[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30613.1

[Show Plain Result]


## Summary of Sequence Search
    1::528
  180::497     4e-39  34%  510 aa  GLUS_METJA RecName: Full=Glutamate synthase;         EC=1.4.1.13;
  848::1172    1e-33  32% 1520 aa  GLTA_BACSU RecName: Full=Glutamate synthase [NADPH] large chain;     
  904::1251    4e-30  33% 1550 aa  GLTB_SYNY3 RecName: Full=Ferredoxin-dependent glutamate synthase 1;  
  894::1197    1e-29  32% 1515 aa  GLTB_AZOBR RecName: Full=Glutamate synthase [NADPH] large chain;     
  911::1232    2e-29  35% 1556 aa  GLTS_SYNY3 RecName: Full=Ferredoxin-dependent glutamate synthase 2;  
  900::1239    4e-29  32% 1538 aa  GLTB_PORYE RecName: Full=Ferredoxin-dependent glutamate synthase;    
  900::1225    2e-28  32% 1538 aa  GLTB_PORPU RecName: Full=Ferredoxin-dependent glutamate synthase;    
  896::1217    4e-28  33% 1536 aa  GLTB_ANTSP RecName: Full=Ferredoxin-dependent glutamate synthase;    
  907::1191    1e-27  34% 1549 aa  GLTB_CYACA RecName: Full=Ferredoxin-dependent glutamate synthase;    
  892::1193    1e-27  31% 1517 aa  GLTB_ECOLI RecName: Full=Glutamate synthase [NADPH] large chain;     
  947::1275    1e-27  30% 2111 aa  GLT1_SCHPO RecName: Full=Putative glutamate synthase [NADPH];        
  999::1325    2e-26  28% 2194 aa  GLSN_MEDSA RecName: Full=Glutamate synthase [NADH], amyloplastic;    
  940::1286    4e-26  30% 2145 aa  GLT1_YEAST RecName: Full=Glutamate synthase [NADH];       
 1058::1322    5e-26  31% 1648 aa  GLTB1_ARATH RecName: Full=Ferredoxin-dependent glutamate synthase 1,
  978::1319    1e-25  33% 1629 aa  GLTB2_ARATH RecName: Full=Ferredoxin-dependent glutamate synthase 2,
 1024::1251    3e-24  33% 1616 aa  GLTB_MAIZE RecName: Full=Ferredoxin-dependent glutamate synthase,
  871::1191    2e-20  30% 1517 aa  GLTB_SPIOL RecName: Full=Ferredoxin-dependent glutamate synthase,
  273::336     9e-06  40%  379 aa  LLDD_PSEMY RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     2e-05  39%  379 aa  LLDD_STRMK RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     2e-05  39%  379 aa  LLDD_STRM5 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::337     2e-05  40%  381 aa  LLDD_HAEIN RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::337     2e-05  40%  381 aa  LLDD_HAEIG RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::337     2e-05  40%  381 aa  LLDD_HAEIE RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::337     2e-05  40%  381 aa  LLDD_HAEI8 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::380     2e-05  31%  396 aa  LLDD_ECOUT RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::380     2e-05  31%  396 aa  LLDD_ECO45 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     3e-05  39%  381 aa  LLDD_PSEE4 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::380     4e-05  31%  396 aa  LLDD_ECOK1 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::337     4e-05  34%  381 aa  LLDD_ACTPJ RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::337     4e-05  34%  381 aa  LLDD_ACTP7 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::337     4e-05  34%  381 aa  LLDD_ACTP2 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     5e-05  39%  381 aa  LLDD_YERPY RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     5e-05  39%  381 aa  LLDD_YERPS RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     5e-05  39%  381 aa  LLDD_YERPP RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     5e-05  39%  381 aa  LLDD_YERPN RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     5e-05  39%  381 aa  LLDD_YERPG RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     5e-05  39%  381 aa  LLDD_YERPE RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     5e-05  39%  381 aa  LLDD_YERPB RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     5e-05  39%  381 aa  LLDD_YERPA RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     5e-05  39%  381 aa  LLDD_YERP3 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     5e-05  37%  381 aa  LLDD_PSEPK RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     5e-05  37%  381 aa  LLDD_PSEPG RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     5e-05  37%  381 aa  LLDD_PSEP1 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::380     6e-05  31%  396 aa  LLDD_SHIDS RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     6e-05  37%  381 aa  LLDD_PSEPW RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     6e-05  39%  381 aa  LLDD_PSEAE RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     6e-05  39%  381 aa  LLDD_PSEAB RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     6e-05  39%  381 aa  LLDD_PSEA8 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     6e-05  39%  381 aa  LLDD_PSEA7 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     8e-05  39%  396 aa  LLDD_SHISS RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     8e-05  39%  396 aa  LLDD_SHIFL RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     8e-05  39%  396 aa  LLDD_SHIF8 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     8e-05  39%  396 aa  LLDD_SHIBS RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     8e-05  39%  396 aa  LLDD_SHIB3 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     8e-05  39%  396 aa  LLDD_ECOSM RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     8e-05  39%  396 aa  LLDD_ECOSE RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     8e-05  39%  396 aa  LLDD_ECOLU RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     8e-05  39%  396 aa  LLDD_ECOLI RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     8e-05  39%  396 aa  LLDD_ECOLC RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     8e-05  39%  396 aa  LLDD_ECOL6 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     8e-05  39%  396 aa  LLDD_ECOL5 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     8e-05  39%  396 aa  LLDD_ECOHS RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     8e-05  39%  396 aa  LLDD_ECODH RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     8e-05  39%  396 aa  LLDD_ECOBW RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     8e-05  39%  396 aa  LLDD_ECO8A RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     8e-05  39%  396 aa  LLDD_ECO81 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     8e-05  39%  396 aa  LLDD_ECO7I RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     8e-05  39%  396 aa  LLDD_ECO5E RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     8e-05  39%  396 aa  LLDD_ECO57 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     8e-05  39%  396 aa  LLDD_ECO55 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     8e-05  39%  396 aa  LLDD_ECO27 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     8e-05  39%  396 aa  LLDD_ECO24 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  37%  388 aa  LLDD_XANOR RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  37%  388 aa  LLDD_XANOP RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  37%  388 aa  LLDD_XANOM RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  37%  386 aa  LLDD_XANCP RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  37%  386 aa  LLDD_XANCB RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  37%  386 aa  LLDD_XANC8 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  37%  388 aa  LLDD_XANC5 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  37%  388 aa  LLDD_XANAC RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  39%  396 aa  LLDD_SALTY RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  39%  396 aa  LLDD_SALTI RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  39%  396 aa  LLDD_SALSV RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  39%  396 aa  LLDD_SALPK RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  39%  396 aa  LLDD_SALPC RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  39%  396 aa  LLDD_SALPB RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  39%  396 aa  LLDD_SALPA RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  39%  396 aa  LLDD_SALNS RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  39%  396 aa  LLDD_SALHS RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  39%  396 aa  LLDD_SALG2 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  39%  396 aa  LLDD_SALEP RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  39%  396 aa  LLDD_SALDC RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  39%  396 aa  LLDD_SALCH RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  39%  396 aa  LLDD_SALAR RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  39%  396 aa  LLDD_SALA4 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  39%  381 aa  LLDD_HAEDU RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  39%  396 aa  LLDD_ESCF3 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  35%  386 aa  LLDD_ERWCT RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     1e-04  37%  379 aa  LLDD_ALCFA RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::346     1e-04  33%  383 aa  LLDD_ACIBY RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::346     1e-04  33%  383 aa  LLDD_ACIBT RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::346     1e-04  33%  383 aa  LLDD_ACIBS RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::346     1e-04  33%  383 aa  LLDD_ACIBC RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::346     1e-04  33%  383 aa  LLDD_ACIB5 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::346     1e-04  33%  383 aa  LLDD_ACIB3 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     2e-04  40%  392 aa  LLDD_CHRSD RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     3e-04  37%  394 aa  LLDD_KLEP7 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     3e-04  37%  394 aa  LLDD_KLEP3 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     3e-04  37%  401 aa  LLDD_ENTS8 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     3e-04  37%  395 aa  LLDD_ENT38 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     3e-04  37%  396 aa  LLDD_CITK8 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     4e-04  32%  378 aa  LLDD_VIBCM RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     4e-04  32%  378 aa  LLDD_VIBCH RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     4e-04  37%  383 aa  LLDD_BART1 RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     5e-04  34%  380 aa  LLDD_PSEFS RecName: Full=L-lactate dehydrogenase [cytochrome];     
