVSKLKNFXXX
GLGB_CHLFF      L-VNPLRKVSDSGVWELFIPGLDEGTLYKWEIVSA-SGEILIKTDPYGKGFDVPPLATSRVINSDRYVWH
GLGB_CHLPN      L-VNPLRKISDQGIWELFVPGLGEGIRYKWEIVTQ-SGNVIVKTDPYGKSFDPPPQGTARVADSESYSWS
GLGB_VIBF1      DGRRHIMQRIDNGLWALFIPEHAVGTKYKFELKGPNGESLPHKMDPYGAHNEQYPSFASVVYDQTSYQWN
GLGB_STRGC      -ENQIPMARNEAGVWEVFTDLPKEGDIYKYNV-KRSSGQEILKIDPLAVYLEERPGTGAVIRTIPEKKWK
GLGB_MYCTU      HEAP-MRVLGPSGVWELFWPDFPCDGLYKFRVHGAD-GVVTDRADPFAFGTEVPPQTASRVTS-SDYTWG
GLGB_MYCTA      HEAP-MRVLGPSGVWELFWPDFPCDGLYKFRVHGAD-GVVTDRADPFAFGTEVPPQTASRVTS-SDYTWG
GLGB_STRR6      ENQIPMVR-NDFGVWEVFTNMAQEGHIYKYHVTRQN-GHQLMKIDPFAVRYEARPGTGAIVTELPEKKWK
GLGB_STRP2      ENQIPMVR-NDFGVWEVFTNMAQEGHIYKYHVTRQN-GHQLMKIDPFAVRYEARPGTGAIVTELPEKKWK
GLGB2_STRAW     AAFP-MRSLGSSGVWELFVPGIGEGELYKFEITRPDGTHTV-RADPMARRAEVPPATASIVT-ESSYAWA
GLGB_STRPN      ENQIPMVR-NDFGVWEVFTNMAQEGHIYKYHVTRQN-GHQLMKIDPFAVRYEARPGTGAIVTELPEKKWK
GLGB_STRMU      -DNPLQMDKNEAGVWEVFTDLPKEGHIYKYLV-KRQGGQIVEKMDPFAIYLEERPGTGSLIRTIPEKKWK
GLGB_RHIRD      R-RHVMRFRKDTGIWEIFAPDVY-ACAYKFEILGANGELLPLKADPYARRGELRPKNASVTAPELTQKWE
GLGB_BURTA      R-VHAMRKRIECGVWELFVPGVGCGALYKFALRTRDGDRLL-KADPYARRTEAPPRTASRICAPSAFGWR
GLGB_LEIXX      GTLHSLRNMGSSGVWELFVPGVGEGAIYKFDLLAQ-SGDWVRKIDPMAQLAETPPDTASRIAV-SRHEWQ
GLGB_BUTFI      ENAHQMKRSKTGNIWTLFIPGVAIGALYKFLITAQDGRK-LYKADPYANYAELRPGNASRTTDLSGFKWS
GLGB_MYCUA      SEAP-MRVLGSSGVWELFWPDFPADGLYKFRVHGAD-GVVSERADPFAFGTEVPPQTASRVTV-SDYSWG
GLGB_DEIGD      FDHPMQR--LDFGFWGAFVPSARPGQRYKFRVTGADGRT-VDKMDPYGAFTEVRPNTASIIWP-LAFEWT
GLGB_NITHX      DRRRHPMRVRGNGYWELFIPGAQTGDRYKFAITDKSGSLLPLKSDPMAFAAEVRPNTASIVVDEXXXXXX
GLGB_CHLCV      L-VNPLRKVSDSGVWELFIPGLDEGTLYKWELVTA-SGEVLIKTDPYGKGFDIPPQVTSRVINSDRYTWH
GLGB_ENT38      R-RHPMRLRRESGIWELFIPGAHNGQLYKFEMIDAHGKLRV-KADPYAFEAQMRPATASLICGLPEKVVQ
GLGB_NOCFA      NTAP-MRALGTSGVWEVFVPDVGSGTKYKYRVHGAD-GRVVDHADPLAFATELPPATASVVTG-SDYTWQ
GLGB_VIBCH      DGRRHPMQRLDYGIWGIFIPGLPEGTQYKFELKGPHGEGLPHKADPWGFYAEQYPSFASVTYDHRRYQWQ
GLGB_STRA3      -NRPLQMNKNQAGVWEANSLDAREGDLYKYLVTRKG-GQVVEKIDPMAVYMERRPGTASVIKVLRNKKWE
GLGB_STRA5      -NRPLQMNKNQAGVWEANSLDAREGDLYKYLVTRKG-GQVVEKIDPMAVYMERRPGTASVIKVLRNKKWE
GLGB_STRA1      -NRPLQMNKNQAGVWEANSLDAREGDLYKYLVTRKG-GQVVEKIDPMAVYMERRPGTASVIKVLRNKKWE
GLGB_CHLAB      L-VNPLRKVSDLGVWELFIPGLEEGTLYKWEIVSA-SGEVLIKTDPYGKRFDVPPHAPSRVVDSDRYTWH
GLGB1_STRCO     TG-HPMRSLGSTGVWELFLPGVGAGELYKFEITRPDGSR-TFRADPLARRTEVPPATSSVVHA-SDYTWG
GLGB_PSEA6      SCLPMQK--TDFGYWVLVVPGVKAGDKYKYQIKDAHGNELPHKADPVGFYAEQYPSHASVVF-DHEXXXX
GLGB_VIBVU      DGRRHPMQRLDYGIWGLFIPDLAEGVSYKFEMKGPKGEGLPHKADPWGFYAEQYPSFASVTYDHARYQWQ
GLGB_RALEJ      A-RHPMRLRHPSGVWELFIPEARPGCRYKFDLLDPHDAQLPDKXXXXXXXXXXXXXXXSVVTSAPPFAWQ
GLGB_BURCM      R-RHPMRLRRPWGVWELFVPGIGAGEHYKYELRAADGHVLPHKADPCARATEAPPRTASVVADTAAFAWH
GLGB_CHLT2      L-VNPLHKVSDQGVWELFVPGLTAGACYKWEMVT-ESGQVLIKSDPYGKFFGPPPRSVSVVIDDS-YEWN
GLGB_DEIRA      FDHPLQR--LDFGFWGAFVPAAQPGQRYKFRVTGAGGQT-VDKTDPYGTFFEVRPNNASIIWQQ-DFEWT
GLGB_CHLTB      L-VNPLHKVSDQGVWELFVPGLTAGACYKWEMVT-ESGQVLIKSDPYGKFFGPPPRSVSVVIDDS-YEWN
GLGB_CHLTA      L-VNPLHKVSDQGVWELFVPGLTAGACYKWEMVT-ESGQVLIKSDPYGKFFGPPPRSVSVVIDDS-YEWT
GLGB_VIBVY      DGRRHPMQRLDYGIWGLFIPGLTEGVSYKFEMKGPKGEGLPHKADPWGFYAEQYPSFASVTYDHARYQWQ
GLGB_PHOPR      DGRRHPMQRLDDGLWGLFIPDLEDGTQYKFELKDSSGNSLPHKADPWGYSSEQYPSFTSIVYDQSRYQWQ
GLGB_SALRD      LDRR------EGGLWEGYVRGAQPGDKYKYHL--RAGGEWFDRTDPYAFRMEPAQNTSALITDLDTYTWG
GLGB_PSEA7      R-RHPMRRRYPSGVWELFIPRLGAGELYKYELQGHXXXXXXXXXXXXXX-CETPPGTASKTCAALRHEWR
GLGB_CHLTR      L-VNPLHKVSDQGVWELFVPGLTAGACYKWEMVT-ESGQVLIKSDPYGKFFGPPPWSVSVVIDDS-YEWT
GLGB_PSEAE      R-RHPMRRRYPSGVWELFVPRLGEGELYKYELQGHD-GXXXXXXXXXXXXCETPPGTASKTCAALRHEWR
GLGB_RHOMR      E-ANPLERY-GGGLWAGYVPGARPGHTYKYRIRHGFYQ--ADKTDPYAFAME--PPTGSSIITRLDYTWH
GLGB2_XANCP     EPRRHPMRQRSGGIWELVLPRVETGARYKYAIITAD-GRVLLKADPVARQSELPPATASVVASADAFAWT
GLGB2_XANC8     EPRRHPMRQRSGGIWELVLPRVETGARYKYAIITAD-GRVLLKADPVARQSELPPATASVVASADAFAWT
GLGB_ROSDO      R-RMMMRQRGATGVWEIFVPXXXXXXXXXXXXXAPDGSLLPQKADPVGFGAEHPPRTGSVVRKIDGYAWD
GLGB_NOVAD      HRRHPMRRRADIGVWEIFIPDIGEHRAYKYRIVGHDGGVLPLKADPYALAAEFRPSTASLTAHPVKMXXX
GLGB_CHLMU      L-VNPLHKVSDQGVWELFVPGLTAGSCYKWEIVTA-SGQVLIKSDPYGFFGS--PPQXXXXXXXXRYEWG
GLGB_BURVG      R-RHPMRLRRPWGVWELFVPGIGPGEHYKYELCAADGSLLPHKADPCARATEAPPRTASVVADTAAFGWH
GLGB_BURCH      R-RHPMRLRRPSGVWELFVPGIGAGERYKYELCAADGRVLPHKADPCARATEAPPRTASVVADVAAFAWH
GLGB_BURCA      R-RHPMRLRRPSGVWELFVPGIGAGERYKYELCAADGRVLPHKADPCARATEAPPRTASVVADVAAFAWH
GLGB2_XANOR     RRHPMRQRI--GGFWELFLPRVEAGPRYKYAVTAAD-GRVLLKADPVARQTELPPATASVVPGTDTFAWT
GLGB1_XANOM     RRHPMRQRI--GGFWELFLPRVEAGPRYKYAVTAAD-GRVLLKADPVARQTELPPATASVVPGTDTFAWT
GLGB_RALSO      R-RHPMRLRHGTGVWELFVPGAGPGSRYKFELVGAD-GHLLVKADPVARRTEAPPATASVVADPLPFRWS
GLGB2_XANAC     RRHPMRQRI--GGFWELFLPRVDAGARYKYAVTAAD-GRVLLKADPVARQTELXXXXXXXXXXXXXFAWT
GLGB_LACPL      --PSALKLLGATGIWQGQVPNVHAGQLYKFQITTP-TGQVQLKIDPFAQQFERKPGDAAVVVEPMTMRWH
GLGB_RALEH      A-RHPMRLRHPSGIWELFIPGAQPGSRYKYDLLDPHGTELPDKXXXXXXXXXXXXXXXSVVAGPGQFAWH
GLGB_JANSC      TE---MTAVGQTGVWQVRIPGVGDGALYKYQIT--DANGALRKADPVGFGAQHPPEQASVVRDIRGYGWR
GLGB_PICTO      PGMHPMINVNDSGIWALFIPGIKENEVYKFAIKTKN-NEIKMKTDPFAFYTEKRPRTGSIVIND-DFHWT
GLGB_BURP6      R-RHPMRLRRPWGVWELFVPRIGAGERYKFALRARDGAALPLKADPCACRTEAPPRTASIVAALERFGWH
GLGB2_XANC5     RRHPMRQRI--GGFWELFLPRVEAGARYKYAVTAAD-GRVLLKADPVARQTELXXXXXXXXXXXXXXXXX
GLGB_BURPS      R-RHPMRLRRPWGVWELFVPRIGAGERYKFALRARDGAALPLKADPCACRTEAPPRTASIVAALERFGWH
GLGB_BURP1      R-RHPMRLRRPWGVWELFVPRIGAGERYKFALRARDGAALPLKADPCACRTEAPPRTASIVAALERFGWH
GLGB_BURP0      R-RHPMRLRRPWGVWELFVPRIGAGERYKFALRARDGAALPLKADPCACRTEAPPRTASIVAALERFGWH
GLGB_BORBR      R-RHAMRLRYPAGVWELFLPDVGPGARYKFQVLGADGHT-VLKADPLARQAEAPPATASIVPDERPFAWT
GLGB_BORPA      R-RHAMRLRYPAGVWELFLPDVGPGARYKFQVLGADGHT-VLKADPLARQAEAPPATASIVPDERPFAWT
GLGB_BORPE      R-RHAMRLRYPAGVWELFLPDVGPGARYKFQVLGADGHT-VLKADPLARQAEAPPATASIVPDERPFAWT
GLGB_BURS3      R-RHPMRLRRPSGVWELFVPGIGAGECYKYELRAADGRVLPHKSDPCARATEAPPRTXXXXXXXXXXXWH
GLGB_DICDI      ERDNY-------GRWSIFIPNNSNGEKIK-IYLKLANGNFDYRIP--AWIKRVEQTKENPVFDGV--FWN
GLGB_CRYNE      ---HTANPMTKSGVWECYVPPVSPG----VCAIPHDSMVKISMTLPGGESIDRIPTWITRVTQDLNISWN
GLGB_HUMAN      FSYPYKK--LDYGKWELYIPPKQNGSKLKVVITSK-SGEILYRISPWAKYVVREGDNVNYDWIH----WD
GLGB_YARLI      DRQQYHMTRDEYGLWSVTVPPTSDGQNSKVKLALKTSNGQWVDRLP-AWSTYVVQDLSKSPIYEAVF-WN
GLGB_FELCA      FSYPYKK--LDYGKWELYIPPKQNGSKLKVVIRSK-SGEILYRISPWAKYVTREGENVNYDWTH----WD
GLGB_MOUSE      FSHPYKK--LEYGKWELYIPPKQNGSKLKVVITSK-SGEILYRISPWAKYVVRENNNVN-------YDWP
GLGB_HORSE      FSYPYKK--LDYGKWDLYIPPKPNGSKLKVVIRSK-SGEILYRISPWAKYVVRESGNVNYDWIH----WD
GLGB_GLOIN      RSKHPMKK-DSFGVWEVHIP-AKNG----IPTIPHNTKIKISMTTPEGECIDRLPAWIKRVTQDLNVSWN
GLGB_ASPOR      T----AHPMTKNGVWEVTVP-AVNGAKISMVIPSGER---IYRIPAWI---KRVVQDLSVSPTYEAVFWN
GLGB_EMENI      K----ANPMTNFGVWEIALP-AKNGTKVKITMVTR-SGERIYRIPAWIKRVVQDLNVSPIYESVFWNPPK
GLGB_CANGA      EESHEMKHKDEFGVFSITLAPLENGD---FAIPHDSKIKVMFVSKVYRIPAWITRATQPSKETAQKYTYE
GLGB_YEAST      TSHE-LKNKDEFGNFTITLHPLPNGD---FAIPHDSKIKVMFGSKIFRLPAWITRATQPSKETSKQFGWN
GLGB_DEBHA      -NTHKLKPVNDFGLWSLTIKPTENNERYKISMVTA-SGERIYRLCPW--LKRATPSTENNLY-EGRF-WN
GLGB_ASHGO      ETSHELQNKDEFGVFTVFGPGA-DGD---FMIPHDSRVKVVFELADGSRIHRLPAKRATQPSKETAKEWS
GLGB_KLULA      ENANEMQR-DEYGIFTTVVPPVDSGNKQYGIPHDSKVKVCFQLADGSRIY-----RLPAWITRATQPDKE
GLGB_MAIZE      NADRMSK--NEFGVWEIFLPNNADGTSPSRVKVRMDTPSGIKDSIP-AWIKYSVQAPGEIPYDGIYYDPP
GLGB_SOLTU      -GSNHMMEKDQFGVWSIRIPDVDS----KPVIPHNSRVKFRFKHGNGVWVDR--------IPAWIKYATA
GLGB_ORYSJ      A-KHKMEK-DKFGIWSIKISHV-NG---KPAIPHNSKVKFRFRHGGGAWVDRIPARYATFDASKFGAPYD
TREZ_ARTSQ      QRRAETGP-EDAGWWTAAGAPTDGNVDYGYLLDGDETP----LPDPRTRRQPDGVHALSRTFDPSAYSWQ
PULA_BACSU      SGRTFQMTRLEKGVYAVTVTGDLHGYEYLFCICNN--SEWMETVDQYAKAVTVNGEKGVVLRPDQMKWTA
TREZ_BREHE      QKK---ETAPGSEGWWTASDAPPNGDDYGYLLDGNTTP----VPEPRSRRLPAGVHNHSRTYNPPPYRWQ
TREZ_MYCTU      ----------------------------------------------------------------------
ISOA1_ARATH     TEEIQLDPSRNGHVWHVFL----RGDGYRFDGKFSPEEGHYYDSDPYAKFGVLGPDACMVPTREEEFDWE
TREZ_RHIS1      GRRPGNGP-ADEGWWTAADAPTGADVDYGYLLDGDE----IPLPDPRTRRQPEGVHALSRTFDPGAHRWQ
PULA_THEMA      VNMEYK----GNGVWEAVVEGDLDGVFYLYQLENYGKIRTTV--DPYAVYANSKKSAVVNLARTNPEGWE
GLGX_HAEIN      -QETRLPMVRTENVWHLAVTGVKTGTEYAFRIHGEFANPQKLILDPYAKAVNGKPDLSS----EESRSWR
TREZ_ARTRM      GQGRAELPLTENGWWALQQPWDGGPDDYGYLVDGKG---------PFADPRSLRPRGVHELGREARYAWG
NEPU_BACST      ----------------------------------------------------------------------
GLGX_MYCTU      ESRIPLDEV-DGYVWHAYLPNITPGQRYGFRVHGPFDPAAGHRCDPYSYVNAVDPDSTPPMVDSLGHTMT
GLGX_MYCBO      ESRIPLDEV-DGYVWHAYLPNITPGQRYGFRVHGPFDPAAGHRCDPYSYVNAVDPDSTPPMVDSLGHTMT
CDAS_THEP3      ----------------------------------------------------------------------