  273::336     7e-04  34%  379 aa  LLDD_VIBPA RecName: Full=L-lactate dehydrogenase [cytochrome];     
    1::528

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GLUS_METJA      ----------------------------------------------------------------------
GLTA_BACSU      ----------------------------------------------------------------------
GLTB_SYNY3      ----------------------------------------------------------------------
GLTB_AZOBR      ----------------------------------------------------------------------
GLTS_SYNY3      ----------------------------------------------------------------------
GLTB_PORYE      ----------------------------------------------------------------------
GLTB_PORPU      ----------------------------------------------------------------------
GLTB_ANTSP      ----------------------------------------------------------------------
GLTB_CYACA      ----------------------------------------------------------------------
GLTB_ECOLI      ----------------------------------------------------------------------
GLT1_SCHPO      ----------------------------------------------------------------------
GLSN_MEDSA      ----------------------------------------------------------------------
GLT1_YEAST      ----------------------------------------------------------------------
GLTB1_ARATH     ----------------------------------------------------------------------
GLTB2_ARATH     ----------------------------------------------------------------------
GLTB_MAIZE      ----------------------------------------------------------------------
GLTB_SPIOL      ----------------------------------------------------------------------
LLDD_PSEMY      ----------------------------------------------------------------------
LLDD_STRMK      ----------------------------------------------------------------------
LLDD_STRM5      ----------------------------------------------------------------------
LLDD_HAEIN      ----------------------------------------------------------------------
LLDD_HAEIG      ----------------------------------------------------------------------
LLDD_HAEIE      ----------------------------------------------------------------------
LLDD_HAEI8      ----------------------------------------------------------------------
LLDD_ECOUT      ----------------------------------------------------------------------
LLDD_ECO45      ----------------------------------------------------------------------
LLDD_PSEE4      ----------------------------------------------------------------------
LLDD_ECOK1      ----------------------------------------------------------------------
LLDD_ACTPJ      ----------------------------------------------------------------------
LLDD_ACTP7      ----------------------------------------------------------------------
LLDD_ACTP2      ----------------------------------------------------------------------
LLDD_YERPY      ----------------------------------------------------------------------
LLDD_YERPS      ----------------------------------------------------------------------
LLDD_YERPP      ----------------------------------------------------------------------
LLDD_YERPN      ----------------------------------------------------------------------
LLDD_YERPG      ----------------------------------------------------------------------
LLDD_YERPE      ----------------------------------------------------------------------
LLDD_YERPB      ----------------------------------------------------------------------
LLDD_YERPA      ----------------------------------------------------------------------
LLDD_YERP3      ----------------------------------------------------------------------
LLDD_PSEPK      ----------------------------------------------------------------------
LLDD_PSEPG      ----------------------------------------------------------------------
LLDD_PSEP1      ----------------------------------------------------------------------
LLDD_SHIDS      ----------------------------------------------------------------------
LLDD_PSEPW      ----------------------------------------------------------------------
LLDD_PSEAE      ----------------------------------------------------------------------
LLDD_PSEAB      ----------------------------------------------------------------------
LLDD_PSEA8      ----------------------------------------------------------------------
LLDD_PSEA7      ----------------------------------------------------------------------
LLDD_SHISS      ----------------------------------------------------------------------
LLDD_SHIFL      ----------------------------------------------------------------------
LLDD_SHIF8      ----------------------------------------------------------------------
LLDD_SHIBS      ----------------------------------------------------------------------
LLDD_SHIB3      ----------------------------------------------------------------------
LLDD_ECOSM      ----------------------------------------------------------------------
LLDD_ECOSE      ----------------------------------------------------------------------
LLDD_ECOLU      ----------------------------------------------------------------------
LLDD_ECOLI      ----------------------------------------------------------------------
LLDD_ECOLC      ----------------------------------------------------------------------
LLDD_ECOL6      ----------------------------------------------------------------------
LLDD_ECOL5      ----------------------------------------------------------------------
LLDD_ECOHS      ----------------------------------------------------------------------
LLDD_ECODH      ----------------------------------------------------------------------
LLDD_ECOBW      ----------------------------------------------------------------------
LLDD_ECO8A      ----------------------------------------------------------------------
LLDD_ECO81      ----------------------------------------------------------------------
LLDD_ECO7I      ----------------------------------------------------------------------
LLDD_ECO5E      ----------------------------------------------------------------------
LLDD_ECO57      ----------------------------------------------------------------------
LLDD_ECO55      ----------------------------------------------------------------------
LLDD_ECO27      ----------------------------------------------------------------------
LLDD_ECO24      ----------------------------------------------------------------------
LLDD_XANOR      ----------------------------------------------------------------------
LLDD_XANOP      ----------------------------------------------------------------------
LLDD_XANOM      ----------------------------------------------------------------------
LLDD_XANCP      ----------------------------------------------------------------------
LLDD_XANCB      ----------------------------------------------------------------------
LLDD_XANC8      ----------------------------------------------------------------------
LLDD_XANC5      ----------------------------------------------------------------------
LLDD_XANAC      ----------------------------------------------------------------------
LLDD_SALTY      ----------------------------------------------------------------------
LLDD_SALTI      ----------------------------------------------------------------------
LLDD_SALSV      ----------------------------------------------------------------------
LLDD_SALPK      ----------------------------------------------------------------------
LLDD_SALPC      ----------------------------------------------------------------------
LLDD_SALPB      ----------------------------------------------------------------------
LLDD_SALPA      ----------------------------------------------------------------------
LLDD_SALNS      ----------------------------------------------------------------------
LLDD_SALHS      ----------------------------------------------------------------------
LLDD_SALG2      ----------------------------------------------------------------------
LLDD_SALEP      ----------------------------------------------------------------------
LLDD_SALDC      ----------------------------------------------------------------------
LLDD_SALCH      ----------------------------------------------------------------------
LLDD_SALAR      ----------------------------------------------------------------------
LLDD_SALA4      ----------------------------------------------------------------------
LLDD_HAEDU      ----------------------------------------------------------------------
LLDD_ESCF3      ----------------------------------------------------------------------
LLDD_ERWCT      ----------------------------------------------------------------------
LLDD_ALCFA      ----------------------------------------------------------------------
LLDD_ACIBY      ----------------------------------------------------------------------
LLDD_ACIBT      ----------------------------------------------------------------------
LLDD_ACIBS      ----------------------------------------------------------------------
LLDD_ACIBC      ----------------------------------------------------------------------
LLDD_ACIB5      ----------------------------------------------------------------------
LLDD_ACIB3      ----------------------------------------------------------------------
LLDD_CHRSD      ----------------------------------------------------------------------
LLDD_KLEP7      ----------------------------------------------------------------------
LLDD_KLEP3      ----------------------------------------------------------------------
LLDD_ENTS8      ----------------------------------------------------------------------
LLDD_ENT38      ----------------------------------------------------------------------
LLDD_CITK8      ----------------------------------------------------------------------
LLDD_VIBCM      ----------------------------------------------------------------------
LLDD_VIBCH      ----------------------------------------------------------------------
LLDD_BART1      ----------------------------------------------------------------------
LLDD_PSEFS      ----------------------------------------------------------------------
LLDD_VIBPA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPKHLDEIET
GLUS_METJA      ----------------------------------------------------------------------
GLTA_BACSU      -------------------------------------------------------------PLKLEEVES
GLTB_SYNY3      ----------------------------------------------------------------------
GLTB_AZOBR      ----------------------------------------------------------------------
GLTS_SYNY3      ----------------------------------------------------------------------
GLTB_PORYE      ----------------------------------------------------------------------
GLTB_PORPU      ----------------------------------------------------------------------
GLTB_ANTSP      ----------------------------------------------------------------------
GLTB_CYACA      ----------------------------------------------------------------------
GLTB_ECOLI      ----------------------------------------------------------------------
GLT1_SCHPO      ----------------------------------------------------------------------
GLSN_MEDSA      ----------------------------------------------------------------------
GLT1_YEAST      ----------------------------------------------------------------------
GLTB1_ARATH     ----------------------------------------------------------------------
GLTB2_ARATH     ----------------------------------------------------------------------
GLTB_MAIZE      ----------------------------------------------------------------------
GLTB_SPIOL      ----------------------------------------------------------------------
LLDD_PSEMY      ----------------------------------------------------------------------
LLDD_STRMK      ----------------------------------------------------------------------
LLDD_STRM5      ----------------------------------------------------------------------
LLDD_HAEIN      ----------------------------------------------------------------------
LLDD_HAEIG      ----------------------------------------------------------------------
LLDD_HAEIE      ----------------------------------------------------------------------
LLDD_HAEI8      ----------------------------------------------------------------------
LLDD_ECOUT      ----------------------------------------------------------------------
LLDD_ECO45      ----------------------------------------------------------------------
LLDD_PSEE4      ----------------------------------------------------------------------
LLDD_ECOK1      ----------------------------------------------------------------------
LLDD_ACTPJ      ----------------------------------------------------------------------
LLDD_ACTP7      ----------------------------------------------------------------------
LLDD_ACTP2      ----------------------------------------------------------------------
LLDD_YERPY      ----------------------------------------------------------------------
LLDD_YERPS      ----------------------------------------------------------------------
LLDD_YERPP      ----------------------------------------------------------------------
LLDD_YERPN      ----------------------------------------------------------------------
LLDD_YERPG      ----------------------------------------------------------------------
LLDD_YERPE      ----------------------------------------------------------------------
LLDD_YERPB      ----------------------------------------------------------------------
LLDD_YERPA      ----------------------------------------------------------------------
LLDD_YERP3      ----------------------------------------------------------------------
LLDD_PSEPK      ----------------------------------------------------------------------
LLDD_PSEPG      ----------------------------------------------------------------------
LLDD_PSEP1      ----------------------------------------------------------------------
LLDD_SHIDS      ----------------------------------------------------------------------
LLDD_PSEPW      ----------------------------------------------------------------------
LLDD_PSEAE      ----------------------------------------------------------------------
LLDD_PSEAB      ----------------------------------------------------------------------
LLDD_PSEA8      ----------------------------------------------------------------------
LLDD_PSEA7      ----------------------------------------------------------------------
LLDD_SHISS      ----------------------------------------------------------------------
LLDD_SHIFL      ----------------------------------------------------------------------
LLDD_SHIF8      ----------------------------------------------------------------------
LLDD_SHIBS      ----------------------------------------------------------------------
LLDD_SHIB3      ----------------------------------------------------------------------
LLDD_ECOSM      ----------------------------------------------------------------------
LLDD_ECOSE      ----------------------------------------------------------------------
LLDD_ECOLU      ----------------------------------------------------------------------
LLDD_ECOLI      ----------------------------------------------------------------------
LLDD_ECOLC      ----------------------------------------------------------------------
LLDD_ECOL6      ----------------------------------------------------------------------
LLDD_ECOL5      ----------------------------------------------------------------------
LLDD_ECOHS      ----------------------------------------------------------------------
LLDD_ECODH      ----------------------------------------------------------------------
LLDD_ECOBW      ----------------------------------------------------------------------
LLDD_ECO8A      ----------------------------------------------------------------------
LLDD_ECO81      ----------------------------------------------------------------------
LLDD_ECO7I      ----------------------------------------------------------------------
LLDD_ECO5E      ----------------------------------------------------------------------
LLDD_ECO57      ----------------------------------------------------------------------
LLDD_ECO55      ----------------------------------------------------------------------
LLDD_ECO27      ----------------------------------------------------------------------
LLDD_ECO24      ----------------------------------------------------------------------
LLDD_XANOR      ----------------------------------------------------------------------
LLDD_XANOP      ----------------------------------------------------------------------
LLDD_XANOM      ----------------------------------------------------------------------
LLDD_XANCP      ----------------------------------------------------------------------
LLDD_XANCB      ----------------------------------------------------------------------
LLDD_XANC8      ----------------------------------------------------------------------
LLDD_XANC5      ----------------------------------------------------------------------
LLDD_XANAC      ----------------------------------------------------------------------
LLDD_SALTY      ----------------------------------------------------------------------
LLDD_SALTI      ----------------------------------------------------------------------
LLDD_SALSV      ----------------------------------------------------------------------
LLDD_SALPK      ----------------------------------------------------------------------