AMYB_PAEPO      ----------------------------------------------------------------------
GLGX_YERE8      QELRIPLPARSGDIWHGYLPGGKPGQRYGYRVSGPFNNPHKLLIDPYARALDRKVDSAAVIVVHEEYDWQ
ISOA3_ARATH     DDDGMIELVLDPSV-------NKTGDTWHICVEDLPLNNVLYGYDPYASFGDSSQKFAQFYGTSSPFDWG
O16G3_BACSU     ----------------------------------------------------------------------
MALT_SCHPO      ----------------------------------------------------------------------
GLGX_ENT38      NEYRYDLPAREGDIWHGYLEDGKPGLRYGFRVHGPWQPEYGLKDDPLFLDGEQQPDSAAIVVVSDVYDWE
MAL2_DROME      ----------------------------------------------------------------------
CDGT_BACOH      ----------------------------------------------------------------------
AMYM_BACAD      STAHMKKTGSDQDYWLASVTPRYKRLRYGFIVNDKDSTCFTEKNDISYYFSFPYVNQADIFQAPE---WK
CDGT_KLEOX      ----------------------------------------------------------------------
MALT_AEDAE      ----------------------------------------------------------------------
AMYA_ASPNG      ----------------------------------------------------------------------
GLGX_YERPB      QERQIAMPARTGDIWHGYLPGGKPGQRYGYRVSGPFDPSRGHRFNPHKLLPDVRDSAAALLVIHEEYDWQ
BBMA2_BACSU     ----------------------------------------------------------------------
BBMA1_BACSU     ----------------------------------------------------------------------
ISOA_PSEUM      ----------------------------------------------------------------------
ISOA_PSEAY      ----------------------------------------------------------------------
GLGX_YERPY      QERQIAMPARTGDIWHGYLPGGKPGQRYGYRVSGPFDPSRGHRFNPHKLLPDVRDSAAALLVIHEEYDWQ
GLGX_YERPS      QERQIAMPARTGDIWHGYLPGGKPGQRYGYRVSGPFDPSRGHRFNPHKLLPDVRDSAAALLVIHEEYDWQ
GLGX_YERPP      QERQIAMPARTGDIWHGYLPGGKPGQRYGYRVSGPFEPSRGHRFNPHKLLPDVRDSAAALLVIHEEYDWQ
GLGX_YERPN      QERQIAMPARTGDIWHGYLPGGKPGQRYGYRVSGPFEPSRGHRFNPHKLLPDVRDSAAALLVIHEEYDWQ
GLGX_YERPG      QERQIAMPARTGDIWHGYLPGGKPGQRYGYRVSGPFEPSRGHRFNPHKLLPDVRDSAAALLVIHEEYDWQ
GLGX_YERPE      QERQIAMPARTGDIWHGYLPGGKPGQRYGYRVSGPFEPSRGHRFNPHKLLPDVRDSAAALLVIHEEYDWQ
GLGX_YERPA      QERQIAMPARTGDIWHGYLPGGKPGQRYGYRVSGPFEPSRGHRFNPHKLLPDVRDSAAALLVIHEEYDWQ
GLGX_CITK8      NEQRYDLPGRSGDVWHGYLADARPGLRYGYRVHGPWQPAQGHRFNPAKLLGELKDNALKCVVTADRYDWE
GLGX_YERP3      QERQIAMPARTGDIWHGYLPGGKPGQRYGYRVSGPFDPSRGHRFNPHKLLPDVRDSAAALLVIHEEYDWQ
GLGX_ERWT9      ------------------------------------------------------------------FDWE
AMY2_DICT6      ----------------------------------------------------------------------
GLGX_SHIBS      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPWQPAEGHRFNPAKLLPDYRDNAAKCVVVVDHYDWE
GLGX_SHIB3      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPDGHRFEFKDNPLLHAGHNEPDAPKCVVVVDHYDWE
GLGX_SHIFL      QEHRYDLPGNSGDIWHGYLPDARPGLRYGYRVHGPWQPAEGHRFNPAKLLPDYRDNAAKCVVVVDHYDWE
GLGX_SHIF8      QEHRYDLPGNSGDIWHGYLPDARPGLRYGYRVHGPWQPAEGHRFNPAKLLPDYRDNAAKCVVVVDHYDWE
GLGX_SHIDS      -EHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPWQPAEGHRFNPYAGHNEYRDNAAKCVVVVDHYDWE
GLGX_ECOL6      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPEGHRFEFKDNPLLHAGHNEPDNASIVVVVDHYDWE
GLGX_ECO81      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPWQPAEGHRFNPAKLLPDYRDNAAIVVVVVDHYDWE
AMY2_DEBOC      ----------------------------------------------------------------------
MALT_CANAL      ----------------------------------------------------------------------
GLGX_SHISS      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPWQPAEGHRFNPAKLLPDYRDNAAKCVVVVDHYDWE
GLGX_ECOUT      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPEGHRFEFKDNPLLHAGHNEPDNASIVVVVDHYDWE
GLGX_ECOK1      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPEGHRFEFKDNPLLHAGHNEPDNASIVVVVDHYDWE
GLGX_ECO45      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPEGHRFEFKDNPLLHAGHNEPDNASIVVVVDHYDWE
CDGT_BACS2      ----------------------------------------------------------------------
AMY3_DICT6      ----------------------------------------------------------------------
GLGX_SALPK      NERRYDLPGRRGDVWHGYLAGARPGLRYGYRVQGHRFNPAKLLLDPYARRVEYRDNAASVVISD-HYDWE
GLGX_SALPA      NERRYDLPGRRGDVWHGYLAGARPGLRYGYRVQGHRFNPAKLLLDPYARRVEYRDNAASVVISD-HYDWE
GLGX_ESCF3      ----------------------------------------------------------------------
GLGX_ECOSM      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPWQPAEGHRFNPAKLLPDYRDNAAKCVVVVDHYDWE
GLGX_ECOSE      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPWQPAEGHRFNPAKLLPDYRDNAAKCVVVVDHYDWE
GLGX_ECOLI      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPWQPAEGHRFNPAKLLPDYRDNAAKCVVVVDHYDWE
GLGX_ECOL5      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPWQPAEGHRFNPAKLLPDYRDNAAKCVVVVDHYDWE
GLGX_ECODH      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPWQPAEGHRFNPAKLLPDYRDNAAKCVVVVDHYDWE
GLGX_ECOBW      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPWQPAEGHRFNPAKLLPDYRDNAAKCVVVVDHYDWE
GLGX_ECO8A      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPWQPAEGHRFNPAKLLPDYRDNAAKCVVVVDHYDWE
GLGX_ECO7I      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPWQPAEGHRFNPAKLLPDYRDNAAKCVVVVDHYDWE
GLGX_ECO5E      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPWQPAEGHRFNPAKLLPDYRDNAAKCVVVVDHYDWE
GLGX_ECO57      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPWQPAEGHRFNPAKLLPDYRDNAAKCVVVVDHYDWE
GLGX_ECO55      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPWQPAEGHRFNPAKLLPDYRDNAAKCVVVVDHYDWE
GLGX_ECO27      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPWQPAEGHRFNPAKLLPDYRDNAAKCVVVVDHYDWE
GLGX_ECO24      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPWQPAEGHRFNPAKLLPDYRDNAAKCVVVVDHYDWE
GLGX_SALPB      NERRYDLPGRRGDVWHGYLAGARPGLRYGYRVQGHRFNPAKLLLDPYARRVEYRDNAASVVISD-HYDWE
GLGX_ENTS8      NETRYALPARSGDVWHGYLPGARPGLRYGYRVHGPWNPAQGHRFNPAKLLRDNRDAMPKSVVMDDRYDWE
GLGX_ECOLU      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPWQPAEGHRFNPAKLLPDYRDNAAKCVVVVDHYDWE
GLGX_ECOLC      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPWQPAEGHRFNPAKLLPDYRDNAAKCVVVVDHYDWE
GLGX_ECOHS      QEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPWQPAEGHRFNPAKLLPDYRDNAAKCVVVVDHYDWE
CDGT_BACS3      ----------------------------------------------------------------------
TRES_THETH      ----------------------------------------------------------------------
NEPU2_THEVU     ----------------------------------------------------------------------
MDE5_SCHPO      ----------------------------------------------------------------------
MAL2_DROVI      ----------------------------------------------------------------------
MAL1_APIME      ----------------------------------------------------------------------
GLGX_SERP5      QQREVRLPLASGDIWHGYLPGGKPGQRYGYRVHGPNPNKLLLDDDPYLHGGYDRPDRPKCVVIDEAYDWQ
GLGX_SALSV      NERRYDLPGRRGDVWHGYLAGARPGLRYGYRVQGHRFNPAKLLLDPYARRVEYRDNAASVIISD-HYDWE
GLGX_SALA4      NERRYDLPGRRGDVWHGYLAGARPGLRYGYRVQGHRFNPAKLLLDPYARRVEYRDNAASVIISD-HYDWE
GLGX_KLEP7      ---------------------------------------------------------------DLRYDWR
CDGT_BACS0      ----------------------------------------------------------------------
MAL1_DROVI      ----------------------------------------------------------------------
GLGX_SALTY      NERRYDLPGRRGDVWHGYLAGARPGLRYGYRVQGHRFNPAKLLLDPYARRVEYRDNAASVVISD-HYDWE
GLGX_SALPC      NERRYDLPGRRGDVWHGYLAGARPGLRYGYRVQGHRFNPAKLLLDPYARRVEYRDNAASVVISD-HYDWE
GLGX_SALNS      NERRYDLPGRRGDVWHGYLAGARPGLRYGYRVQGHRFNPAKLLLDPYARRVEYRDNAASVVISD-HYDWE
GLGX_SALHS      NERRYDLPGRRGDVWHGYLAGARPGLRYGYRVQGHRFNPAKLLLDPYARRVEYRDNAASVVISD-HYDWE
GLGX_SALG2      NERRYDLPGRRGDVWHGYLAGARPGLRYGYPVQGHRFNPAKLLLDPYARRVEYRDNAASVVISD-HYDWE
GLGX_SALEP      NERRYDLPGRRGDVWHGYLAGARPGLRYGYRVQGHRFNPVKLLLDPYARRVEYRDNAASVVISD-HYDWE
GLGX_SALCH      NERRYDLPGRRGDVWHGYLAGARPGLRYGYRVQGHRFNPAKLLLDPYARRVEYRDNAASVVISD-HYDWE
CDGT_BREBE      ----------------------------------------------------------------------
CDAS_BACSH      ----------------------------------------------------------------------
AMY1_SACFI      ----------------------------------------------------------------------
GLGX_SALDC      NERRYDLPGRRGDVWHGYLAGARPGLRYGYRVQGHRFNPAKLLLDPYARRVEYRDNAASVVISD-HYDWE
AMY_ASPSH       ----------------------------------------------------------------------
AMYB_ASPAW      ----------------------------------------------------------------------
AMYA_ASPAW      ----------------------------------------------------------------------
AMYA1_ASPOR     ----------------------------------------------------------------------
GLGX_SALTI      NERRYDLPGRRGDVWHGYLAGARPGLRYGYRVQGHRFNPAKLLLDPYARQVEYRDNAASVVISD-HYDWE
CDGT2_PAEMA     ----------------------------------------------------------------------