LLDD_SALPC      ----------------------------------------------------------------------
LLDD_SALPB      ----------------------------------------------------------------------
LLDD_SALPA      ----------------------------------------------------------------------
LLDD_SALNS      ----------------------------------------------------------------------
LLDD_SALHS      ----------------------------------------------------------------------
LLDD_SALG2      ----------------------------------------------------------------------
LLDD_SALEP      ----------------------------------------------------------------------
LLDD_SALDC      ----------------------------------------------------------------------
LLDD_SALCH      ----------------------------------------------------------------------
LLDD_SALAR      ----------------------------------------------------------------------
LLDD_SALA4      ----------------------------------------------------------------------
LLDD_HAEDU      ----------------------------------------------------------------------
LLDD_ESCF3      ----------------------------------------------------------------------
LLDD_ERWCT      ----------------------------------------------------------------------
LLDD_ALCFA      ----------------------------------------------------------------------
LLDD_ACIBY      ----------------------------------------------------------------------
LLDD_ACIBT      ----------------------------------------------------------------------
LLDD_ACIBS      ----------------------------------------------------------------------
LLDD_ACIBC      ----------------------------------------------------------------------
LLDD_ACIB5      ----------------------------------------------------------------------
LLDD_ACIB3      ----------------------------------------------------------------------
LLDD_CHRSD      ----------------------------------------------------------------------
LLDD_KLEP7      ----------------------------------------------------------------------
LLDD_KLEP3      ----------------------------------------------------------------------
LLDD_ENTS8      ----------------------------------------------------------------------
LLDD_ENT38      ----------------------------------------------------------------------
LLDD_CITK8      ----------------------------------------------------------------------
LLDD_VIBCM      ----------------------------------------------------------------------
LLDD_VIBCH      ----------------------------------------------------------------------
LLDD_BART1      ----------------------------------------------------------------------
LLDD_PSEFS      ----------------------------------------------------------------------
LLDD_VIBPA      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RVKIGGSDCKQPYMASHLNISAMSFGALSANAVMALNKGAKLGGFYQCTGEGGLTKYHLQGGDLVFQIGT
GLUS_METJA      -------------------IAHMSYGALSLNAHLSFAKAVKECGTFMGTGEGGLPKALYPYADIITQVAS
GLTA_BACSU      AESI----------VKRFKTGAMSFGSLSKEAHEALAIAMNRLGGKSNSGEGGEDPKRFENGDAIKQIAS
GLTB_SYNY3      ---------------------AMSYGSISKEAHESLAIAMNRIGGKSNTGEGGFTWTNDQGNSAIKQVAS
GLTB_AZOBR      ----------------------MSMGALSPEAHGTLNVAMNRIGAKSDSGEGGEDPARFRNGDAIKQVAS
GLTS_SYNY3      ----------------------MSLGALSREAHETLAIAMNRLGAKSNSGEGGLPHLHLQNGDTIKQIAS
GLTB_PORYE      ----------------------MSLGALSRETHETLAIAMNRIGGKSNSGEGGEDPVRFKILNDVNSSGT
GLTB_PORPU      ----------------------MSLGALSRETHETLAIAMNRIGGKSNSGEGGEDPVRFKVLNDVNESGN
GLTB_ANTSP      ----------------------MSLGALSRETHETLAIRMNRIGGKSNSGEGGRTFSHLKGSSAIKQIAS
GLTB_CYACA      ----------------------MSLGALSREAHETLSIAMNRIGGKSNSGEGGEDSLRFTVLTDVDETGN
GLTB_ECOLI      --------------------AAMSIGALSPEAHEALAEAMNXXXXXXXXXXXDPARYGTNKVSRIKQVAS
GLT1_SCHPO      ---------------------AMSYGSISMESHSSLAIAMNRLGGKSNTGEGGARSQRLANGDTIKQIAS
GLSN_MEDSA      ---------------------AMSYGSISLEAHTALATAMNTIGGKSNTGEGGEQPSRMEPRSAIKQVAS
GLT1_YEAST      ---------------------AMSYGSISMEAAIAMNR---LGAKSNC-GEGGEDAERSENGDTIKQVAS
GLTB1_ARATH     ----------------------------------------------------------LQNGDIIKQVAS
GLTB2_ARATH     ----------------------MSLGAISRETAIAMNR---LGGKSN-SGEGGSTLPHLKGGDTIKQVAS
GLTB_MAIZE      ----------------------------------------------------------LQNGDTIKQVAS
GLTB_SPIOL      ----------------------MSLGAISRETHEAIAIAMNRLGGKSNSGEGGSTLPHLKGGDTIKQVAS
LLDD_PSEMY      ----------------------------------------------------------------------
LLDD_STRMK      ----------------------------------------------------------------------
LLDD_STRM5      ----------------------------------------------------------------------
LLDD_HAEIN      ----------------------------------------------------------------------
LLDD_HAEIG      ----------------------------------------------------------------------
LLDD_HAEIE      ----------------------------------------------------------------------
LLDD_HAEI8      ----------------------------------------------------------------------
LLDD_ECOUT      ----------------------------------------------------------------------
LLDD_ECO45      ----------------------------------------------------------------------
LLDD_PSEE4      ----------------------------------------------------------------------
LLDD_ECOK1      ----------------------------------------------------------------------
LLDD_ACTPJ      ----------------------------------------------------------------------
LLDD_ACTP7      ----------------------------------------------------------------------
LLDD_ACTP2      ----------------------------------------------------------------------
LLDD_YERPY      ----------------------------------------------------------------------
LLDD_YERPS      ----------------------------------------------------------------------
LLDD_YERPP      ----------------------------------------------------------------------
LLDD_YERPN      ----------------------------------------------------------------------
LLDD_YERPG      ----------------------------------------------------------------------
LLDD_YERPE      ----------------------------------------------------------------------
LLDD_YERPB      ----------------------------------------------------------------------
LLDD_YERPA      ----------------------------------------------------------------------
LLDD_YERP3      ----------------------------------------------------------------------
LLDD_PSEPK      ----------------------------------------------------------------------
LLDD_PSEPG      ----------------------------------------------------------------------
LLDD_PSEP1      ----------------------------------------------------------------------
LLDD_SHIDS      ----------------------------------------------------------------------
LLDD_PSEPW      ----------------------------------------------------------------------
LLDD_PSEAE      ----------------------------------------------------------------------
LLDD_PSEAB      ----------------------------------------------------------------------
LLDD_PSEA8      ----------------------------------------------------------------------
LLDD_PSEA7      ----------------------------------------------------------------------
LLDD_SHISS      ----------------------------------------------------------------------
LLDD_SHIFL      ----------------------------------------------------------------------
LLDD_SHIF8      ----------------------------------------------------------------------
LLDD_SHIBS      ----------------------------------------------------------------------
LLDD_SHIB3      ----------------------------------------------------------------------
LLDD_ECOSM      ----------------------------------------------------------------------
LLDD_ECOSE      ----------------------------------------------------------------------
LLDD_ECOLU      ----------------------------------------------------------------------
LLDD_ECOLI      ----------------------------------------------------------------------
LLDD_ECOLC      ----------------------------------------------------------------------
LLDD_ECOL6      ----------------------------------------------------------------------
LLDD_ECOL5      ----------------------------------------------------------------------
LLDD_ECOHS      ----------------------------------------------------------------------
LLDD_ECODH      ----------------------------------------------------------------------
LLDD_ECOBW      ----------------------------------------------------------------------
LLDD_ECO8A      ----------------------------------------------------------------------
LLDD_ECO81      ----------------------------------------------------------------------
LLDD_ECO7I      ----------------------------------------------------------------------
LLDD_ECO5E      ----------------------------------------------------------------------
LLDD_ECO57      ----------------------------------------------------------------------
LLDD_ECO55      ----------------------------------------------------------------------
LLDD_ECO27      ----------------------------------------------------------------------
LLDD_ECO24      ----------------------------------------------------------------------
LLDD_XANOR      ----------------------------------------------------------------------
LLDD_XANOP      ----------------------------------------------------------------------
LLDD_XANOM      ----------------------------------------------------------------------