AMYM_BACST      ----------------------------------------------------------------------
AMY3_WHEAT      ----------------------------------------------------------------------
AMY1_LIPKO      ----------------------------------------------------------------------
O16G2_BACSU     ----------------------------------------------------------------------
AMYA3_ASPOR     ----------------------------------------------------------------------
ISOA2_ARATH     ----------------------------------------------------------------------
GLGX_KLEP3      ----------------------------------------------------------------------
CDGT1_PAEMA     ----------------------------------------------------------------------
AMYS_NEIPO      ----------------------------------------------------------------------
AMY2A_ORYSJ     ----------------------------------------------------------------------
AMY2A_ORYSI     ----------------------------------------------------------------------
MAL1_DROME      ----------------------------------------------------------------------
MGTA_THENE      ----------------------------------------------------------------------
AMYS_NEIME      ----------------------------------------------------------------------
AMY1_HORVU      ----------------------------------------------------------------------
O16G_BACTR      ----------------------------------------------------------------------
O16G_BACF5      ----------------------------------------------------------------------
MAL3_DROME      ----------------------------------------------------------------------
MALX1_YEAST     ----------------------------------------------------------------------
AMY4_SCHPO      ----------------------------------------------------------------------
YQ29_SCHPO      ----------------------------------------------------------------------
TREC_BACSU      ----------------------------------------------------------------------
APU_THEP3       ----------------------------------------------------------------------
TGS1_HUMAN      ----------------------------------------------------------------------
AMY_STRVL       ----------------------------------------------------------------------
O16G_BACCO      ----------------------------------------------------------------------
CDGT2_BACCI     ----------------------------------------------------------------------
CDGT_BACST      ----------------------------------------------------------------------
AMY1_DEBOC      ----------------------------------------------------------------------
O16G1_BACSU     ----------------------------------------------------------------------
CDGT_THETU      ----------------------------------------------------------------------
O16G_BACCE      ----------------------------------------------------------------------
MGTA_THEMA      ----------------------------------------------------------------------
MALX4_YEAST     ----------------------------------------------------------------------
MALX2_YEAST     ----------------------------------------------------------------------
CDGT_BACS8      ----------------------------------------------------------------------
CDGT_BAC11      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DDKWLEKRAKTNYYDNPMNVYELHLASWKTKNGKFLTYDELNETLPQYIKEMGYTHVEFMPLHEHPLDAS
GLGB_FRATM      DDKWLEKRAKTNYYDNPMNVYELHLASWKTKNGKFLTYDELNETLPQYIKEMGYTHVEFMPLHEHPLDAS
GLGB_FRATW      DDKWLEKRAKTNYYDNPMNVYELHLASWKTKNGKFLTYDELSETLPQYIKEMGYTHVEFMPLHEHPLDAS
GLGB_FRATT      DDKWLEKRAKTNYYDNPMNVYELHLASWKTKNGKFLTYDELSETLPQYIKEMGYTHVEFMPLHEHPLDAS
GLGB_FRAT1      DDKWLEKRAKTNYYDNPMNVYELHLASWKTKNGKFLTYDELSETLPQYIKEMGYTHVEFMPLHEHPLDAS
GLGB_FRATO      DDKWLEKRAKTNYYDNPMNVYELHLASWKTKNGKFLTYDELSETLPQYIKEMGYTHVEFMPLHEHPLDAS
GLGB_FRATF      DDKWLEKRAKTNYYDNPMNVYELHLASWKTKNGKFLTYDELSETLPQYIKEMGYTHVEFMPLHEHPLDAS
GLGB_FRATH      DDKWLEKRAKTNYYDNPMNVYELHLASWKTKNGKFLTYDELSETLPQYIKEMGYTHVEFMPLHEHPLDAS
GLGB_FRATN      DDKWLEKRAKTNYYDNPMNVYELHLASWKTKDGKFMTYDELSETLPQYIKEMGYTHVEFMPLHEHPLDAS
GLGB_FRAP2      DEKWLKKRATADYYNSPMNTYELHLASWKTKDDRFMTYEEIAEVLPKYVKDMGYTHVEFMPLHEHPLDAS
GLGB_CLOP1      DKRWLNKREKEGLDNKPMNIYELHLGSWKRKDGEFMTYEEISEVLVEYVKEMGYTHVEFMPINEHPLDAS
GLGB1_CLOPE     DKKWLNKREETNYFESPINIYELHLGSWKRKDDEFLSYDELSIILPKYIKEMGYTHVEFMPLNEHPLDAS
GLGB2_CLOPE     DKRWLNKREKEGLDNKPMNIYELHLGSWKRKDGEFMTYEEISEVLVEYIKEMGYTHVEFMPINEHPLDAS
GLGB2_CLOPS     DKRWLNKREKEGLDNKPMNIYELHLGSWKRKDGEFMTYEEISEVLVEYIKEMGYTHVEFMPVNEHPLDAS
GLGB1_CLOPS     DKKWLNKREATNYFESPINIYELHLGSWKRKDDEFLSYDELSVVLPKYVKEMGYTHVEFMPLNEHPLDAS
GLGB_OCEIH      DDQWIEQRNTYDPYSSPISIYEVHLGTWKTLKKQFLSYRELATQLIPYVKSLGYTHIELLPINEHPFDRS
GLGB_HALOH      XXXXXXXXXXXTVYNKPVLIYEVHLGSWKRKNGDYLTYRELANELVEYVKDMGYNYIELLPVAEHPFDGS
GLGB_THEEB      DSDWLEKRRHTDPLNQPISVYEVHLGSWLHASARFLTYRELAAKLIPYVKELGYTHIELLPVAEHPFDGS
GLGB_SYNJA      DQEWLEKRAATDPLRSPISVYEVHLGSWQKPNTRFLTYRELADKLIPYVKELGFTHIELLPVAEHPFDGS
GLGB_SHESW      DTLWMNKRAVTAWHKAPMAIYEVHLGSWRRKNGEYLDYQDLIEQLIPYVKAQSFTHIELMPISEYPFDGS
GLGB_SHEPC      DTLWMNKRAVTAWHKAPMAIYEVHLGSWRRKNGEYLDYQDLIEQLIPYVKAQGFTHIELMPISEYPFDGS
GLGB_ANASP      DEDWLEQRRHTDPLTQPISVYEVHLGSWQLPNGRFLTYRELASRLIPYVKELGYTHIELLPIAEHPFDGS
GLGB_NITOC      DRKWMEQRKQFDWLHQPISVYEVHLGSWQRENGAFLNYRQLARQLVDYVLKTGFTHIELLPVTEHPLDAS
GLGB_NITEC      DNDWMVQRAGWDWLHAPVNIYELHVGSWKRHDGSFYSYQELADHLIPYLQEMGYSHVELLPISEHPLDES
GLGB_BACWK      DKNWIRKRKKKSIYKEAMTVYELHFGSWKKKDGALYSYREMAEELIPYVVEHQFTHIEIMPLVEHPYDRS
GLGB_ANAVT      DENWLEQRRHTDPLTQPISVYEVHLGSWKLPNGRFLTYRELASRLIPYVKELGYTHIELLPIAEHPFDGS
GLGB_BACC4      DKNWIRXXXXXSIYKEAMTVYELHFGSWKKKDGTLYSYREMVEELIPYVVEHQFTHIEIMPLVEHPYDRS
GLGB_SHEON      DTQWMDKRAATAWHRAPMSIYEVQLGSWRRKGEQYFDYQDLIEQLIPYVKEQGFTHIELMPVSEYPFDGS
GLGB_NITEU      DDDWIARRKGWDWLHAPLNIYELHVGSWKRHDGRFYSYHELADHLIPYLQDMGYSHVELLPISEHPLDES
GLGB_BACCR      DKNWNRXXXXXSIYKEAMTVYELHFGSWKKKDGTLYSYREMVEELIPYVVEHQFTHIEIMPLVEHPYDRS
GLGB_SYNJB      DQAWLEKRAATDPLRSPISVYEVHLGSWQKPNTRFLTYRELADKLIPYVKELGFTHIELLPVAEHPFDGS
GLGB_SHESR      DTQWMDKRATTAWHRAAMSIYEVQLGSWRRKGEQYFDYQDLIEQLIPYVKEQGFTHIELMPVSEYPFDGS
GLGB_BACHK      DKNWSRXXXXXSVYKEAMTVYELHFGSWKKKDGTLYSYREMAEELIPYVVEHQFTHIEIMPLVEHPYDRS
GLGB_BACC3      DKNWSRXXXXXSVYKEAMTVYELHFGSWKKKDGTLYSYREMAEELIPYVVEHQFTHIEIMPLVEHPYDRS
GLGB_BACC0      DKNWSRXXXXXSVYKEAMTVYELHFGSWKKKDGTLYSYREMAEELIPYVVEHQFTHIEIMPLVEHPYDRS
GLGB_BACAN      DKNWSRXXXXXSVYKEAMTVYELHFGSWKKKDGTLYSYREMAEELIPYVVEHQFTHIEIMPLVEHPYDRS
GLGB_BACAC      DKNWSRXXXXXSVYKEAMTVYELHFGSWKKKDGTLYSYREMAEELIPYVVEHQFTHIEIMPLVEHPYDRS
GLGB_BACAA      DKNWSRXXXXXSVYKEAMTVYELHFGSWKKKDGTLYSYREMAEELIPYVVEHQFTHIEIMPLVEHPYDRS
GLGB_BACC2      DKNWTRXXXXXPIYKEAMTVYELHFGSWKKKDGTLYSYREMVEELIPYVVEHQFTHIEIMPLVEHPYDRS
GLGB_BACCZ      DKNWSRXXXXXSVYKEAMTVYELHFGSWKKKDGTLYSYKEMAEELIPYVVEHQFTHIEIMPLVEHPYDRS
GLGB_SHESM      DTQWMHKRATTAWHRAAMSIYEVQLGSWRRKGEQYFDYQDLIEQLIPYVKEQGFTHIELMPVSEYPFDGS
GLGB_HAES1      --SMTEKRRKANQADQPISIYEVHLGSWRRENNFWLDYDQIAEELIPYVKDMGFTHIELLPLSEFPFDGS
GLGB_TRIEI      DQEWMEKRRHTDPLTQPISVYECHFGSWKLPNGRFLTYRELADRLVSYVKDLGYTHIEMLPVAEHPFDGS
GLGB_MARAV      DGDWLERRNRFDWQQSPISVYEVHPGSWRHHSGRWLTYRELADQLVPYVLETGFTHIELLPVTEHPLDES
GLGB_PROMA      DQKWMTQRDKTDQLNKPISVYEMHLGSWMHSSNKFLTYPELTEKLIPYVKARGFTHIELMPISEHPFDGS
GLGB_MANSM      --EMTEKRRAANQSDKPISIYEVHLGSWRRENNFWLDYDEIADELIPYVKEMGFTHIELLPISEYPFDGS
GLGB_SYNP6      DADWLERRRHQEPLRQPISVYEVHLGSWMHASSRFLTYRELADRLIPYVLDLGYSHIELLPIAEHPFDGS
GLGB_SYNE7      DADWLERRRHQEPLRQPISVYEVHLGSWMHASSRFLTYRELADRLIPYVLDLGYSHIELLPIAEHPFDGS
GLGB_HAES2      --SMTEKRRKANQADQPISIYEVHLGSWRRENNFWLDYDQIAEELIPYVKDMGFTHIELLPLSEFPFDGS
GLGB_BACCQ      DKNWSRXXXXXSVYKEAMTVYELHFGSWKKKDGTLYSYREMAEELIPYVVEHQFTHIEIMPLVEHPYDRS
GLGB_SHEB9      DTAWMSKRAATAWHKAPMSAYEVHLGSWRRKGEQYLDYQDLIEQLIPYVKEQGFTHIELMPISEFPFDGS
GLGB_NITMU      DARWMAQRAVWDWLATPLNIYEVHAGSWKRHNGSFYSYRELADHLLPYVREMGYTHIELLPISEHPLDES
GLGB_SYNY3      DEDWLEARRTSDPLSKPVSVYELHLGSWKTLHGRFLTYYELVDKLIPYVKELGYTHIELLPIAEHPFDGS
GLGB_THICR      DRDWLAARAHFDWQASPINIYEVHLGSWRDHDGFFLNYKEIAQRLVEYVKWMGYTHIELLPISEHPLDES
GLGB_SHEB8      DTAWMSKRAATAWHKAPMSAYEVHLGSWRRKGEQYLDYQDLIEQLIPYVKEQGFTHIELMPISEFPFDGS
GLGB_CELJU      DADWMEHRAHWDWQASPLSIYEVHLGSWRRGAGEFLSYRELAHQLADYVKYMGFTHVEILPVSEHPLDDS
GLGB_SHEB5      DTAWMSKRAATAWHKAPMSAYEVHLGSWRRKGEQYLDYQDLIEQLIPYVKEQGFTHIELMPISEFPFDGS
GLGB_SHEB2      DTAWMSKRAATAWHKAPMSAYEVHLGSWRRKGEQYLDYQDLIEQLIPYVKEQGFTHIELMPISEFPFDGS
GLGB_PROMP      DSSWITNRDSSSQINKPISVYEMHLGSWMEKNGRFLTYPELTEKLIPYVKERGFTHIELMPISEHPFDGS
GLGB_THIDA      DAEWLAARTRFDWQHRPMSVYEVHPGSWRRRDGSFYSWRELTAELIPYVRDLGYTHIELLPVAEHPFDAS
GLGB_GLOVI      DGEWLKRRALSNPLKQPLAIYEVHLGSWMREGDRFLSYTELADKLIPYVKDLGFTHIELLPILEHPFDGS
GLGB_RHOBA      DSDWLQQRAEMDPMHTPMNVYEVHLGSWQKGPGRWLDYRDLAKRLVDYCHRMNFTHVELMPISEHPFTGS