LLDD_XANCP      ----------------------------------------------------------------------
LLDD_XANCB      ----------------------------------------------------------------------
LLDD_XANC8      ----------------------------------------------------------------------
LLDD_XANC5      ----------------------------------------------------------------------
LLDD_XANAC      ----------------------------------------------------------------------
LLDD_SALTY      ----------------------------------------------------------------------
LLDD_SALTI      ----------------------------------------------------------------------
LLDD_SALSV      ----------------------------------------------------------------------
LLDD_SALPK      ----------------------------------------------------------------------
LLDD_SALPC      ----------------------------------------------------------------------
LLDD_SALPB      ----------------------------------------------------------------------
LLDD_SALPA      ----------------------------------------------------------------------
LLDD_SALNS      ----------------------------------------------------------------------
LLDD_SALHS      ----------------------------------------------------------------------
LLDD_SALG2      ----------------------------------------------------------------------
LLDD_SALEP      ----------------------------------------------------------------------
LLDD_SALDC      ----------------------------------------------------------------------
LLDD_SALCH      ----------------------------------------------------------------------
LLDD_SALAR      ----------------------------------------------------------------------
LLDD_SALA4      ----------------------------------------------------------------------
LLDD_HAEDU      ----------------------------------------------------------------------
LLDD_ESCF3      ----------------------------------------------------------------------
LLDD_ERWCT      ----------------------------------------------------------------------
LLDD_ALCFA      ----------------------------------------------------------------------
LLDD_ACIBY      ----------------------------------------------------------------------
LLDD_ACIBT      ----------------------------------------------------------------------
LLDD_ACIBS      ----------------------------------------------------------------------
LLDD_ACIBC      ----------------------------------------------------------------------
LLDD_ACIB5      ----------------------------------------------------------------------
LLDD_ACIB3      ----------------------------------------------------------------------
LLDD_CHRSD      ----------------------------------------------------------------------
LLDD_KLEP7      ----------------------------------------------------------------------
LLDD_KLEP3      ----------------------------------------------------------------------
LLDD_ENTS8      ----------------------------------------------------------------------
LLDD_ENT38      ----------------------------------------------------------------------
LLDD_CITK8      ----------------------------------------------------------------------
LLDD_VIBCM      ----------------------------------------------------------------------
LLDD_VIBCH      ----------------------------------------------------------------------
LLDD_BART1      ----------------------------------------------------------------------
LLDD_PSEFS      ----------------------------------------------------------------------
LLDD_VIBPA      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GYFGCRTDDGKFSAEKFVEKANLDSVKMIEIKLSQGAKPSHGGVLPAAKITPEIAEIRGVSMGKDVLSPP
GLUS_METJA      GRFGVN--------EEYLMKGSA-----IEIKIGQGAKPGIGGHLPGEKVTAEISATRMIPEGSDAISPA
GLTA_BACSU      GRFG-------------VKSHYLVNADELQIKMAQGAKPGEGGQLPGNKVYPWVADVRGSTPGVGLISPP
GLTB_SYNY3      GRFG-------------VTSLYLSQAKEIQIKMAQGAKPGEGGQLPGKKVYPWIAKVRHSTPGVGLISPP
GLTB_AZOBR      GRFG-------------VTAEYLNQCRELEIKVAQGAKPGEGGQLPGFKVTEMIARLRHSTPGVMLISPP
GLTS_SYNY3      GRFG-------------VTPEYLMSGKQLEIKMAQGAKPGEGGQLPGKKVSEYIAMLRRSKPGVTLISPP
GLTB_PORYE      SPLGLKNGDTASSAIKQIASGRLMNAKQLEIKIAQGAKPGEGGQLPGKKISPYIATLRKCKPGVPLISPP
GLTB_PORPU      SDLGLRNGDTASSAIKQIASGRLMNAKQLEIKIAQGAKPGEGGQLPGKKISPYIATLRKCKPGVPLISPP
GLTB_ANTSP      GRFG-------------VTPEYLVNAKQLEIKIAQGAKPGEGGQLPGKKVSPYIAELRNCKPGVTLISPP
GLTB_CYACA      SLKGLKNGDSLSSAIKQIASGRLVNAKQLEIKISQGAKPGEGGQLPGKKVSPYIATLRACKPGVTLISPP
GLTB_ECOLI      GRFG-------------VTPAYLVNADVIQIKVAQGAKPGEGGQLPGDKVTPYIAKLRYSVPGVTLISPP
GLT1_SCHPO      GRFG-------------VTSWYLSDADELQIKMAQGAKPGEGGELPGNKVSESIAKTRHSTAGVGLISPP
GLSN_MEDSA      GRFG-------------VSSYYLTNADELQIKMAQGAKPGEGGELPGHKVIGDIAITRNSTAGVGLISPP
GLT1_YEAST      ARFG-------------VTSYYLSDADEIQIKIAQGAKPGEGGELPAHKVSKDIAKTRHSTPNVGLISPP
GLTB1_ARATH     GRFG-------------VTPTFLVNADQLEIKVAQGAKPGEGGQLPGKKVSAYIARLRSSKPGVPLISPP
GLTB2_ARATH     GRFG-------------VTPTFLVNADQLEIKVAQGAKPGEGGQLPGKKVSAYIARLRNSKPGVPLISPP
GLTB_MAIZE      GRFG-------------VTPTFLVNADQIEIKIAQGAKPGEGGQLPGKKVSAYIARLRNSKPGVPLISPP
GLTB_SPIOL      GRFG-------------VTPTFLVNADQIEIKIAQGAKPGEGGQLPGKKVSAYIARLRNSKPGVPLISPP
LLDD_PSEMY      ----------------------------------------------------------------------
LLDD_STRMK      ----------------------------------------------------------------------
LLDD_STRM5      ----------------------------------------------------------------------
LLDD_HAEIN      ----------------------------------------------------------------------
LLDD_HAEIG      ----------------------------------------------------------------------
LLDD_HAEIE      ----------------------------------------------------------------------
LLDD_HAEI8      ----------------------------------------------------------------------
LLDD_ECOUT      ----------------------------------------------------------------------
LLDD_ECO45      ----------------------------------------------------------------------
LLDD_PSEE4      ----------------------------------------------------------------------
LLDD_ECOK1      ----------------------------------------------------------------------
LLDD_ACTPJ      ----------------------------------------------------------------------
LLDD_ACTP7      ----------------------------------------------------------------------
LLDD_ACTP2      ----------------------------------------------------------------------
LLDD_YERPY      ----------------------------------------------------------------------
LLDD_YERPS      ----------------------------------------------------------------------
LLDD_YERPP      ----------------------------------------------------------------------
LLDD_YERPN      ----------------------------------------------------------------------
LLDD_YERPG      ----------------------------------------------------------------------
LLDD_YERPE      ----------------------------------------------------------------------
LLDD_YERPB      ----------------------------------------------------------------------
LLDD_YERPA      ----------------------------------------------------------------------
LLDD_YERP3      ----------------------------------------------------------------------
LLDD_PSEPK      ----------------------------------------------------------------------
LLDD_PSEPG      ----------------------------------------------------------------------
LLDD_PSEP1      ----------------------------------------------------------------------
LLDD_SHIDS      ----------------------------------------------------------------------
LLDD_PSEPW      ----------------------------------------------------------------------
LLDD_PSEAE      ----------------------------------------------------------------------
LLDD_PSEAB      ----------------------------------------------------------------------
LLDD_PSEA8      ----------------------------------------------------------------------
LLDD_PSEA7      ----------------------------------------------------------------------
LLDD_SHISS      ----------------------------------------------------------------------
LLDD_SHIFL      ----------------------------------------------------------------------
LLDD_SHIF8      ----------------------------------------------------------------------
LLDD_SHIBS      ----------------------------------------------------------------------
LLDD_SHIB3      ----------------------------------------------------------------------
LLDD_ECOSM      ----------------------------------------------------------------------
LLDD_ECOSE      ----------------------------------------------------------------------
LLDD_ECOLU      ----------------------------------------------------------------------
LLDD_ECOLI      ----------------------------------------------------------------------
LLDD_ECOLC      ----------------------------------------------------------------------
LLDD_ECOL6      ----------------------------------------------------------------------
LLDD_ECOL5      ----------------------------------------------------------------------
LLDD_ECOHS      ----------------------------------------------------------------------
LLDD_ECODH      ----------------------------------------------------------------------
LLDD_ECOBW      ----------------------------------------------------------------------
LLDD_ECO8A      ----------------------------------------------------------------------
LLDD_ECO81      ----------------------------------------------------------------------
LLDD_ECO7I      ----------------------------------------------------------------------
LLDD_ECO5E      ----------------------------------------------------------------------
LLDD_ECO57      ----------------------------------------------------------------------
LLDD_ECO55      ----------------------------------------------------------------------
LLDD_ECO27      ----------------------------------------------------------------------
LLDD_ECO24      ----------------------------------------------------------------------
LLDD_XANOR      ----------------------------------------------------------------------
LLDD_XANOP      ----------------------------------------------------------------------
LLDD_XANOM      ----------------------------------------------------------------------
LLDD_XANCP      ----------------------------------------------------------------------
LLDD_XANCB      ----------------------------------------------------------------------
LLDD_XANC8      ----------------------------------------------------------------------
LLDD_XANC5      ----------------------------------------------------------------------
LLDD_XANAC      ----------------------------------------------------------------------
LLDD_SALTY      ----------------------------------------------------------------------
LLDD_SALTI      ----------------------------------------------------------------------
LLDD_SALSV      ----------------------------------------------------------------------
LLDD_SALPK      ----------------------------------------------------------------------
LLDD_SALPC      ----------------------------------------------------------------------
LLDD_SALPB      ----------------------------------------------------------------------
LLDD_SALPA      ----------------------------------------------------------------------
LLDD_SALNS      ----------------------------------------------------------------------
LLDD_SALHS      ----------------------------------------------------------------------
LLDD_SALG2      ----------------------------------------------------------------------
LLDD_SALEP      ----------------------------------------------------------------------
LLDD_SALDC      ----------------------------------------------------------------------
LLDD_SALCH      ----------------------------------------------------------------------
LLDD_SALAR      ----------------------------------------------------------------------
LLDD_SALA4      ----------------------------------------------------------------------
LLDD_HAEDU      ----------------------------------------------------------------------
LLDD_ESCF3      ----------------------------------------------------------------------
LLDD_ERWCT      ----------------------------------------------------------------------
LLDD_ALCFA      ----------------------------------------------------------------------
LLDD_ACIBY      ----------------------------------------------------------------------
LLDD_ACIBT      ----------------------------------------------------------------------
LLDD_ACIBS      ----------------------------------------------------------------------
LLDD_ACIBC      ----------------------------------------------------------------------
LLDD_ACIB5      ----------------------------------------------------------------------
LLDD_ACIB3      ----------------------------------------------------------------------
LLDD_CHRSD      ----------------------------------------------------------------------
LLDD_KLEP7      ----------------------------------------------------------------------
LLDD_KLEP3      ----------------------------------------------------------------------
LLDD_ENTS8      ----------------------------------------------------------------------
LLDD_ENT38      ----------------------------------------------------------------------
LLDD_CITK8      ----------------------------------------------------------------------
LLDD_VIBCM      ----------------------------------------------------------------------
LLDD_VIBCH      ----------------------------------------------------------------------
LLDD_BART1      ----------------------------------------------------------------------
LLDD_PSEFS      ----------------------------------------------------------------------
LLDD_VIBPA      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AHSAFSTPIEFCYFIKQLRDLSNGKPIGFKLCIGSHVEFLAICKAMLETGIRPDFITVXXXXXXXXXXPL
GLUS_METJA      PHHDIYSIEDLAQLVRSLKEATRWKPVFVKIAAVHNAPAIAVGIATSDA----DAVVIDGYKGGTGAAPK
GLTA_BACSU      PHHDIYSIEDLAQLIHDLKNANRDARISVKLVSKAGVGTIAAGVAKATA----DVIVISGYDGGTGASPK
GLTB_SYNY3      PHHDIYSIEDLAELIHDLKNANREARINVKLVVGVGTIAAGVAKA------HADVVLVSGYDGGTGASPQ
GLTB_AZOBR      PHHDIYSIEDLAQLIYDLKQINPDAKVTVKLVSRSGIGTIAAGVAKANA----DIILISGNSGGTGASPQ
GLTS_SYNY3      PHHDIYSIEDLAQLIYDLHQINPEAQVSVKLVIGIGTIAAGVAKA------NADIIQISGHDGGTGASPL
GLTB_PORYE      PHHDIYSIEDLSQLIFDLHQINPKAKISVKLVIGIGTIAAGVAKG------NADIIQISGHDGGTGASPL
GLTB_PORPU      PHHDIYSIEDLSQLIFDLHQINPTAKISVKLVIGIGTIAAGVAKG------NADIIQISGHDGGTGASPL
GLTB_ANTSP      PHHDIYSIEDLAQLIFDLHQINPDAQVSVKLVASLGIGTIA---AGVAKG-NADIIQISGHDGGTGASPL
GLTB_CYACA      PHHDIYSIEDLAQLIFDLHQVNPECKVSVKLVIGVGTIAVGVAKAGAE------IIQISGHDGGTGASPL
GLTB_ECOLI      PHHDIYSIEDLAQLIFDLKQVNPKAMISVKLVSEPGVGTIA-------TGVAKDLITIAGYDGGTGASPL
GLT1_SCHPO      PHHDIYSIEDLKQLIYDMKSANPRARVSVKLVVGVGIVASGVAKA------KADHILVSGHDGGTGASRW
GLSN_MEDSA      PHHDIYSIEDLAQLIHDLKNANPAARISVKLVSEAGVGVIA-------SGVHAEHVLISGHDGGTGASRW
GLT1_YEAST      PHHDIYSIEDLKQLIYDLKCANPRAGISVKLVVGVGIVASGVAKA------KADHILVSGHDGGTGAARW
GLTB1_ARATH     PHHDIYSIEDLAQLIFDLHQINPNAKVSVKLVAEAGIGTVASGVAKGNA----DIIQISGHDGGTGASPI
GLTB2_ARATH     PHHDIYSIEDLAQLIFDLHQVNPKAKVSVKLVSETGIGTVAVAKA------NADIIQISGYDGGTGASPI
GLTB_MAIZE      PHHDIYSIEDLAQLIYDLHQINPKAKVSVKLVSEAGIGTVAVSKA------NADIIQISGHDGGTGASPI
GLTB_SPIOL      PHHDIYSIEDLAQLIYDLHQINPKAKVSVKLVAEAGIGTVAVAKG------NADIIQVSGHDGGTGASPI
LLDD_PSEMY      ----------------------------------------------------------------------
LLDD_STRMK      ----------------------------------------------------------------------
LLDD_STRM5      ----------------------------------------------------------------------
LLDD_HAEIN      ----------------------------------------------------------------------
LLDD_HAEIG      ----------------------------------------------------------------------
LLDD_HAEIE      ----------------------------------------------------------------------
LLDD_HAEI8      ----------------------------------------------------------------------
LLDD_ECOUT      ----------------------------------------------------------------------
LLDD_ECO45      ----------------------------------------------------------------------
LLDD_PSEE4      ----------------------------------------------------------------------
LLDD_ECOK1      ----------------------------------------------------------------------
LLDD_ACTPJ      ----------------------------------------------------------------------
LLDD_ACTP7      ----------------------------------------------------------------------
LLDD_ACTP2      ----------------------------------------------------------------------
LLDD_YERPY      ----------------------------------------------------------------------
LLDD_YERPS      ----------------------------------------------------------------------
LLDD_YERPP      ----------------------------------------------------------------------
LLDD_YERPN      ----------------------------------------------------------------------
LLDD_YERPG      ----------------------------------------------------------------------
LLDD_YERPE      ----------------------------------------------------------------------
LLDD_YERPB      ----------------------------------------------------------------------
LLDD_YERPA      ----------------------------------------------------------------------
LLDD_YERP3      ----------------------------------------------------------------------
LLDD_PSEPK      ----------------------------------------------------------------------
LLDD_PSEPG      ----------------------------------------------------------------------
LLDD_PSEP1      ----------------------------------------------------------------------
LLDD_SHIDS      ----------------------------------------------------------------------
LLDD_PSEPW      ----------------------------------------------------------------------
LLDD_PSEAE      ----------------------------------------------------------------------
LLDD_PSEAB      ----------------------------------------------------------------------
LLDD_PSEA8      ----------------------------------------------------------------------
LLDD_PSEA7      ----------------------------------------------------------------------
LLDD_SHISS      ----------------------------------------------------------------------
LLDD_SHIFL      ----------------------------------------------------------------------
LLDD_SHIF8      ----------------------------------------------------------------------
LLDD_SHIBS      ----------------------------------------------------------------------
LLDD_SHIB3      ----------------------------------------------------------------------
LLDD_ECOSM      ----------------------------------------------------------------------
LLDD_ECOSE      ----------------------------------------------------------------------
LLDD_ECOLU      ----------------------------------------------------------------------