GLGB_RHORT      DGRWMSERADRVATSAPVSIYEVHLGSWRHGGGRSLSYREMAEQLIPYVKEMGFTHIELLPVSEFPFDGS
GLGB_AQUAE      DSEYMKKRKRVNSHDSPISIYEVHVGSWRREGNRFLSYRELAEYLPYYVKEMGFTHVEFLPVMEHPFYGS
GLGB_ACTP2      D----AKLRHANDPDQPISIYEVHLGSWRRENNYWLNYEEIANELIPYVKDMGFTHIELLPITEYPFDGS
GLGB_BACCN      DKNWFRXXXXXSVYKEAMAIYELHFGSWKKKDGSLYSYREMAEELIPYMANHHFTHIEIMPLVEHPYDRS
GLGB_DESHY      DQAWLAQRKTRNPKVLPLSSYEIHLGSWRTEDGRFLNYAQLVTVLIPYVKSLGYTHIEILPLMEHPYDGS
GLGB_BACC1      DKNWSRXXXXXSVYKEAMTVYELHFGSWKKKDGTLYSYREMAEELIPYVVEHQFTHIEIMPLVEHPYDRS
GLGB_SYNS3      DDAWINSRDRRNPLDQPISVYEMHLGSWLKPGARLLTYPELADRLIPYVKEQGFSHIELMPITEHPFDGS
GLGB_ACTPJ      D----AKLRHANEPDQPISIYEVHLGSWRRENNYWLNYEEIANELIPYVKDMGFTHIELLPITEYPFDGS
GLGB_PASMU      --PMTEQRRKANQFDQPISIYEVHLGSWRRENNFWLDYDQIADELIPYVKEMGFTHIEFLPISEFPFDGS
GLGB_BACC7      DKNWSRXXXXXSVYKEAMTVYELHFGSWKKKDGTLYSYREMAEELIPYVVEHQFTHIEIMPLVEHPYDRS
GLGB_ACTP7      D----AKLRHANDPDQPISIYEVHLGSWRRENNYWLNYEEIANELIPYVKDMGFTHIELLPITEYPFDGS
GLGB_RUBXD      DGEWMERRGSRNAPDAPMAIYEVHLGSWRRRDGSHLTYRELAEELVPYVAGLGYTHVELLPPMEHPFGGS
GLGB_BACST      DQTWRRKKQRKRIYDQPLFIYELHFGSWKKKDGSFYTYQEMAEELIPYVLEHGFTHIELLPLVEHPFDRS
GLGB_HAEIN      --EMTEARKKANQGNQPISIYEVHLGSWRRENNFWLDYDQIADELIPYVKEMGFTHIEFLPLSEFPFDGS
GLGB_SACD2      DAEWFAKANNWTQRDRPISIYEVHLGSWKREDNRYLSYKELAADLIPYVKSMGFTHIQLMPISEFPFDGS
GLGB_PROM5      DXXXXXXXXXXXQINKPISVYEMHLGSWMEKNGRFLTYPELTEKLIPYVKERGFTHIELMPISEHPFDGS
GLGB_SYNSC      DQTWMQKRDSSNALDQPISVYEMHLGSWMKPGARLLTYAELADRLIPYVKDRGFTHIEVMPITEHPFDGS
GLGB_HAEIG      --EMTEARKKANQGNQPISIYEVHLGSWRRENNFWLDYDQIADELIPYVKEMGFTHIEFLPLSEFPFDGS
GLGB_PARUW      DQAWMEQRKAKNWTSLPMNIYEVHLGSWKKKNSEFLNYRELAHELTAYCLDMGFTHIELLPIQEHPLDES
GLGB_HAEI8      --EMTEQRRQANQANQPISIYEVHLGSWRRENNFWLDYDQIADELIPYVKEMGFTHIEFLPLSEFPFDGS
GLGB_SYNPW      DTDWIQKRDSSNPLDQPIAVYEMHLGSWLKPGARLLTYPELADRLIPYVKERGFTHIELMPITEHPFDGS
GLGB_PROM4      DQEWITKRDSSNPLDQPISVYEMHLGSWLEPNGRLLTYPELKQKLIKYVKERGFTHIELMPISEHPFDGS
GLGB_ACTSZ      -QEMTAARRKANQLDQPISIYEVHLGSWRRNNNFWLNYDEIADELIPYVKEMGFTHIELLPISEFPFDGS
GLGB_METCA      DADWLAQRKDWPWLHRPLSVYEMHAGSWKRDEGGYLNYRDLAHELVDYVKSAGFSHIELMPVTEHPLDAS
GLGB2_RHIEC     DDNWMKGQSRQQRLEGPISVYEVHAGSWLRENGRSLDWVELSQRLVPYVREMGFTHIELLPIMEHPFGGS
GLGB_BACCL      DSPWQRKKRRKRIYDQPMVIYELHFGSWKKKDGRFYTYREMADELIPYVLERGFTHIELLPLVEHPLDRS
GLGB_SHEFN      DSQWLADRASHQPHVQPMSIYEVQLASWRRKGDEYTDYSQLIAELVPYIKEMGFTHLQLMPISEYPFDGS
GLGB_METFK      DAEWLEDRARADWLHAPFNCYEVHLGSWRRDHGEFLGYRELAHQLVPYMQEMGYTHIELLPVSEHPLNES
GLGB_PROMM      DEQWMRQRDSRNALDQPISVYEMHLGSWMKPGARLLTYPELADQLIPYVKDRGFTHIELMPISEHPFDGS
GLGB1_RHIEC     DEAHLKHWRETDKRRQPISIYEVHAGSWQRRDGTMLSWDELASSLIPYCVDMGFTHIEFLPITEHPYDPS
GLGB_PROM3      DEQWMRQRDSRNALDQPISVYEMHLGSWMKPGARLLTYPELADQLIPYVKDRGFTHIELMPISEHPFDGS
GLGB_SYNS9      DSSWMQDRDSRNALDQPISVYEMHIGSWMKPGARLLTYAELSDRLIPYVKERGFTHIELMPITEHPFDGS
GLGB_RHOFD      DDQWMSSRGPKNALDAPMSIYEIHLGSWRRQDGHFLDYRELAHSLADYVIEMGFTHVELMPVTEHPFYGS
GLGB1_RHIL3     DEAHLKHWRETDKRRQPISIYEVHAASWQRRDGTMLSWDELASSLIPYCADMGFTHIEFLPITEYPYDPS
GLGB_PSEPK      DHDWMAQRAQRHAYNAPLSIYELHPGSWRCELGRFYNWRELAERLVPYVQELGFTHIELLPIMEHPFGGS
GLGB_PROMT      DQSWISNRDNRDPLEQPISVYEMHLGSWMNSNGRLLTYKELANKVIPYVKERGFTHIELMPISEHPFDGS
GLGB_AZOSE      DDAWMAGRARANALDAPFSIYELHLGSWRAQDGALPGYREIAPQLAAYVVEWGFTHVELMPLSEHPFYGS
GLGB_RHIME      DEAHRRHWAEIDPRRQPISIYEVHAASWQRRNGDMLTWDELAERLIPYCVDMGFTHIEFLPISEYPYDPS
GLGB_RHOP5      RPAPAGISALTS----PMSIYEVHLGSWRRKNNDWLSYRELAEQLPAYVRDLGFTHVEFLPINEHPFDGS
GLGB_CORDI      DDTWMTNRAHTDHDNTAMSVYEVHLGSWSQGQN----YEELATNLVDYVKEMGYTHVEFLPVAEHPFGGS
GLGB_STRAU      DAEWMARRGALAPHQAPMSVYELHLASWRPG----LSYRQLAEQLPAYVKELGFTHVELMPVAEHPFGGS
GLGB_PROM1      DQSWISNRDNRDPLEQPISVYEMHLGSWMNSNGRLLTYKELANKVIPYVKERGFTHIELMPISEHPFDGS
GLGB_CORJK      DDEWLAHRAAVGV-DETMSIYEMHLGSWR----KGRSYRELAVELVEYVQELGYTHVELMGVSEHPFEPS
GLGB_ERWCT      N----EARREANSLRSPISIYEVHLGSWRTDNNFWLSYQELANQLIDYVQYMGFTHVELMPINEHPFDGS
GLGB_BACSU      XXXXXXXXXAKTLYEKPVFIYELHLGSWKKSDGRHYSYKELSQTLIPYIKKHGFTHIELLPVYEHPYDRS
GLGB2_STRCO     DAQWMRTRADTPVHEAPFSVYEVHLPSWRPG----LTYRELAEELPAYVKDLGFTHVELMPVAEHPYGPS
GLGB_SYNR3      DDAWLKQRDNRNPLEQPVSVYEMHMGSWMKPGARLLTYPELADRVIPYVKARGFTHIELMPMAEHPFDGS
GLGB_MESSB      DGEWVEHRIGKNDRKAPISIYEVHLGSWRREDGRYLSYDELADRLLPYVKDLGFTHIECMPVSEHPFSGS
GLGB_ALHEH      DREWMAARREDQWQSIPISIYEVHLGSWRAGDGSFLDYRTLAHRLVDHVLATGFTHIELLPITEHPFDGS
GLGB1_XANCP     DDGWMATRARRQAHDAPMSIYEIHAGSWLREEGLDLDWDGLADRLIPYVADMGFTHVELMPVTEHPFGGS
GLGB1_XANC8     DDGWMATRARRQAHDAPMSIYEIHAGSWLREEGLDLDWDGLADRLIPYVADMGFTHVELMPVTEHPFGGS
GLGB1_STRAW     DEAWMAARGERPVHESPFSVYEVHLPSWRPG----LTYRQLAEQLPAYVADLGFTHVELLPVAEHPFGGS
GLGB_NEIDE      P----AFRRRANSVEAPISIYEVHLGSWRRENNYWLTYTQLADELVNYVKDMGFTHIELLPLSEYPFDGS
GLGB_MYXXD      DAAWLEQRARRDVHHQPWSVYEVHLGSWRRDGDRPMTYRELAPALAEYIKFTGFTHIELLPVAEHPYGGS
GLGB1_XANAC     DDGWMATRARRQAHDAPMSIYEIHAGSWLREAGVDLDWDGLADRLIPYVADMGFTHVELMPVSEHPFGGS
GLGB_AGRT5      DQAHREHWAQVDQRRQPISIYEVHAGSWQRRDGTFLSWDELAAQLIPYCTDMGFTHIEFLPITEHPYDPS
GLGB_SYNPX      DGSWMQRRDSSNPLEQPISVYEMHLGSWMKPGARLLTYAELAARLIPYVKERGFTHIELMPITEHPFDGS
GLGB_ECOL6      T----EERKKANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPINEHPFDGS
GLGB_DESVV      DGAWMAERARQGLLERPVSIYEVHLGSWRRRHGDFLTYDELGDQLIPYATGMGFTHLELLPVAEHPLDQS
GLGB_CORGL      DSEWLRERSQTDLASKPMSVYEVHLGSWRW--GK--NYEDLATELVDYVADLGYTHVEFLPVAEHPFGGS
GLGB_ECOUT      T----EERKKANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPINEHPFDGS
GLGB_ECOK1      T----EERKKANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPINEHPFDGS
GLGB_ECO57      T----EERKKANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPLNEHPFDGS
GLGB_SHIF8      T----EERKKANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPINEHPFDGS
GLGB_ERWCH      D----EARQHANELQSPISIYEVHLGSWRTHNNFWLSYRELADQLVPYVKEMGFTHVELMPVHKHPFDGS
GLGB_SHIFL      T----EERKKANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPINEHPFDGS
GLGB_ECOL5      T----EERKKANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPINEHPFDGS
GLGB_DESVH      DGAWMAERARQGLLERPVSIYEVHLGSWRRRHGDFLTYDELGDQLIPYATGLGFTHLELLPVAEHPLDQS
GLGB_BRAJA      --RPRPAPDGINALSAPMSIYEVHLGSWRRKDNEWLTYRELAEQLPAYARDMGFTHLEFLPVSEHPFDGS
GLGB_RHOS1      DAGWMQERESRQRRDAPISIYEVHAGSWR----QGLDYDALAEELSAYVREMGFTHVEFLPISEHPFTGS
GLGB_SHISS      T----EERKKANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPINEHPFDGS
GLGB_PROM9      DNAWITNRDSSSQINKPISVYEMHLGSWLHENGRLLTYPELTEKLIPYVKDRGFTHIELMPISEHPFDGS
GLGB_ECOLI      T----EERKKANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPINEHPFDGS
GLGB_ECOLC      T----EERKKANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPINEHPFDGS
GLGB_ECOHS      T----EERKKANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPINEHPFDGS
GLGB_ECO24      T----EERKKANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPINEHPFDGS
GLGB_RHOS4      DAGWMQERESRQRRDAPISIYEVHAGSWR----QGLDYDALAEELSAYVREMGFTHVEFLPISEHPFTGS
GLGB_COREF      DSEWMDKRAEIDTATTPMSVYEVHLGSWRWGR----SYAELATELVDYVADLGYTHVEFMPVAEHPFGGS
GLGB2_RHIL3     DDGWMKGRSRQDRLEGAFSVYEVHVGSWQKDGNRSLDWVELSQRLVPYVSDMGFTHIELLPIMEHPFGGS
GLGB_YERPS      S----AARQKANDLCSPVSIYEVHLGSWRTDNNFWLSYRELADQLVEYVKYMGFTHVELLPINEHPFDGS
GLGB_YERPP      S----AARQKANDLCSPVSIYEVHLGSWRTDNNFWLSYRELADQLVEYVKYMGFTHVELLPINEHPFDGS
GLGB_YERPN      S----AARQKANDLCSPVSIYEVHLGSWRTDNNFWLSYRELADQLVEYVKYMGFTHVELLPINEHPFDGS
GLGB_YERPE      S----AARQKANDLCSPVSIYEVHLGSWRTDNNFWLSYRELADQLVEYVKYMGFTHVELLPINEHPFDGS
GLGB_YERPA      S----AARQKANDLCSPVSIYEVHLGSWRTDNNFWLSYRELADQLVEYVKYMGFTHVELLPINEHPFDGS
GLGB_PROAC      DDEWIARREASRAHAEPMSVYEVHLGGWRHG----LSYRELADQLVSYVTWQGYTHVEFMPLAEHPFAPS
GLGB_LACS1      DGLWRGRQKRMNHFNNPINIYEVHAPSWKEEDGSLYTFKDLTAELIPYVKKMGYTHIEFMPLMEHPLPAS
GLGB_SHIDS      T----EERKKANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPINEHPFDGS
GLGB_YERP3      S----AARQKANDLCSPVSIYEVHLGSWRTDNNFWLSYRELADQLVEYVKYMGFTHVELLPINEHPFDGS
GLGB_SHIBS      T----EERKKANQFDASISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPINEHPFDGS
GLGB_BACLD      DRKWQKKKQQKAVYEKPISIYELHIGSWKKKDGRFFTYRELSETVIPYVKEHGFTHIELMPLTEHPFDRS
GLGB1_XANC5     DDGWMATRARRQAHDAPMSIYEIHAGSWLREXXXXXXXXXXXXXXIPYVADMGFTHVELMPVSEHPFGGS
GLGB_RHOP2      ----LPRPAPDNILGAPMSIYEVHLGSWRRKDGEWLTYRELAEQLPAYVRDMGFTHVEFLPVSEHPFDGS
GLGB_FRASC      DGAWLDRRARTAWRTEPVSVYEVHLGSWR----RGLSYRELAEELTAYVVENGFTHVEMLPVAEHPFGGS
GLGB_PSE14      DQEWLRSRTGRHDVAAPLSIYELHAGSWQMEDGQWRQYNELADRLIPYVKELGFTHIELMPIMEHPFGGS
GLGB_RHOPB      RPA----PPAINALTSPMSIYEVHLGSWRRKDNQWLSYRELAEVLPAYVRDLGFTHVEFLPVNEHPFDGS
GLGB_FUSNN      DKRWLNNREIG--YAKPINIYEVHLGSWKKKDGTYYNYKEIAELLVEYMLEMNYTHIEIMPIIEYPFDGS
GLGB1_XANOR     DDGWMATRARRQAHDAPMSVYEMHAGSWLREEGVDLDWDGLADHLIPYVADMGFTHVELMPVTEHPFGGS
GLGB_SALAR      S----EERQKANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGS
GLGB_PSEF5      DQEWMLARGERQRVDAPLSIYELHAGSWQCEVARQYSWAELAERLIPYVKDLGFTHIELMPIMEHPFGGS
GLGB_MYCPA      DADWMTQRAARNPVFEPMSTYEVHLGSWRPG----LSYRQLARELTDYVVEHGFTHVELLPVAEHPFAGS
GLGB_PSEU2      DQEWLQSRAGRHEVTAPLSIYELHAGSWQVEDNQWRQYNELADRLIPYVKELGFTHIELMPIMEHPFGGS
GLGB_RHOPS      RPA----PAQINALGAPMSIYEVHLGSWRRKDGEWLSYRELAETLPAYVREMGFTHVEFLPVSEHPFDGS
GLGB_BURXL      DHEWIQSRAGKQTARSPISIYEVHAESWAEEGQRGLDWEELAERMIPYVKSMGFTHVEFMPIAEHPFGGS
GLGB2_XANOM     DDGWMATRARRQAHDAPMSVYEMHAGSWLREEGVDLDWDGLADRLIPYVADMGFTHVELMPVTEHPFGGS
GLGB_YERE8      TPA----RQKANDLRSPISIYEVHLGSWRTDNNFWLSYGELADQLVEYVKYMGFTHVELLPINEHPFDGS
GLGB_SALPB      S----EERQKANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGS
GLGB_SALPA      S----EERQKANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGS
GLGB_THEFY      DDEWLTQRAAADLHRKPMSIYEVHLGSWRPG----LSYRELADQLVDYVRELGFTHVEFLPVAEHPFGGS
GLGB_PSESM      DQDWLQSRAGRHDVAAPLSIYELHAGSWQMEQGQWRQYNELADRLIPYVKELGFTHIELMPIMEHPFGGS
GLGB_SALTI      S----EERQKANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGS
GLGB_SALCH      S----EERQKANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGS
GLGB_SALTY      G----EERQKANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGS
GLGB_MYCSS      DDAWMTQRAAQNPVFEPMSTLEVHLMSWRPG----LSYVELADQLTEYIVEHGFTHVEMLPVAEHPFGGS
GLGB_MYCSK      DDAWMTQRAAQNPVFEPMSTLEVHLMSWRPG----LSYVELADQLTEYIVEHGFTHVEMLPVAEHPFGGS
GLGB_CITK8      T----EERKQANRFDAPVSIYEVHLGSWRTDNNFWLSYRELADQLIPYVKWMGFTHLELLPVNEHPFDGS
GLGB_VIBPA      DAKW-QNRAVTQKRDEALSFYELHAGSWKRDGGDFLNYRELAEQLVPYLVDMGYTHVELMPVSEHPFYGS
GLGB_MAGSA      XXXXXXXXXXXNDRHAPISIYEVHLGSWRRVPNRPLSYLEMADQLGDYVADLGFTHVEFLPIHEHPFGGS
GLGB_RHOSR      DAEWLAQRAATEPAQSPMSVYEVHLASWRPG----LNYREMAEQLAVHLTETGFTHVELLPVAEHPFGGS
GLGB_MYCSJ      DDAWMTQRAAQNPVFEPMSTLEVHLMSWRPG----LSYVELADQLTEYVVEHGFTHVEMLPVAEHPFGGS
GLGB_DESDG      DAAWMQRRREAGPLQQPVSIYELHAGSWMRRHGEFVNWDELAGTLIPYVRDAGFTHIELMPVAEHPLDQS
GLGB_NITWN      --RPTPLAATINARGVPISIYEVHLGSWRRSDGRWLSYRELAETLPDYVRELGFTHIELMPVNEHPFDGS
GLGB_BRASO      --RPRPAPHDINKLNKPVSIYEVHLGSWRRKNNQWLTYRELAEQLPAYARDMGFTHIEFLPINEHPFDGS
GLGB_BIFLO      DDAWMQHRRTTNPHDGPVSIYEVHAGSWK----QGLTYRDLAKQLVDYVKQEGFTHVEFMPLAQHPFSGS
GLGB_RHILO      DE------AHRNYWRNAVSIYEVHAGSWQLHDGTFLSWDELADRLIPYVVETGFTHIEFMPISEHPYDPS
GLGB_PSEPF      DQDWMSGRRERQQHNAPLSIYELHAGSWQCELARQYTWPELAERLIPYVKELGFTHIELMPIMEHPFGGS
GLGB_LACAC      DGAWMGRNKRSNHFARPINIYEVHASSWKRHDGSLYTLKDLQKELIPYVKEQGFNYIEFLPLTAHPLDAS
GLGB_DECAR      DADWLQQRAGWDWQQAPVNIYEVHPGSWRHPDGKPYLWGELAERLIPYALAQGYTHLELLPITEHPLDES
GLGB_SERP5      TPQ----RQRANDFDRPISIYEVHLGSWRTDDNFWLSYGELAVQLIDYVKDMGFTHIELLPINEHPFDGS
GLGB_GRABC      DEQWMQQRGRLQAADQPISIYEVHPTSWMP--AKCGDWNTLADRLIPYVQSLGFTHVEFLPVMEHPFGGS
GLGB_MYCBP      DDDWMAGRALRNPVNEAMSTYEVHLGSWRPG----LSYRQLARELTDYIVDQGFTHVELLPVAEHPFAGS
GLGB_MYCBO      DDDWMAGRALRNPVNEAMSTYEVHLGSWRPG----LSYRQLARELTDYIVDQGFTHVELLPVAEHPFAGS
GLGB_KLEP7      -EQPADRRA-ANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGS
GLGB_BRASB      --RPRPAPSDINKLDRPVSIYEVHLGSWRRKNNQWLTYRELAEQLPAYARDMGFTHIEFLPVSEHPFDGS
GLGB_PROM2      XXXXXXXXXXXXQINKPISVYEMHLGSWLHENGRLLTYPELTEKLIPYVKDRGFTHIELMPISEHPFDGS
GLGB_PROM0      XXXXXXXXXXXXQINKPISVYEMHLGSWLHENGRLLTYPELTKKLIPYVKERGFTHIELMPISEHPFDGS
GLGB_STRSV      DGLWLARRKRWGFFSRPVNIYEVHAGSWKNEDGSPYSFAQLKEDLIPYLVEMNYTHVEFMPLMAHPLGLS
GLGB_RHOPA      --RPRPAPENINALSAPMSIYEVHLGSWRRKEGQWLTYRELAEQLPAYVRDMGFTHVEFLPVSEHPFDGS
GLGB_PROMS      XXXXXXXXXXXXQINKPISVYEMHLGSWLHENGRLLTYPELTKKLIPYVKERGFTHIELMPISEHPFDGS
GLGB_CHLFF      DAEWMEKRSCTQ--DQPLSIYEVHVGSWQWQDGRPIGYRGLAERLAQYCKEMSYTHIELLPITEHPLNES
GLGB_CHLPN      DHRWMERRSKQS--EGPVTIYEVHLGSWQWQEGRPLSYSEMAHRLASYCKEMHYTHVELLPITEHPLNES
GLGB_VIBF1      DAKW-QQRPVTEKQKEALSFYELHAGSWKNENGDFLTYRELAEQLIPYILDMGYTHIELMPVSEHPFYGS
GLGB_STRGC      DGLWLARRKRWGFFSRPVNIYEVHAGSWKNEDGSPYSFAQLKEDLIPYLVEMNYTHVEFMPLMAHPLGLS
GLGB_MYCTU      DDDWMAGRALRNPVNEAMSTYEVHLGSWRPG----LSYRQLARELTDYIVDQGFTHVELLPVAEHPFAGS
GLGB_MYCTA      DDDWMAGRALRNPVNEAMSTYEVHLGSWRPG----LSYRQLARELTDYIVDQGFTHVELLPVAEHPFAGS
GLGB_STRR6      DGLWLARRKRWGFAERPVNIYEVHAGSWKRNDGSPYSFAQLKDELIPYLVEMNYTHIEFMPLMSHPLGLS
GLGB_STRP2      DGLWLARRKRWGFAERPVNIYEVHAGSWKRNDGSPYSFAQLKDELIPYLVEMNYTHIEFMPLMSHPLGLS
GLGB2_STRAW     DGAWMAARGERPVHESPFSVYEVHLPSWRPG----LTYRQLAEQLPAYVADLGFTHVELLPVAEHPFGGS
GLGB_STRPN      DGLWLARRKRWGFEERPVNIYEVHAGSWKNSDGSPYSFAQLKDELIPYLVEMNYTHIEFMPLMSHPLGLS
GLGB_STRMU      DGLWLGRRKRWGFFKRPVNIYEVHAGSWKNEDGSPYSFEQLKDELVPYLVKMNYTHVEFMPLMAHPLGMS
GLGB_RHIRD      DQAHREHWAQVDQRRQPISIYEVHAGSWRSEDGTFLSWDELEAQLIPYCTDMGFTHIEFLPITEHPYDPS
GLGB_BURTA      DDAWMRERXXXXXXXXXXXIYEVHLDSWRRHDGRAYSYDELADALIPYVAALGFTHVELLPIAEYPFAGS
GLGB_LEIXX      DGEWMRRRAASDPHTGPMSIYELHFGSWRPDLG----YREAADQLIDYLGALGYTHVEFLPLAEHPFGGS
GLGB_BUTFI      DSKWYESLKGKDMNRQPIAIYECHIGSWMTEDG-FYTYRQFADRIVEYLKEMKYTHIELIGIAEHPFDGS
GLGB_MYCUA      DGDWMTERAQRNPVFEPMSTYEVHLGSWRPG----LSYRQLATELTDYVVAHKFTHVELLPVAEHPFAGS
GLGB_DEIGD      DDAWMQKR--TPGFDRPISIYEVHVGSWARRDGWFLNYRELAHRLADYVTFMGYTHVELLGVMEHPFDGS
GLGB_NITHX      XXXXXXINARRA----PISIYEVHLGSWRRDDNRWLSYRELADTLPRYASSLGFTHIELMPVNEHPFDGS
GLGB_CHLCV      DQKWMENRKNTK--DQPLAIYEVHVGSWQWDNGRPLGYRELAKRLAQYCKELHYTHVELLPITEHPLNES
GLGB_ENT38      S----EERKQANNFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHIELLPINEHPFDGS
GLGB_NOCFA      DAQWLERRRSTDPTRSPMSVYEVHLGSWRPGLG----YRELAEQLADYVRAAGYTHVELLPVAEHPFGGS
GLGB_VIBCH      DTAW-QQRPVTEKRKQALSFYELHVGSWKRENGEFLNYRELADQLVPYLVEMGYTHVELMPVAEHPFYGS
GLGB_STRA3      DGLWMGRRKRLGFQKRPINIYEVHAGSWKKDDGHPMTFSQLKDYLIPYLVEMNYTHVEFMPLMAHPLDMS
GLGB_STRA5      DGLWMGRRKRLGFQKRPINIYEVHAGSWKKDDGHPMTFSQLKDYLIPYLVEMNYTHVEFMPLMAHPLDMS
GLGB_STRA1      DGLWMGRRKRLGFQKRPINIYEVHAGSWKKDDGHPMTFSQLKDYLIPYLVEMNYTHVEFMPLMAHPLDMS
GLGB_CHLAB      DAAWMEKRKHRG--DQPLAIYEVHVGSWQWHEGKPLGYRELAKKLAAYCKEMHYTHVELLPVTEHPLNES
GLGB1_STRCO     DEEWLAHRADAPAHEAPMSVYEVHLPSWRPG----LTYRQLAEQLPAYVADLGFTHVELMPVAEHPFGGS
GLGB_PSEA6      XXXXXXXXVKGDKYTQAMSIYEVHLGSWKSQSGKYLSYHELVDELIPYVKDMGYTHLELLPISEFPFDGS
GLGB_VIBVU      DAQW-QTRPVTEKRKEALSFYELHAGSWKNEQGEFLNYRELAAELVPYLVDMGYTHVELMPVSEHPFYGS
GLGB_RALEJ      DDEWMRLRNAVDPYAAPLSIYEVHVGSWRAANDPARGWEVLADRLIPYVHELGFTHIELLPVTEHPFGGS
GLGB_BURCM      DDGWLHARPPADQFRMPWSIYEVHAESWQRDMDRSANWDELAERLIPYVRGMGFTHVEFMPISEYPFGGS
GLGB_CHLT2      DSEWLEERIKKT--EGPMNIYEVHVGSWQWQEGQPLNYKELADQLALYCKQMHYTHVELLPVTEHPLNES
GLGB_DEIRA      DAGWLEQRARRGQLEDPISIYECHVGSWARRDGWFLNYRDLAHRLGEYVTYMGYTHVELLGVMEHPFDGS
GLGB_CHLTB      DSEWLEERIKKT--EGPMNIYEVHVGSWQWQEGQPLNYKELADQLALYCKQMHYTHVELLPVTEHPLNES
GLGB_CHLTA      DSEWLEERIKKT--EGPMNIYEVHVGSWRWQEGQPLNYRELADQLALYCKQMHYTHVELLPVTEHPLNES
GLGB_VIBVY      DAQW-QTRPVTEKRKEALSFYELHAGSWKNEQGEFLNYRELAAELVPYLVDMGYTHVELMPVSEHPFYGS
GLGB_PHOPR      DKAW-QTRPVSVKHQEALSFYELHAGSWRNEQGDFLTYRELAEQLIPYLSEMGYTHLELMPVSEHPFYGS
GLGB_SALRD      DDAWMTTREGPSGIDGPLSIYEVHLGSWREEHGASLSYREVAEPLADHVQNLGFTHVEFLPLAEHPYYGS
GLGB_PSEA7      DQDWLARRAERQGYAAPLSIYEVHAGSWRHRDGRPPRWSELAEELIPYVRQLGFSHIELMPVMEHPFGGS
GLGB_CHLTR      DSEWLEERIKKT--EGPMNIYEVHVGSWRWQEGQPLNYKELADQLALYCKQMHYTHVELLPVTEHPLNES
GLGB_PSEAE      DQDWLARRAERQGYAAPLSIYEVHAGSWRHRDGRPPHWSELAEELIPYVRQLGFTHIELMPVMEHPFGGS
GLGB_RHOMR      DDEWMRRRKGPASLYEPVSIYEVHLGSWRHKRGESFSYREIAEPLADYVQEMGFTHVELLPVMEHPYYGS
GLGB2_XANCP     DAEWMARRSAAAE-PAPLSIYEVHAASWRRDHDQPLDWVSLAAQLIPYVQELGFTHIELLPITEHPFGGS
GLGB2_XANC8     DAEWMARRSAAAE-PAPLSIYEVHAASWRRDHDQPLDWVSLAAQLIPYVQELGFTHIELLPITEHPFGGS
GLGB_ROSDO      DAQWMTRRADVQRIDQPVSIYEVHLGSWRRDGNRPLSYVELADQLVAYVKDMGFTHMEVMPVSEFPFDGS
GLGB_NOVAD      XXXXXXXXXSVDARREPMSIYEVHPGSWQKPHEEFHTWDELADRLIPYVAEMGFTHIEFLPVSEHPYDPS
GLGB_CHLMU      DKEWLDERSKKA--EGPMNIYEVHVGSWRWQEEQPLNYRELADQLSLYCKQMHYTHVELLPVTEHPLNES
GLGB_BURVG      DAGWIDARPDAGRFRVPWSIYEVHAESWQREMDRSATWDELAERLIPYVKGMGFTHVEFMPISEYPFGGS
GLGB_BURCH      DDGWMHARPRDDRYRVPWSIYEVHPESWQRQMDRSATWDELAERLIPYVKGMGFTHVEFMPIAEYPFGGS
GLGB_BURCA      DDGWMHARPRDDRYRVPWSIYEVHPESWQRQMDRSATWDELAERLIPYVKGMGFTHVEFMPIAEYPFGGS
GLGB2_XANOR     DAAWMAKR-DPSAVPAPLSIYEVHAASWRRDHNQPLDWPTLAEQLIPYVQQLRFTHIELLPITEHPFGGS
GLGB1_XANOM     DAAWMAKR-DPSAVPAPLSIYEVHAASWRRDHNQPLDWPTLAEQLIPYVQQLRFTHIELLPITEHPFGGS
GLGB_RALSO      DAAWMETRAARQRPDAPIAIYEVHAGSWLRDGGRSLDWDALGERLIPYVAGLGFTHVELLPVAEHPFGGS
GLGB2_XANAC     DAAWMANRDPAAV-PGPLSIYEVHAASWRRDHNQPLDWPTLAEQLIPYVQQLGFTHIELLPITEHPFGGS
GLGB_LACPL      DSLWLARRKKSRAANRPINIYEVHLGSWRRHDGSYYTYAELAAELIPYVKQRGYTHIELMPVMEHLLDAS
GLGB_RALEH      DADWMARRGGADPYAAPMSVYEVHALSWRAANDTQRGWEILAERLVPYVQELGFTHIELLPITEHPFGGS
GLGB_JANSC      DGAWMETRAEAADRAAPISIYEVHLGSWRRKGGRPLSYKEAAQDLVGYVRHMGFTHIELMPISEFPFDGS
GLGB_PICTO      DNSF--KRS-----ENALSIYEMHLGSWKRNNGDYYNYREIADMLIDHLKKTGFNCVEIMPVMEHPLDIS
GLGB_BURP6      DDAWLRARASLDLAHAPVSIYEVHPESWAAEGNRSATWDELAQRLIPYAAGMGFSHVELTPIAEYPFGGS
GLGB2_XANC5     XXXXXXNR-DPGAVPAPLSIYEVHAASWRRDHNQPLDWPTLAEQLIPYVQQLGFTHIELLPITEHPFGGS
GLGB_BURPS      DDAWLRARASLDLAHAPVSIYEVHPESWAAEGNRSATWDELAQRLIPYAAGMGFSHVELTPIAEYPFGGS
GLGB_BURP1      DDAWLRARASLDLAHAPVSIYEVHPESWAAEGNRSATWDELAQRLIPYAAGMGFSHVELTPIAEYPFGGS
GLGB_BURP0      DDAWLRARASLDLAHAPVSIYEVHPESWAAEGNRSATWDELAQRLIPYAAGMGFSHVELTPIAEYPFGGS
GLGB_BORBR      DEAWMEQRAARQRCDAPISIYEVHAGSWFDDAGA-PRWQSLAARLPEYARSLGFTHIELLPVMAHPFGGS
GLGB_BORPA      DEAWMEQRAARQRCDAPISIYEVHAGSWFDDAGA-PRWQSLAARLPEYARSLGFTHIELLPVMAHPFGGS
GLGB_BORPE      DKAWMEQRAARQRCDAPISIYEVHAGSWFDDAGA-PRWQNLAARLPEYARSLGFTHIELLPVMAHPFGGS
GLGB_BURS3      DEGWMHARPRADRYRVPWSIYEVHAESWQREMNRSATWDELAERLIPYVQGMGFTHVEFMPIAEYPFGGS
GLGB_DICDI      PSKQYVFKNKSPMKPTELRIYEAHVGM-SSELPEISTYSKFKDTVLPMVKELGYNCIQLMAVMEHAYYAS
GLGB_CRYNE      PPKEQQYQFKHGHSTRPLKIYEAHVGI-SSPNMRVTTYKEFEVDVLPKIKQLGYNCIQMMAIMEHAYYAS
GLGB_HUMAN      PEHSYEFKHSRPKKPRSLRIYESHVGI-SSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYAS
GLGB_YARLI      PPESEKYQWKNKSPPTPANIYEAHVGI-SSSEPRVGTYKEFTKNILPRIHKLGYNVIQLMAIMEHAYYAS
GLGB_FELCA      PEHPYKFKHSRPKKPRGVRIYESHVGI-SSYEGKIASYKHFTYNVLPRIKDLGYNCIQMMAIMEHAYYAS
GLGB_MOUSE      EDPYKFKHSRPKK-PRSLRIYESHVGI-SSHEGKIASYKHFTSNVLPRIKDLGYNCIQLMAIMEHAYYAS
GLGB_HORSE      PEQPYKFKHSRPKKPRSLRIYESHVGI-SSHEGKIASYKHFTCNVLPRIKGLGYNCIQMMAIMEHAYYAS
GLGB_GLOIN      PPQKYQWKNNSPKKPTSLRIYEAHVGI-STNEGRVGTYNEFTDNVLKRIKDLGYNAIQLMAIMEHAYYAS
GLGB_ASPOR      PPT--EKQYKFQYSPESLRIYEAHVGI-SSPETKVATYKEFTSNMLPRIKYLGYNAIQLMAIMEHAYYAS
GLGB_EMENI      AERYNFQHARPKKPES-LRIYEAHVGI-SSPDTRVATYKEFTANMLPRIKYLGYNAIQLMAIMEHAYYAS
GLGB_CANGA      GRFWKHQRPKFNLANDSIKIYEAHIGI-SSPEPKVASYKEFTQNVLPRIKHLGYDAIQLMAIMEHAYYAS
GLGB_YEAST      PEKFVHPRPKFSESVDSLRIYEAHVGI-SSPEPKITTYKEFTEKVLPRIKYLGYDAIQLMAIMEHAYYAS
GLGB_DEBHA      PQKFKHERPRLESKDG-IKIYEAHVGI-STPEPKVGSYKNFTTKVLPVIHKLGYNTIQLMAVMEHAYYAS
GLGB_ASHGO      PYKFKHERPRLDPNVESLRIYEAHVGI-STPEPRVGSYSEFTKDVLPRIRDLGYNAIQLMAIMEHAYYAS
GLGB_KLULA      TAKQWGPSYEARFWNPPVHIYEAHVGI-STPEPKVGSYKEFTQNVLPRIKDLGYDAIQLMAIMEHAYYAS
GLGB_MAIZE      EEKYVFRHAQPKR-PKSLRIYETHVGM-SSPEPKINTYVNFRDEVLPRIKKLGYNAVQIMAIQEHSYYGS
GLGB_SOLTU      DATKFAAPYDGVYWDPPPSIYEAHVGM-SSSEPRVNSYREFADDVLPRIKANNYNTVQLMAIMEHSYYGS
GLGB_ORYSJ      GVHWDPPACERYVFKHPRRIYEAHVGM-SGEEPEVSTYREFADNVLPRIRANNYNTVQLMAIMEHSYYAS
TREZ_ARTSQ      DDAWQGRELQGAV------IYELHLGTFTPEGTLEAAAGKLD-----YLAGLGVDFIELLPVNAFNGTHN
PULA_BACSU      PLKPFSHPVDAVIYETHLRDFSIHENSGMINKGKYLALTETDTQTANYVKELGVTHVELLPVNEKPLDAN
TREZ_BREHE      DSRWRGKELQGTL------IYQLHVGT-STPDG---TLDAAGEKL-SYLVDLGIDFIELLPVNGFNGTHN
TREZ_MYCTU      -------------------IYELHIXXXXXXXXXXXXIEKLD-----YLVDLGIDFVELMPVNSFAGTRG
ISOA1_ARATH     GDMHLKLPQKD------LVIYEMHVRGFTRHESSKITYQGVAEKL-DHLKELGINCIELMPCHEHRVNF-
TREZ_RHIS1      DAGWQGRELQGSV------IYELHIGTFTPEG----TLDAAAGKL-DYLAGLGIDFIELLPVNAFNGTHN
PULA_THEMA      NDRG----PKIEGYEDAI-IYEIHIASGVKNKGLYLGLTEENTKGPSHLVELGVTHVHILPFFDFELDKN
GLGX_HAEIN      DNAHLAPRAEEFDWENDTSVYELHVKGFSQLNEKIPTYTGLAHPVNAYLKELGVTAVELLPVNFHGLQNY
TREZ_ARTRM      DDGW-RGRDLTGAV-----IYELHVGTFTPEG----TLDSAIRRLDHLVR-LGVDAVELLPVNAFNGTHG
NEPU_BACST      -----------------------------------------------YLVDLGITGIYLTPIFRSP--SN
GLGX_MYCTU      SDWAYDRSPRTPYHETV--IYEAHVKGMTQTHPSIPTYAGLHPVIIDHLNELNVTAVELMPVHQFLHDSR
GLGX_MYCBO      SDWAYDRSPRTPYHETV--IYEAHVKGMTQTHPSIPTYAGLHPVIIDHLNELNVTAVELMPVHQFLHDSR
CDAS_THEP3      -----------------------------------------------YLKDLGINAIYLTPIFLS--HST
AMYB_PAEPO      -----------------------------------------------YIKNMGFTAIWITPVTMQKSEYA
GLGX_YERE8      GD-----RRPTIPWGNTV-IYEAHVRGLTQLHPDIPTYAGLHPAMIQYLQKLGITTLELLPVQFHGLSNY
ISOA3_ARATH     DDYKFP-----NIPEKDLVIYEMNVRAFTADESSGMSYLGFIEKIP-HLQDLGINAVELLPVFENPRDHT
O16G3_BACSU     -------------------VYQIYPRSFKDSNGDGIGDIQGIRTKLSYIKELGADVIWICPLYDSP-NAD
MALT_SCHPO      ------EKIKPNWW-RETSVYQIYPASFKDSNGDGFGDLEGIISKVDYLKALNVESIWLCPIYPSPLK-D
GLGX_ENT38      GDSSPDPWGNTVIYEHVKGLTYLHPAIPKEIRG---TYKALGHVMIAYLKHLGITSLELLPLQRLGLTNY
MAL2_DROME      ------------------NYYQIYPRSFRDSDGDGIDLNGVTEKL-QYLKDIGFTGTWLSPIFKSPM-VD
CDGT_BACOH      --------------------------------------DKINDG---YLTDLGITAINVYALHPSGYTSY
AMYM_BACAD      DTVWYERFANGNKDNDPDGTLP-----WGSREPEIDNFGDLEGVIEHYLKELGIGGIYFTPIFK--AHSN
CDGT_KLEOX      EETYLDFRKETIYFGDPSNNAGFNSATYDPNNLKKYTGGDLRGLINKYLKSLGVTSIWITPPIDNVTDAA
MALT_AEDAE      ------------------NFYQVYPRSFKXXXXXXXXXXXXVTEKLKYLKDIGMDGVWLSPIFSSPM-AD
AMYA_ASPNG      -----------------------------------------------YIEGMGFTAIWISPITEQPQDAY
GLGX_YERPB      GDK-----PPAIPWGNTV-VYEAHVRGLTQLHPDIPTYAALHPALIEHLKTLGITTLELLPVQFHGLSNY
BBMA2_BACSU     -----------------------------------------------YLEDLGVNGIYLTPIFSAP--SN
BBMA1_BACSU     -----------------------------------------------YLEDLGVNGIYLTPIFSAP--SN
ISOA_PSEUM      -----------------------------------------------YLASLGVTAVEFLPVQETQNDAN
ISOA_PSEAY      -----------------------------------------------YLASLGVTAVEFLPVQETQNDAN
GLGX_YERPY      GDK-----PPAIPWGNTV-IYEAHVRGLTQLHPDIPTYAALHPALIEHLKTLGITTLELLPVQFHGLSNY
GLGX_YERPS      GDK-----PPAIPWGNTV-IYEAHVRGLTQLHPDIPTYAALHPALIEHLKTLGITTLELLPVQFHGLSNY
GLGX_YERPP      GDK-----PPAIPWGNTV-IYEAHVRGLTQLHPDIPTYAALHPALIEHLKTLGITTLELLPVQFHGLSNY
GLGX_YERPN      GDK-----PPAIPWGNTV-IYEAHVRGLTQLHPDIPTYAALHPALIEHLKTLGITTLELLPVQFHGLSNY
GLGX_YERPG      GDK-----PPAIPWGNTV-IYEAHVRGLTQLHPDIPTYAALHPALIEHLKTLGITTLELLPVQFHGLSNY
GLGX_YERPE      GDK-----PPAIPWGNTV-IYEAHVRGLTQLHPDIPTYAALHPALIEHLKTLGITTLELLPVQFHGLSNY
GLGX_YERPA      GDK-----PPAIPWGNTV-IYEAHVRGLTQLHPDIPTYAALHPALIEHLKTLGITTLELLPVQFHGLSNY
GLGX_CITK8      DDA-----APRTPWGNTV-IYEAHV--------KGLTY--LHPAIPSYFKQLGITALELLPLQRLGLSNY
GLGX_YERP3      GDK-----PPAIPWGNTV-IYEAHVRGLTQLHPDIPTYAALHPALIEHLKTLGITTLELLPVQFHGLSNY
GLGX_ERWT9      DDTWVPWGSTVIYEAHVRGLTQLHPGIPAEMRG---TYAALGHVMIDYFQRLGITSLQLLPLLRLGLSNY
AMY2_DICT6      -----------------------------------------------YIENLGINTIWISPIFKST--SY
GLGX_SHIBS      DDA-----PPRTPWDSTI-IYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_SHIB3      DD------APPRTPWGSTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_SHIFL      DD------APPRTPWGSTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_SHIF8      DD------APPRTPWGSTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_SHIDS      DD------APPRTPWGSTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_ECOL6      DD------APPRTPWGSTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_ECO81      DD------APPRTPWGSTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
AMY2_DEBOC      -----------------------------------------------YIQGMGFTAIWISPVVEQPDDTG
MALT_CANAL      -------------------VYQIWPASYKDSNGDGVDIPGIISTL-DYIASLGVTTVWLSPMYDSPQD-D
GLGX_SHISS      DD------APPRTPWGSTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_ECOUT      DD------APPRMPWGCTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_ECOK1      DD------APPRMPWGCTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_ECO45      DD------APPRMPWGCTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
CDGT_BACS2      --------------------------------------DKINDG---YLTDLGITALNVYALHPSGYTSY
AMY3_DICT6      ------------WYKNAI-FYEVFVRSFADSDGDRV--GDLNGLIDKYFKNLNITALWLMPIF--PSVSY
GLGX_SALPK      DDA-----APRTPWGKTV-IYEAHV--------KGLTY--LHPELPQYFKQLGITALELLPLQRMGLTNY
GLGX_SALPA      DDA-----APRTPWGKTV-IYEAHV--------KGLTY--LHPELPQYFKQLGITALELLPLQRMGLTNY
GLGX_ESCF3      -----------------------------------------------YFKRLGITALELMPLQRLGLTNY
GLGX_ECOSM      DD------APPRTPWGSTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_ECOSE      DD------APPRTPWGSTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_ECOLI      DD------APPRTPWGSTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_ECOL5      DD------APPRTPWGSTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_ECODH      DD------APPRTPWGSTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_ECOBW      DD------APPRTPWGSTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_ECO8A      DD------APPRTPWGSTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_ECO7I      DD------APPRTPWGSTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_ECO5E      DD------APPRTPWGSTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_ECO57      DD------APPRTPWGSTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_ECO55      DD------APPRTPWGSTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_ECO27      DD------APPRTPWGSTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_ECO24      DD------APPRTPWGSTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_SALPB      DDA-----APRTPWGKTV-IYEAHV--------KGLTY--LHPELPQYFKQLGITALELLPLQRMGLTNY