LLDD_ECOLI      ----------------------------------------------------------------------
LLDD_ECOLC      ----------------------------------------------------------------------
LLDD_ECOL6      ----------------------------------------------------------------------
LLDD_ECOL5      ----------------------------------------------------------------------
LLDD_ECOHS      ----------------------------------------------------------------------
LLDD_ECODH      ----------------------------------------------------------------------
LLDD_ECOBW      ----------------------------------------------------------------------
LLDD_ECO8A      ----------------------------------------------------------------------
LLDD_ECO81      ----------------------------------------------------------------------
LLDD_ECO7I      ----------------------------------------------------------------------
LLDD_ECO5E      ----------------------------------------------------------------------
LLDD_ECO57      ----------------------------------------------------------------------
LLDD_ECO55      ----------------------------------------------------------------------
LLDD_ECO27      ----------------------------------------------------------------------
LLDD_ECO24      ----------------------------------------------------------------------
LLDD_XANOR      ----------------------------------------------------------------------
LLDD_XANOP      ----------------------------------------------------------------------
LLDD_XANOM      ----------------------------------------------------------------------
LLDD_XANCP      ----------------------------------------------------------------------
LLDD_XANCB      ----------------------------------------------------------------------
LLDD_XANC8      ----------------------------------------------------------------------
LLDD_XANC5      ----------------------------------------------------------------------
LLDD_XANAC      ----------------------------------------------------------------------
LLDD_SALTY      ----------------------------------------------------------------------
LLDD_SALTI      ----------------------------------------------------------------------
LLDD_SALSV      ----------------------------------------------------------------------
LLDD_SALPK      ----------------------------------------------------------------------
LLDD_SALPC      ----------------------------------------------------------------------
LLDD_SALPB      ----------------------------------------------------------------------
LLDD_SALPA      ----------------------------------------------------------------------
LLDD_SALNS      ----------------------------------------------------------------------
LLDD_SALHS      ----------------------------------------------------------------------
LLDD_SALG2      ----------------------------------------------------------------------
LLDD_SALEP      ----------------------------------------------------------------------
LLDD_SALDC      ----------------------------------------------------------------------
LLDD_SALCH      ----------------------------------------------------------------------
LLDD_SALAR      ----------------------------------------------------------------------
LLDD_SALA4      ----------------------------------------------------------------------
LLDD_HAEDU      ----------------------------------------------------------------------
LLDD_ESCF3      ----------------------------------------------------------------------
LLDD_ERWCT      ----------------------------------------------------------------------
LLDD_ALCFA      ----------------------------------------------------------------------
LLDD_ACIBY      ----------------------------------------------------------------------
LLDD_ACIBT      ----------------------------------------------------------------------
LLDD_ACIBS      ----------------------------------------------------------------------
LLDD_ACIBC      ----------------------------------------------------------------------
LLDD_ACIB5      ----------------------------------------------------------------------
LLDD_ACIB3      ----------------------------------------------------------------------
LLDD_CHRSD      ----------------------------------------------------------------------
LLDD_KLEP7      ----------------------------------------------------------------------
LLDD_KLEP3      ----------------------------------------------------------------------
LLDD_ENTS8      ----------------------------------------------------------------------
LLDD_ENT38      ----------------------------------------------------------------------
LLDD_CITK8      ----------------------------------------------------------------------
LLDD_VIBCM      ----------------------------------------------------------------------
LLDD_VIBCH      ----------------------------------------------------------------------
LLDD_BART1      ----------------------------------------------------------------------
LLDD_PSEFS      ----------------------------------------------------------------------
LLDD_VIBPA      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           EFSNHIGMPLEDSLIFVHNALVGCGLRDEIRIIASSKVATGFDMVRLFAMGADTCNSARAMMLAIGCIQS
GLUS_METJA      VFRDHVGIPIEMAIAAVDQRLREEGLRNEISIIASGGIRCSADVFKAIALGADAVYIGTAAMVALGCRVC
GLTA_BACSU      TSIKHTGLPWELGLAEAHQTLMLNGLRDRVVLETDGKLMTGRDVVMAALLGAEEFGFATAPLVVLGCVMM
GLTB_SYNY3      TSIKHAGLPWELGLAETHQTLVLNNLRSRIVVETDGQMKTGRDVAIAALLGAEEFGFSTAPLVSLGCIMM
GLTB_AZOBR      TSIKFAGLPWEMGLSEVHQVLTLNRLRHRVRLRTDGGLKTGRDIVIAAMLGAEEFGIGTASLIAMGCIMV
GLTS_SYNY3      SSIKHAGSPWELGVTEVHRVLMENQLRDRVLLRADGGLKTGWDVVMAALMGAEEYGFGSIAMIAEGCIMA
GLTB_PORYE      SSIKHAGSPWELGLSEVHQLLAENQLRDRVTLRVDGGLRTGSDIVLAAIMGAEEFGFGTVAMIATGCIMA
GLTB_PORPU      SSIKHAGSPWELGLSEVHQLLAENQLRDRVTLRVDGGLRTGSDIVLAAIMGAEEFGFGTIAMIATGCIMA
GLTB_ANTSP      SSIKHAGAPWDVGLAEVHTTLVENSLREKVILRVDGGLRTGKDIIIAALMGAEEFGFGTVAMIATGCVMA
GLTB_CYACA      SSIKHAGVPWELGLHEVHCLLVENNLREKVILRVDGGLRTGQDVVMAALLGADEYGFGTIAMIAGGCIMA
GLTB_ECOLI      SSVKYAGCPWELGLVETQQALVANGLRHKIRLQVDGGLKTGVDIIKAAILGAESFGFGTGPMVALGCKYL
GLT1_SCHPO      TGIKYAGLPWELGVAETHQTLVLNDLRGRVVIQTDGQIRTGRDVAIACLLGAEEWGFATTPLIALGCIMM
GLSN_MEDSA      TGIKSAGLPWELGLAETHQTLVANDLRGRTTLQTDGQLKTGRDVAIAALLGAEEYGFSTAPLITLGCIMM
GLT1_YEAST      TSVKYAGLPWELGLAETHQTXXXXXXXXXXXXQTDGQLRTGFDIAVAVLLGAESFTLATVPLIAMGCVML
GLTB1_ARATH     SSIKHAGGPWELGLTETHQTLIANGLRERVILRVDGGLKSGVDVLMAAAMGADEYGFGSLAMIATGCVMA
GLTB2_ARATH     SSIKHAGGPWELGLAETQKTLIGNGLRERVIIRVDGGFKSGVDVLIAAAMGADEYGFGTLAMIATGCIMA
GLTB_MAIZE      SSIKHAGGPWELGLTETNQTLIQNGLRERVVLRVDGGFRSGQDVLIAAAMGADEYGFGSVAMIATGCVMA
GLTB_SPIOL      SSIKHAGGPWELGLSETHQTLISNGLRERVILRVDGGLKCXXXXXXXXXXXXXEYGFGSLAMIATGCVMA
LLDD_PSEMY      --SNHGGRQL-DGVLSSARALIADAVKGELKILADSGIRTGLDVVRMLALGADTVLLGRAFIYAL-----
LLDD_STRMK      --SNHGGRQL-DGVLSTARALIADAVQGDLKILADSGIRTGLDVVRMLALGADTVLLGRAFVYAL-----
LLDD_STRM5      --SNHGGRQL-DGVLSTARALIADAVQGDLKILADSGIRTGLDVVRMLALGADTVLLGRAFVYAL-----
LLDD_HAEIN      --SNHGGRQL-DGVLSSARALIADAVKGDIKIIADSGIRNGLDIVRMLALGADATMLGRAFVYALG----
LLDD_HAEIG      --SNHGGRQL-DGVLSSARALIADAVKGDIKIIADSGIRNGLDIVRMLALGADATMLGRAFVYALG----
LLDD_HAEIE      --SNHGGRQL-DGVLSSARALIADAVKGDIKIIADSGIRNGLDIVRMLALGADATMLGRAFVYALG----
LLDD_HAEI8      --SNHGGRQL-DGVLSSARALIADAVKGDIKIIADSGIRNGLDIVRMLALGADATMLGRAFVYALG----
LLDD_ECOUT      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYALA----
LLDD_ECO45      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYALA----
LLDD_PSEE4      --SNHGGRQL-DGVLSSARALIADAVKGDIKILADSGIRSGLDVVRMIALGADTVLIGRAFLYAL-----
LLDD_ECOK1      --SNHGGRQL-DGVLSSACALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYALA----
LLDD_ACTPJ      --SNHGGRQLDGALSSARALSIADAVKGDIKILADSGIRNGLDIVRMLALGADATMLGRAFVYALG----
LLDD_ACTP7      --SNHGGRQLDGALSSARALSIADAVKGDIKILADSGIRNGLDIVRMLALGADATMLGRAFVYALG----
LLDD_ACTP2      --SNHGGRQLDGALSSARALSIADAVKGDIKILADSGIRNGLDIVRMLALGADATMLGRAFVYALG----
LLDD_YERPY      --SNHGGRQL-DGVLSTARALIADAVKGDITILADSGIRTGLDVVRMIALGADSVLLGRAFVYAL-----
LLDD_YERPS      --SNHGGRQL-DGVLSTARALIADAVKGDITILADSGIRTGLDVVRMIALGADSVLLGRAFVYAL-----
LLDD_YERPP      --SNHGGRQL-DGVLSTARALIADAVKGDITILADSGIRTGLDVVRMIALGADSVLLGRAFVYAL-----
LLDD_YERPN      --SNHGGRQL-DGVLSTARALIADAVKGDITILADSGIRTGLDVVRMIALGADSVLLGRAFVYAL-----
LLDD_YERPG      --SNHGGRQL-DGVLSTARALIADAVKGDITILADSGIRTGLDVVRMIALGADSVLLGRAFVYAL-----
LLDD_YERPE      --SNHGGRQL-DGVLSTARALIADAVKGDITILADSGIRTGLDVVRMIALGADSVLLGRAFVYAL-----
LLDD_YERPB      --SNHGGRQL-DGVLSTARALIADAVKGDITILADSGIRTGLDVVRMIALGADSVLLGRAFVYAL-----
LLDD_YERPA      --SNHGGRQL-DGVLSTARALIADAVKGDITILADSGIRTGLDVVRMIALGADSVLLGRAFVYAL-----
LLDD_YERP3      --SNHGGRQL-DGVLSTARALIADAVKGDITILADSGIRTGLDVVRMIALGADSVLLGRAFVYAL-----
LLDD_PSEPK      --SNHGGRQL-DGVLSSARALIADAVKGDLKILADSGIRSGLDVVRMIALGADTVLIGRAFLYAL-----
LLDD_PSEPG      --SNHGGRQL-DGVLSSARALIADAVKGDLKILADSGIRSGLDVVRMIALGADTVLIGRAFLYAL-----
LLDD_PSEP1      --SNHGGRQL-DGVLSSARALIADAVKGDLKILADSGIRSGLDVVRMIALGADTVLIGRAFLYAL-----
LLDD_SHIDS      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYALA----
LLDD_PSEPW      --SNHGGRQL-DGVLSSARALIADAVKGDLKILADSGIRSGLDVVRMIALGADTVLIGRAFLWAL-----
LLDD_PSEAE      --SNHGGRQL-DGVLSSARALIADAVKGELAILADSGIRTGLDVVRMIALGADSVLLGRAFVYAL-----
LLDD_PSEAB      --SNHGGRQL-DGVLSSARALIADAVKGELAILADSGIRTGLDVVRMIALGADSVLLGRAFVYAL-----
LLDD_PSEA8      --SNHGGRQL-DGVLSSARALIADAVKGELAILADSGIRTGLDVVRMIALGADSVLLGRAFVYAL-----