GLGX_ENTS8      DD------APPNIAWGETVIYEAHVRGLTRLHPDIPTYAALGHAMIAWFQRLGITALELQPLQRLGLANY
GLGX_ECOLU      DD------APPRTPWGSTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_ECOLC      DD------APPRTPWGSTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
GLGX_ECOHS      DD------APPRTPWGSTIIYEAHVKGLTYLHPEIPTYKALGHVMINYLKQLGITALELLPLQRMGLSNY
CDGT_BACS3      -----------------------------------------------------YSVINYSGVHN---TAY
TRES_THETH      -------------------IYQLHVRSFDANNDGYGDFEGLRRKLP-YLEELGVNTLWLMPFFQSPLRDD
NEPU2_THEVU     -----------------------------------------------YLEELGVTALYFTPIFASP--SH
MDE5_SCHPO      -----------------------------------------------YIQGMGFTAIWISPIIKNIEEAY
MAL2_DROVI      --------------------YQIYPRSFKDSNGDGIDLQGVISKLP-YLAETGITATWLSPIFQSPM-VD
MAL1_APIME      -------------------VYQVYPRSFKDSNXXXXXXXXXXXXXLDHFLEMGVDMFWLSPIYPSPM-VD
GLGX_SERP5      DDPW----GKTVIYEAHVRGLTLHPEIPQVLRGSFAALG--HPVMIAYFKRLGITALELLPVQQHSSEPR
GLGX_SALSV      DDA-----APRTPWGKTV-IYEAHV--------KGLTY--LHPELPQYFKQLGITALELLPLQRMGLTNY
GLGX_SALA4      DDA-----APRTPWGKTV-IYEAHV--------KGLTY--LHPELPQYFKQLGITALELLPLQRMGLTNY
GLGX_KLEP7      GDK----PPRTPWGETV--IYEAHVKGLTLLNPQLPTYKALGHAMIAYFKSLGISALELLPLQRMGLSNY
CDGT_BACS0      ----------------------------------------------------------------------
MAL1_DROVI      ------KKHKPNELDDNINFYQIYPRSFKDSDGDGIGDLKGITSKLQYFVDTGITAIWLSPIYKSPM-VD
GLGX_SALTY      DDA-----APRTPWGKTV-IYEAHV--------KGLTY--LHPELPQYFKQLGITALELLPLQRMGLTNY
GLGX_SALPC      DDA-----APRTPWGKTV-IYEAHV--------KGLTY--LHPELPQYFKQLGITALELLPLQRMGLTNY
GLGX_SALNS      DDA-----APRTPWGKTV-IYEAHV--------KGLTY--LHPELPQYFKQLGITALELLPLQRMGLTNY
GLGX_SALHS      DDA-----APRTPWGKTV-IYEAHV--------KGLTY--LHPELPQYFKQLGITALELLPLQRMGLTNY
GLGX_SALG2      DDA-----APRTPWGKTV-IYEAHV--------KGLTY--LHPELPQYFKQLGITALELLPLQRMGLTNY
GLGX_SALEP      DDA-----APRTPWGKTV-IYEAHV--------KGLTY--LHPELPQYFKQLGITALELLPLQRMGLTNY
GLGX_SALCH      DDA-----APRTPWGKTV-IYEAHV--------KGLTY--LHPELPQYFKQLGITALELLPLQRMGLTNY
CDGT_BREBE      ----------------------------------------INKMNDGYLTDLGITALNVYALHPSGYTSY
CDAS_BACSH      -----------------------------------------------YLSDLGVNALYFNPLFAATTNHK
AMY1_SACFI      -----------------------------------------------YIKDMGFTAIWISPVVENPDNTA
GLGX_SALDC      DDA-----APRTPWGKTV-IYEAHV--------KGLTY--LHPELPQYFKQLGITALELLPLQRMGLTNY
AMY_ASPSH       -----------------------------------------------YIQGMGFTAIWITPVTAQLPDAY
AMYB_ASPAW      -----------------------------------------------YIQGMGFTAIWITPVTAQLPDAY
AMYA_ASPAW      -----------------------------------------------YIQGMGFTAIWITPVTAQLPDAY
AMYA1_ASPOR     -----------------------------------------------YIQGMGFTAIWITPVTAQLPDAY
GLGX_SALTI      DDA-----APRTPWGKTV-IYEAHV--------KGLTY--LHPELPQYFKQLGITALELLPLQRMGLTNY
CDGT2_PAEMA     ----------------------------------------------------------------------
AMYM_BACST      --------------NNPAKSYGLYKSKWKMYWGGDL--EGVRQKLP-YLKQLGVTTIWLSPVLDN-LDTL
AMY3_WHEAT      --------------------------SWKTQGGWY----KFMQGKVEEIASTGATHVWLPPPSQSV--SP
AMY1_LIPKO      -----------------------------------------------YIQGMGFTAIWISPIVENPDDTG
O16G2_BACSU     ---------KTDWWKDAV-VYQIYPRSFQDSNGDGI--GDLRGIISRYIKELGADVIWICPIYPSP-NVD
AMYA3_ASPOR     -----------------------------------------------YIQGMGFTAIWITPVTAQLPDAY
ISOA2_ARATH     -----------------------------------------------HLKTLGTNAVLLEPIFSFS-EQK
GLGX_KLEP3      -----------------------------------------------YFKSLGISALELLPLQRMGLSNY
CDGT1_PAEMA     ----------------------------------------------------------------------
AMYS_NEIPO      ----------------------------------------LKDKIP-YFQELGLTYLHLMPLFKCPEGKS
AMY2A_ORYSJ     ----------------------------------------------------GVTHV-WLPPPSHSVSTQ
AMY2A_ORYSI     ----------------------------------------------------GVTHV-WLPPPSHSVSTQ
MAL1_DROME      -----EGTADIDWWENA-SLYQIYPRSFQDSDGDGIGDLKGITSRLGYLKEIGITATWLSPIFTSPM-SD
MGTA_THENE      -----------------------------------------------YLKELGVDFVWLMPVFSSI--SF
AMYS_NEIME      -----------------------------------------------YFQELGLTYLHLMPLFKCPEGKS
AMY1_HORVU      --------------------------SWKQSGGWYMMMGKVDD-----IAAAGVTHV-WLPPPSHSV-SN
O16G_BACTR      -------------------VYQIYPRSFYDSNXXXXXXXXXXXAKLDYLKELGVDVVWLSPVYKSPNDDN
O16G_BACF5      -------------------VYQIYPRSFYDSNGD--GFGDLQGVIQKYIKRLGADVIWLCPVFDSPQDDN
MAL3_DROME      --------------------YQIYPRSFKDSDGDGVDLIGITQQLP-YLKEIGITATWLSPIFTSPM-AD
MALX1_YEAST     -------------------VYQIYPASFKDSNNDGWGDLAGITSKLDYVKELGVDAIWVCPFYDSPQE-D
AMY4_SCHPO      -----------------------------------------------YIRDLGFTAISISPVPEYHGEAY
YQ29_SCHPO      -----------------------------------------------YIKSLGCTAIWISPIVKNISEAY
TREC_BACSU      -------------------VYQIYPKSFNDTTGNGV--GDLNGIIEKYLKTLQVDVLWLTPIYDSPQHDN
APU_THEP3       ----------------------------------------INDKL-DYLKNLGISVIYLNPIFQSP--SN
TGS1_HUMAN      ----------------------------------------------------------------------
AMY_STRVL       ----------------------------------------------------GYGYVQVSPPQEHLQGGQ
O16G_BACCO      -------------------VYQIYPRSFYDTNGDGI--GDLRGIMDKYLKTLGIDCIWISPVYDSPQDDN
CDGT2_BACCI     ----------------------------------------------------------------------
CDGT_BACST      ----------------------------------------INKINDGYLTDMGVTAIVFSVMNDASGSAS
AMY1_DEBOC      -----------------------------------------------YIQGMGFTAIWISPVVEQPDNTA
O16G1_BACSU     -------------------VYQIYPRSFYDANGD--GFGDLQGVIQKYIKNLGADVIWLSPVFDSPQDDN
CDGT_THETU      ----------------------------------------------------------------------
O16G_BACCE      -------------------VYQIYPRSFMDSNGDGI--GDLRGIISKYLKELGIDVIWLSPVYESPNDDN
MGTA_THEMA      -----------------------------------------------YLKELGIDFVWLMPVFSSI--SF
MALX4_YEAST     -------------------IYQIYPASFKDSNNDGWGDMKGIASKLEYIKELGADAIWISPFYDSPQD-D
MALX2_YEAST     -------------------IYQIYPASFKDSNNDGWGDMKGIASKLEYIKELGTDAIWISPFYDSPQD-D
CDGT_BACS8      ----------------------------------------------------------------------
CDGT_BAC11      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           WGYQPTGFYSVNSRHGDIIGLKRLVDKLHNNDIGVILDWVPGHFCKDQHGLIYFDGSPCYEYQEPTKAIN
GLGB_FRATM      WGYQPTGFYSVNSRHGDIIGLKRLVDKLHNNDIGVILDWVPGHFCKDQHGLIYFDGSPCYEYQEPTKAIN
GLGB_FRATW      WGYQPTGFYSVNSRHGDIIGLKRLVDKLHNNDIGVILDWVPGHFCKDQHGLIYFDGSPCYEYQEPTKAIN
GLGB_FRATT      WGYQPTGFYSVNSRHGDIIGLKRLVDKLHNNDIGVILDWVPGHFCKDQHGLIYFDGSPCYEYQEPTKAIN
GLGB_FRAT1      WGYQPTGFYSVNSRHGDIIGLKRLVDKLHNNDIGVILDWVPGHFCKDQHGLIYFDGSPCYEYQEPTKAIN
GLGB_FRATO      WGYQPTGFYSVNSRHGDIIGLKRLVDKLHNNDIGVILDWVPGHFCKDQHGLIYFDGSPCYEYQEPTKAIN
GLGB_FRATF      WGYQPTGFYSVNSRHGDIIGLKRLVDKLHNNDIGVILDWVPGHFCKDQHGLIYFDGSPCYEYQEPTKAIN
GLGB_FRATH      WGYQPTGFYSVNSRHGDIIGLKRLVDKLHNNDIGVILDWVPGHFCKDQHGLIYFDGSPCYEYQEPTKAIN
GLGB_FRATN      WGYQPTGFYSVNSRHGDIIGLKRLVDKLHNNDIGVILDWVPGHFCKDQHGLIYFDGTPCYEYQEHTKAIN
GLGB_FRAP2      WGYQPTGFYSINSRHGDLVGLKHLVDKLHTHDIGVILDWVPGHFCKDQHGLINFDGSACYEYQEPTKAIN
GLGB_CLOP1      WGYQGVGYYSVTSRYGDLNGLKALINKLHKNNIGVLLDWVPSHFCKDEHGLFMFDGSPTYEYGAWWKANN
GLGB1_CLOPE     WGYQVTGYYSITSRYGDIKGLKRLINALHKEDIGVILDWVPGHFCKDEQGLYMFDGTPTYEYEEKWKADN
GLGB2_CLOPE     WGYQGVGYYSVTSRYGDLNGLKTLINKLHKNNIGVLLDWVPSHFCKDEHGLFMFDGSPTYEYEAWWKANN
GLGB2_CLOPS     WGYQGVGYYSVTSRYGDLNGLKTLINKLHKNNIGVLLDWVPSHFCKDEHGLFMFDGSPTYEYEVWWKANN
GLGB1_CLOPS     WGYQVTGYYSVTSRYGDIKGLKRLINALHKNDIGVILDWVPGHFCKDEQGLYMFDGTPTYEYEEKWKADN
GLGB_OCEIH      WGYQITGYFAVTSRYGNPSDFKYFIDQCHQHQIGVILDWVPGHFCKDDFGLRQFDGAPLYEYRDPKKSEK
GLGB_HALOH      WGYQLTNYYSVTSRYGTPEDFMYFIDKCHQNGIGVILDWVPGHFCKDDHGLRLFDGTALYEPQDPRKAEN
GLGB_THEEB      WGYQVTGYYAPTSRYGSPHDFMYFVDQCHQNGIGVIVDWVPGHFPKDGHGLAFFDGTHLYEHADPRKGEH
GLGB_SYNJA      WGYQVIGYYAVTSRYGSPQDFMYFVDRAHQEGIGVIVDWVPGHFPKDGHGLAFFDGTHLYEYADPRKGEH
GLGB_SHESW      WGYQPVGLYAPTHRFGDANGLKAFVDACHQADIGVVLDWVAAHFPKDPHGLVRFDGTCLYEHEDPRKGTH
GLGB_SHEPC      WGYQPVGLYAPTHRFGDANGLKAFVDACHQADIGVVLDWVAAHFPKDPHGLVRFDGTCLYEHEDPRKGTH
GLGB_ANASP      WGYQVTGYYAPTSRFGTPEDFMYFVDQCHQNNIGVLVDWVPGHFPKDGHGLAFFDGTHLYEHADPRKGEH
GLGB_NITOC      WGYQTTGYFAPTSRFGSPDEFRYFVDHCHLHGIGVLMDWVPGHFPKDAHGLAQFDGSALYEHEDPRLGEH
GLGB_NITEC      WGYQVTGYFAATSRYGNPEAFMYFVDKCHQAGIGVILDWVPAHFPQDSFSLARFDGTALYEHEDPRLGYH
GLGB_BACWK      WGYQGTGYYAATSRFGTPHDLMYFVDECHKYGIGVILDWVPGHFCKDAHGLYLFDGTPTYEYKDRDVQEN
GLGB_ANAVT      WGYQVTGYYAPTSRFGTPEDFMYFVDQCHQNNIGVIVDWVPGHFPKDGHGLAFFDGTHLYEHADSRKGEH
GLGB_BACC4      WGYQGTGYYAATSRFGTPHDLMHFVDECHKYGIGVILDWVPGHFCKDAHGLYLFDGTPTYEYKDKDVQEN
GLGB_SHEON      WGYQPVGLYAPTYRFGDANGFKAFIDACHQAEIGVLLDWVAAHFPKDPHGLVRFDGTCLYEHEDPRKGTH
GLGB_NITEU      WGYQATGYFAVTSRYGSPEAFMSFVDRCHQAGIGVILDWVPAHFPQDSFSLARFDGTALYEHEDPRLGYH
GLGB_BACCR      WGYQGTGYYAATSRFGTPHDLMHFVDECHKYGIGVILDWVPGHFCKDAHGLYLFDGTPTYEYKDKDVQEN
GLGB_SYNJB      WGYQVIGYYAVTSRYGSPQDFMYFVDRAHQAGIGVIVDWVPGHFPKDGHGLAFFDGTHLYEYADPRKGEH
GLGB_SHESR      WGYQPVGLYAPTHRFGDANGLKAFIDACHQAEIGVLLDWVAAHFPKDPHGLVRFDGTCLYEHEDPRKGTH
GLGB_BACHK      WGYQGTGYYAATSRFGTPYDLMHFVDECHKYGIGVILDWVPGHFCKDAHGLYLFDGTPTYEYKDKDVQEN
GLGB_BACC3      WGYQGTGYYAATSRFGTPYDLMHFVDECHKYGIGVILDWVPGHFCKDAHGLYLFDGTPTYEYKDKDVQEN
GLGB_BACC0      WGYQGTGYYAATSRFGTPYDLMHFVDECHKYGIGVILDWVPGHFCKDAHGLYLFDGTPTYEYKDKDVQEN
GLGB_BACAN      WGYQGTGYYAATSRFGTPHDLMHFVDECHKYGIGVILDWVPGHFCKDAHGLYLFDGTPTYEYKDKDVQEN
GLGB_BACAC      WGYQGTGYYAATSRFGTPHDLMHFVDECHKYGIGVILDWVPGHFCKDAHGLYLFDGTPTYEYKDKDVQEN
GLGB_BACAA      WGYQGTGYYAATSRFGTPHDLMHFVDECHKYGIGVILDWVPGHFCKDAHGLYLFDGTPTYEYKDKDVQEN
GLGB_BACC2      WGYQGTGYYAATSRFGTPHDLMYFVDECHKYGIGVILDWVPGHFCKDAHGLYLFDGTPTYEYKDKDVQEN
GLGB_BACCZ      WGYQGTGYYAATSRFGTPHDLMHFVDECHKYGIGVILDWVPGHFCKDAHGLYLFDGTPTYEYKDKDVQEN
GLGB_SHESM      WGYQPVGLYAPTHRFGDANGLKAFIDACHQAEIGVLLDWVAAHFPKDPHGLVRFDGTCLYEHEDPRKGTH
GLGB_HAES1      WGYQPIGLYSPTSRFGTAEGFKRLVNKAHKAGINVILDWVPGHFPSDTHGLVAFDGTALYEHADPKEGYH
GLGB_TRIEI      WGYQVTGFFAPTSRYGSAQDFMYFVDKCHENGIGVIVDWVPGHFPKDGHGLAFFDGTHLYEHPDPRKGEH
GLGB_MARAV      WGYQTTGYYAPTSRFGSPDDLRYFVDQCHQNNIGVILDWVPGHFPDDDFALAEFDGTALYEHEDPRRGRH
GLGB_PROMA      WGYQVTGWYAPTSRYGTPDEFRAFVDTCHSEGIGVILDWVPGHFPKDEHGLAFFDGKHLYEHADPRIGEH
GLGB_MANSM      WGYQPLGLYAPTSRFGTPDGFKRLIEKAHESGINVILDWVPGHFPSDTHGLAAFDGTSLYEYADPKEGYH
GLGB_SYNP6      WGYQVTGYYAATSRYGSPEDFMYFVDRCHQNGIGVILDWVPGHFPKDGHGLAFFDGTHLYEHADSRQGEH
GLGB_SYNE7      WGYQVTGYYAATSRYGSPEDFMYFVDRCHQNGIGVILDWVPGHFPKDGHGLAFFDGTHLYEHADSRQGEH
GLGB_HAES2      WGYQPIGLYSPTSRFGTAEGFKRLVNKAHKAGINVILDWVPGHFPSDTHGLVAFDGTALYEHADPKEGYH
GLGB_BACCQ      WGYQGTGYYAATSRFGTPHDLMHFVDECHKYGIGVILDWVPGHFCKDAHGLYLFDGTPTYEYKDKDVQEN
GLGB_SHEB9      WGYQPVGLYAPTHRFGDANGLKAFVDACHQAGIGIILDWVSAHFPKDPHGLVRFDGTCLYEHEDPRKGTH
GLGB_NITMU      WGYQTTGYFAATSRYGTSDDLKFFINACHQEGIGVILDWVPAHFPQDAFALARFDGSALYEHEDPRMGLH
GLGB_SYNY3      WGYQVTGYYAPTSRFGSPEDFMYFVDQCHLNGIGVIIDWVPGHFPKDGHGLAFFDGTHLYEHGDPRKGEH
GLGB_THICR      WGYQTTGYFSPTSRFGSPDDFRYFVNYCHENGIGVFLDWVPAHFPKDEFALARFDGTALYEHEDPRRGEH
GLGB_SHEB8      WGYQPVGLYAPTHRFGDANGLKAFVDACHQAGIGIILDWVSAHFPKDPHGLVRFDGTCLYEHEDPRKGTH
GLGB_CELJU      WGYQTTGYYAPTSRFGSPDDFRYFVDHLHQQGIGIILDWVPAHFPKDAHALARFDGSALYEHEDPRLGEH
GLGB_SHEB5      WGYQPVGLYAPTHRFGDANGLKAFVDACHQAGIGIILDWVSAHFPKDPHGLVRFDGTCLYEHEDPRKGTH
GLGB_SHEB2      WGYQPVGLYAPTHRFGDANGLKAFVDACHQAGIGIILDWVSAHFPKDPHGLVRFDGTCLYEHEDPRKGTH
GLGB_PROMP      WGYQVTGWYAPTSRYGTPNEFKEFINRCHAEGIGVILDWVPGHFPKDKHGLAFFDGCHLYEHGDPRIGEH
GLGB_THIDA      WGYQVSGYYAATARFGSPDDLRAFVDACHQAGLGVLLDWVPGHFPKDDFALARFTGEPLYEHADPRRGEH
GLGB_GLOVI      WGYQVLGYYAPTSRFGNPTEFMAFVDRCHQSGIGVILDWVPAHFPKDGHGLALFDGTHLYEHADSRQGEH
GLGB_RHOBA      WGYQSVGYYAPTSRHGSPEDFMFFVDHMHQNGIGVLIDWVPAHFPKDDHGLRQFDGSALYEHADPRQGEH
GLGB_RHORT      WGYQPIGLFAPTSRFGEPDDFRHFVDRCHQEGVGVILDWVAGHFPEDAHGLSWFDGTHLYEHSDPRQGRH
GLGB_AQUAE      WGYQITGYFAPTSRYGTPQDFMYLIDKLHQEGIGVILDWVPSHFPTDAHGLAYFDGTHLYEYEDWRKRWH
GLGB_ACTP2      WGYQPTGLYSPTSRFGSPEDLRTLIRKAHEAGINVILDWVVGHFPTDSHGLTEFDGSHLYEHQDPREGYH
GLGB_BACCN      WGYQGTGYYAVTSRFGTPHDFMYFVDECHKYGIGVILDWVPGHFCKDAHGLYLFDGTPTYEYRDLDVQEN
GLGB_DESHY      WGYQITGFYACTSRYGTPHDLMYLIDQCHQAGIGVILDWVPGHFCMDAHGLGKFDGSPLYE-----REVH
GLGB_BACC1      WGYQGTGYYAATSRFGTPHDLMHFVDECHKYGIGVILDWVPGHFCKDAHGLYLFDGTPTYEYKDKDVQEN
GLGB_SYNS3      WGYQVTGWYAPTSRYGTPDEFRAFVDRCHAEGIGVIIDWVPGHFPKDSHGLAFFDGCHLYEHADPRIGEH
GLGB_ACTPJ      WGYQPTGLYSPTSRFGSPDDLRTLIRKAHEAGINVILDWVVGHFPTDSHGLTEFDGSHLYEHQDPREGYH
GLGB_PASMU      WGYQPLGLYSPTSRFGTAEGFKRLIEKAHQAGINVILDWVPGHFPSDTHGLAAFDGTALYEHADPREGYH
GLGB_BACC7      WGYQGTGYYAATSRFGTPHDLMYFVDECHKYGIGVILDWVPGHFCKDAHGLYLFDGTPTYEYKDKDVQEN
GLGB_ACTP7      WGYQPTGLYSPTSRFGSPDDLRTLIRKAHEAGINVILDWVVGHFPTDSHGLTEFDGSHLYEHQDPREGYH
GLGB_RUBXD      WGYQPVGLFAPTSRFGPPEDFKHLVDAFHRAGVGVIADWVPAHFPEDAHGLARFDGTHLYEHADPRKGRH
GLGB_BACST      WGYQGIGYYSATSRYGTPHDLMYFIDRCHQAGIGVILDWVPGHFCKDSHGLYMFDGAPAYEYANMQDREN
GLGB_HAEIN      WGYQPLGLYSPTSRFGSPEAFRRLVKRAHEAGINVILDWVPGHFPSDTHGLVAFDGTALYEHEDPREGYH
GLGB_SACD2      WGYQPVGLYAPTSRFGSPEDFKYFVDCCHQNDLAVLIDWVPGHFPTDSHGLGLFDGTPLYEHADSRQGFH
GLGB_PROM5      WGYQVTGWYAPTSRYGTPNEFKEFINKCHAEGIGVILDWVPGHFPKDKHGLAFFDGCHLYEHGDPRIGEH
GLGB_SYNSC      WGYQVTGWYAPTSRYGTPDEFRAFVDRCHAEGIGVIIDWVPGHFPKDAHGLAFFDGAHLYEHSDPRIGEH
GLGB_HAEIG      WGYQPLGLYSPTSRFGSPEAFSRLVKRAHEAGINVILDWVPGHFPSDTHGLVAFDGTALYEHEDPREGYH
GLGB_PARUW      WGYQVSGFYAPTSRFGHPEDFQYFVNYLHQHQISLILDWVPGHFPTDAFSLARFDGSALYEHADPRQGYH
GLGB_HAEI8      WGYQPLGLYSPTSRFGSPEAFRRLVKRAHEAGINVILDWVPGHFPSDTHGLVAFDGTALYEHEDPREGYH
GLGB_SYNPW      WGYQVTGWYAPTSRYGTPDEFRAFVDRCHAEGIGVIIDWVPGHFPRDSHGLAFFDGCHLYEHADPRIGEH
GLGB_PROM4      WGYQATGWYAPTSRYGTPNEFRAFVDACHSEGIGVILDWVPGHFPKDSHGLAFFDGSHLYEHSDPRIGEH
GLGB_ACTSZ      WGYQPIGLYAPTSRFGSPEGFKRFVDKAHAAGINVILDWVPGHFPSDTHGLATFDGTALYEHADPKEGYH
GLGB_METCA      WGYQTTGYFAPTSRFGTPDDFRYFVDHCHRNGIGVILDWVPAHFPKDAHGLARFDGTALYEHEDPRLGEH
GLGB2_RHIEC     WGYQPLGLFAPTGRYGTPEDLAYFIDRCHGAGIGVILDWVPAHFPTDVWGLARFDGTALYEHEDPREGFH
GLGB_BACCL      WGYQGTGYYSVTSRYGTPHDFMYFVDRCHQAGLGVIIDWVPGHFCKDAHGLYMFDGAPTYEYANEKDREN
GLGB_SHEFN      WGYQPVGLFAPTYRFGDANGLRAFIDECHQQGIAVLLDWVPAHFPRDPHGLVRFDGSCLYEHDDPRKGEQ
GLGB_METFK      WGYQTTGYFAPTNRFGSPDDLRYFVDQCHQAGIGVILDWVPGHFPKDDWALARFDGSALFEHEDPRLGEH
GLGB_PROMM      WGYQVTGWYAPTSRFGSPDEFRAFVDRCHAEGLGVIIDWVPGHFPKDGHGLAFFDGTHLYEHSDPRIGEH
GLGB1_RHIEC     WGYQTTGLYAPTARFGEPEGFARFVNGCHKVGIGVILDWVPAHFPTDEHGLGWFDGTALYEHEDPRKGFH
GLGB_PROM3      WGYQVTGWYAPTSRFGSPDEFRAFVDRCHAEGLGVIIDWVPGHFPKDGHGLAFFDGTHLYEHSDPRIGEH
GLGB_SYNS9      WGYQVTGWYAPTSRYGTPDEFRAFVDRCHAEGIGVIIDWVPGHFPKDAHGLAFFDGTHLYEHGDPRIGEH
GLGB_RHOFD      WGYQTTGYFAPTSRFGTPQDFMHFVDHLHQRGIGVLLDWVPSHFPTDEHGLGYFDGTHLFEHSDPRQGFH
GLGB1_RHIL3     WGYQTTGLYAPTARFGEPEGFARFVNGCHKVGIGVILDWVPAHFPTDEHGLGWFDGTALYEHEDPRKGFH
GLGB_PSEPK      WGYQPLSMFAPTSRYGSAEDFAAFIDACHQGGIGVLLDWVPAHFPTDEHGLARFDGTALYEYDNPLEGYH
GLGB_PROMT      WGYQVTGWYAPTSRFGSPDEFRAFVDSCHKEGIGIILDWVPGHFPKDQHGLAYFDGSHLYEHSDPRVGEH
GLGB_AZOSE      WGYQTTGYFAATARYGTPDDLMFLIDTLHQAGVGVILDWVPSHFPSDAHGLAEFDGTYLYEHADPRQGFH
GLGB_RHIME      WGYQTTGLYAPTARFGEPEGFARFVNGCHKVGIGVILDWVPAHFPTDEHGLRWFDGTALYEHADPRQGFH
GLGB_RHOP5      WGYQPTGLFAPTSRFGTPEDFAALVDACHAHGLGVLLDWVPGHFPDDPHGLAHFDGTSLYEHANPLQGRH
GLGB_CORDI      WGYQVSGYYAPTSRWGTPDQLRLLIDAFHQAGIGVIVDWVPAHFPKDAFALGRFDGQALYEHPDWRRGEQ
GLGB_STRAU      WGYQVTGFYAPTSRMGTPDDFRFLVDALHRAGIGVIVDWVPAHFPRDDWALAEFDGRPLYEHQDPRRAAH
GLGB_PROM1      WGYQVTGWYAPTSRFGSPDEFRAFVDSCHKEGIGIILDWVPGHFPKDQHGLAYFDGSHLYEHSDPRVGEH
GLGB_CORJK      WGYQVTSYYAPNNRYGGPDDLRYLIDSLHRAGIGVIMDWVPGHFPKDGWALGRFDGEACYEHPDPRRGEQ
GLGB_ERWCT      WGYQPLGLYAPTRRFGTASDFRAFVDALHGAGINVLLDWVPGHFPGDEYGLAQFDGTALYEYSDPREGYH
GLGB_BACSU      WGYQGTGYYSPTSRFGPPHDLMKFVDECHQQNIGVILDWVPGHFCKDAHGLYMFDGEPLYEYKEERDREN
GLGB2_STRCO     WGYQVTGFYAPTARLGSPDDFRFLVDALHRAGIGVIMDWVPAHFPKDDWALGRFDGDPLYEPGDSRRAEH
GLGB_SYNR3      WGYQVTGFYAPTSRFGTLDEFRAFVDRCHAEGIGVILDWVPGHFPKDAHGLAFFDGSHLYEHGDPRIGEH
GLGB_MESSB      WGYQPVGLYAPTSRFGTPEDFARFVDRCHHEGIGVIIDWVPAHFPSDAHGLARFDGTALYEHEDPRLGFH
GLGB_ALHEH      WGYQTTGYFAPTTRFGAPDDFRYFVDHCHRHGIGVILDWVPAHFPRDDWALANFDGTPLYEHADPRRGEH
GLGB1_XANCP     WGYQPLGLFAPTARFGSPDGFARFVDRCHREGIGVIVDWVPAHFPTDAHGLAHFDGTALYEHADPREGFH
GLGB1_XANC8     WGYQPLGLFAPTARFGSPDGFARFVDRCHREGIGVIVDWVPAHFPTDAHGLAHFDGTALYEHADPREGFH
GLGB1_STRAW     WGYQVTGFYAPTARLGTPDDFKYLVDALHRAGVGVLMDWVPAHFPRDDWALAEFDGRPLYEHEDPLRAAH
GLGB_NEIDE      WGYQATGLYAPTSRFGSPDELKALIDAAHAAGISVILDWVAGHFPTDDHGLNTFDGTALYEHADPREGYH
GLGB_MYXXD      WGYQVGGYYAPTARFGHPDDLRFFIDHMHQEGIGVLVDWVPGHFPRDLHALGQFDGTALYEHADPRKGAQ
GLGB1_XANAC     WGYQPLGLFAPTARFGTPDGFARFVDRCHREGIGVIVDWVPAHFPTDAHGLAHFDGTALYEHADPREGFH
GLGB_AGRT5      WGYQTTGLYAPTARFGDPEGFARFVNGAHKVGIGVLLDWVPAHFPTDEHGLRWFDGTALYEHADPRQGFH
GLGB_SYNPX      WGYQVTGWYAPTSRYGTPDEFRAFVDRCHAEGIGVIIDWVPGHFPKDAHGLAFFDGTHLYEHGDPRIGEH
GLGB_ECOL6      WGYQPTGLYAPTRRFGTRDDFRYFIDAAHAAGLNVILDWVPGHFPTDDFALAEFDGTNLYEHSDPREGYH
GLGB_DESVV      WGYQTGHYYAPTSRFGSPEGFKRFVDRCHQAGLGVILDWVPAHFPRDAWSLGRFDGTALYEHLDPRLGEH
GLGB_CORGL      WGYQVTGYYAPTSRWGTPDQFRALVDAFHARGIGVIMDWVPAHFPKDDWALARFDGEALYEHPDWRRGEQ
GLGB_ECOUT      WGYQPTGLYAPTRRFGTRDDFRYFIDAAHAAGLNVILDWVPGHFPTDDFALAEFDGTNLYEHSDPREGYH
GLGB_ECOK1      WGYQPTGLYAPTRRFGTRDDFRYFIDAAHAAGLNVILDWVPGHFPTDDFALAEFDGTNLYEHSDPREGYH
GLGB_ECO57      WGYQPTGLYAPTRRFGTRDDFRYFIDAAHAAGLNVILDWVPGHFPTDDFALAEFDGTNLYEHSDPREGYH
GLGB_SHIF8      WGYQPTGLYAPTRRFGTRDDFRYFIDAAHAAGLNVILDWVPGHFPTDDFALAEFDGTNLYEHSDPREGYH
GLGB_ERWCH      WGYQPLGLYAPTRRFGSPDDFRYLVSAFHEAGINVLLDWVSGHFPADSYGLARFDGPALYEYADPKEGYH