LLDD_PSEA7      --SNHGGRQL-DGVLSSARALIADAVKGELAILADSGIRTGLDVVRMIALGADSVLLGRAFVYAL-----
LLDD_SHISS      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYAL-----
LLDD_SHIFL      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYAL-----
LLDD_SHIF8      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYAL-----
LLDD_SHIBS      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYAL-----
LLDD_SHIB3      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYAL-----
LLDD_ECOSM      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYAL-----
LLDD_ECOSE      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYAL-----
LLDD_ECOLU      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYAL-----
LLDD_ECOLI      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYAL-----
LLDD_ECOLC      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYAL-----
LLDD_ECOL6      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYAL-----
LLDD_ECOL5      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYAL-----
LLDD_ECOHS      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYAL-----
LLDD_ECODH      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYAL-----
LLDD_ECOBW      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYAL-----
LLDD_ECO8A      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYAL-----
LLDD_ECO81      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTILLGRAFLYAL-----
LLDD_ECO7I      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYAL-----
LLDD_ECO5E      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYAL-----
LLDD_ECO57      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYAL-----
LLDD_ECO55      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYAL-----
LLDD_ECO27      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYAL-----
LLDD_ECO24      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYAL-----
LLDD_XANOR      --SNHGGRQL-DGVLSSARALIADAVKGELKILADSGIRSGLDVVRMLALGADAVLLGRAFVYAL-----
LLDD_XANOP      --SNHGGRQL-DGVLSSARALIADAVKGELKILADSGIRSGLDVVRMLALGADAVLLGRAFVYAL-----
LLDD_XANOM      --SNHGGRQL-DGVLSSARALIADAVKGELKILADSGIRSGLDVVRMLALGADAVLLGRAFVYAL-----
LLDD_XANCP      --SNHGGRQL-DGVLSSARALIADAVKGELKILADSGIRSGLDVVRMLALGADAVLLGRAFVYAL-----
LLDD_XANCB      --SNHGGRQL-DGVLSSARALIADAVKGELKILADSGIRSGLDVVRMLALGADAVLLGRAFVYAL-----
LLDD_XANC8      --SNHGGRQL-DGVLSSARALIADAVKGELKILADSGIRSGLDVVRMLALGADAVLLGRAFVYAL-----
LLDD_XANC5      --SNHGGRQL-DGVLSSARALIADAVKGELKILADSGIRSGLDVVRMLALGADAVLLGRAFVYAL-----
LLDD_XANAC      --SNHGGRQL-DGVLSSARALIADAVKGELKILADSGIRSGLDVVRMLALGADAVLLGRAFVYAL-----
LLDD_SALTY      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAYLYAL-----
LLDD_SALTI      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAYLYAL-----
LLDD_SALSV      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAYLYAL-----
LLDD_SALPK      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAYLYAL-----
LLDD_SALPC      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAYLYAL-----
LLDD_SALPB      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAYLYAL-----
LLDD_SALPA      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAYLYAL-----
LLDD_SALNS      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAYLYAL-----
LLDD_SALHS      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAYLYAL-----
LLDD_SALG2      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAYLYAL-----
LLDD_SALEP      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAYLYAL-----
LLDD_SALDC      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAYLYAL-----
LLDD_SALCH      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAYLYAL-----
LLDD_SALAR      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAYLYAL-----
LLDD_SALA4      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAYLYAL-----
LLDD_HAEDU      --SNHGGRQLDGALSSA-KALIADAVKGEIKILADSGIRNGLDVVRMIALGADATLIGRAFVYAL-----
LLDD_ESCF3      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAYLYAL-----
LLDD_ERWCT      --SNHGGRQLDGVLSTAHALAIADAVKGDITILADSGIRSGLDVVRMIALGADGVMLGRAFVYAL-----
LLDD_ALCFA      --SNHGGRQL-DGVLSSARALIADAVKGQIKILADSGIRSGLDVVRMIALGADAAMLGRAYIYAL-----
LLDD_ACIBY      --SNHGGRQL-DGVMSSARALIADAVKGDLAILADSGIRNGLDVVRMLALGADTVLLGRAFVYALAAAGG
LLDD_ACIBT      --SNHGGRQL-DGVMSSARALIADAVKGDLAILADSGIRNGLDVVRMLALGADTVLLGRAFVYALAAAGG
LLDD_ACIBS      --SNHGGRQL-DGVMSSARALIADAVKGDLAILADSGIRNGLDVVRMLALGADTVLLGRAFVYALAAAGG
LLDD_ACIBC      --SNHGGRQL-DGVMSSARALIADAVKGDLAILADSGIRNGLDVVRMLALGADTVLLGRAFVYALAAAGG
LLDD_ACIB5      --SNHGGRQL-DGVMSSARALIADAVKGDLAILADSGIRNGLDVVRMLALGADTVLLGRAFVYALAAAGG
LLDD_ACIB3      --SNHGGRQL-DGVMSSARALIADAVKGDLAILADSGIRNGLDVVRMLALGADTVLLGRAFVYALAAAGG
LLDD_CHRSD      --SNHGGRQL-DGVPSTARALIADAVKGDLAILADSGVRNGLDVVRMIAMGADTILLGRAYIYAL-----
LLDD_KLEP7      --SNHGGRQL-DGVLSSARALIADAVKGDITILADSGIRNGLDVVRMIALGADSVLLGRAYLYAL-----
LLDD_KLEP3      --SNHGGRQL-DGVLSSARALIADAVKGDITILADSGIRNGLDVVRMIALGADSVLLGRAYLYAL-----
LLDD_ENTS8      --SNHGGRQL-DGVLSSARALIADAVKGDITILADSGIRNGLDVVRMIALGADSVLLGRAYLYAL-----
LLDD_ENT38      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADSVLLGRAYLYAL-----
LLDD_CITK8      --SNHGGRQL-DGVLSSARALIADAVKGDIAILADSGIRNGLDVVRMIALGADSVLLGRAYLYAL-----
LLDD_VIBCM      --SNHGGRQLDGVLSTVQALAIADAVKGDLKILVDSGIRTGLDVVRMLALGADCTMLGRSFIYAL-----
LLDD_VIBCH      --SNHGGRQLDGVLSTVQALAIADAVKGDLKILVDSGIRTGLDVVRMLALGADCTMLGRSFIYAL-----
LLDD_BART1      --SNHGGRQL-DGVLSTARALIAEAVKNDLVILADSGVRSGLDVVRMIAQGADAVMIGRAFVYAL-----
LLDD_PSEFS      --SNHGGRQL-DGVLSTAKALIADAVGDDLTVLVDSGIRSGLDVVRMLALGAKACLLGRASAYAL-----
LLDD_VIBPA      --SNHGGRQL-DGVLSTAKALIADAVKGDLKIFVDSGIRTGLDVVRMLALGADCTLLGRSFVYAL-----


                         .         .         +         .         .         .         .:490
query           RQCNNNTCPVGVATQNPRLEKALVVEDKMYRVYNFHKATIQSCLEIIGAMGLISTDDVEPENLKKRISVN
GLUS_METJA      GRCYTGLCAWGIATQRPELVKRLDPEVGARRVANLIKAWTHEIKELLGAAGINSIESLRGNRDRLRVGLN
GLTA_BACSU      RACHLDTCPVGVATQNPELRKKFMGDPD--HIVNYMLFIAEEVREYMAALGFKTFDEM------------
GLTB_SYNY3      RACHLNTCPVGIATQNPEL-RAKFTGDPAHAV-NFMTFIATELREVMAQLGFRTTDILEPKKAAKGIDLS
GLTB_AZOBR      RQCHSNTCPVGVCVQDDKLRQKFVTPEKVVNLFTFLAEEVR---EILAGLGFRSLNEV------------
GLTS_SYNY3      RVCHTNNCPVGVATQQERLRQRF--KGVPGQVVNFFYFIAEEVRSLLAHLGYRSLDDI------------
GLTB_PORYE      RICHTNKCPVGVATQREELRARF--SGVPEALVNFFLFIGNEVREILASLGYKSLDDITGQNLIKNTDIN
GLTB_PORPU      RICHTNKCPVGVATQREELRARF--SGVPEALVNFFLFIGNEVREILASLGYKSLDEITGQN--------
GLTB_ANTSP      RVCHTNNCPVGVATQRQDLRNRFIPSD----VVNFFIFVAEEVREILAELGYKSLEEL------------
GLTB_CYACA      RVCHTNSCPVGVATQKEEL---------------------------------------------------
GLTB_ECOLI      RICHLNNCATGVATQDDKLRKN-HYHGLPFKVTNYFEFIARETRELMAQLGVTRLVDL------------
GLT1_SCHPO      RKCHLNTCPVGIATQDPELRKKF--EGQPEHVVNFFYYVAEELRGIMAKLGFRTINEMVGRSDKLKVA-E
GLSN_MEDSA      RKCHKNTCPVGIATQDPVLREKFAGEPE--HVINFFFMVAEEMREIMSQLGFRTVNEMVGRSDMLEVDKE
GLT1_YEAST      RRCHLNSCAVGIATQDPYLRSKF--KGQPEHVINFFYYLIQDLRQIMAKLGFRTIDEMHSEKLKKRDDVN
GLTB1_ARATH     RICHTNNCPVGVASQREELRARFVPGD----LVNYFLYVAEEVRGILAQLGYNSLDDI------------
GLTB2_ARATH     RICHTNNCPVGVASQREELRARF--PGLPGDLVNFFLYIAEEVRGILAQLGYEKLDDIGRTDLLKARDIS
GLTB_MAIZE      RICHTNNCPVGVASQREEL---------------------------------------------------
GLTB_SPIOL      RICHTNNCPVGVASQREELRARFVPGD----LVNFFLYVAEEVRGILAQLGFEKLDDI------------
LLDD_PSEMY      ----------------------------------------------------------------------
LLDD_STRMK      ----------------------------------------------------------------------
LLDD_STRM5      ----------------------------------------------------------------------
LLDD_HAEIN      ----------------------------------------------------------------------
LLDD_HAEIG      ----------------------------------------------------------------------
LLDD_HAEIE      ----------------------------------------------------------------------
LLDD_HAEI8      ----------------------------------------------------------------------
LLDD_ECOUT      -----TAGQAGVANLLNLIEKEMKVAMTLTGAKSISEITQDSLVQVLG----------------------
LLDD_ECO45      -----TAGQAGVANLLNLIEKEMKVAMTLTGAKSISEITQDSLVQVLG----------------------
LLDD_PSEE4      ----------------------------------------------------------------------
LLDD_ECOK1      -----TAGQAGVANLLNLIEKEMKVAMTLTGAKSISEITQDSLVQVLG----------------------
LLDD_ACTPJ      ----------------------------------------------------------------------
LLDD_ACTP7      ----------------------------------------------------------------------
LLDD_ACTP2      ----------------------------------------------------------------------
LLDD_YERPY      ----------------------------------------------------------------------
LLDD_YERPS      ----------------------------------------------------------------------
LLDD_YERPP      ----------------------------------------------------------------------
LLDD_YERPN      ----------------------------------------------------------------------
LLDD_YERPG      ----------------------------------------------------------------------
LLDD_YERPE      ----------------------------------------------------------------------
LLDD_YERPB      ----------------------------------------------------------------------
LLDD_YERPA      ----------------------------------------------------------------------
LLDD_YERP3      ----------------------------------------------------------------------
LLDD_PSEPK      ----------------------------------------------------------------------
LLDD_PSEPG      ----------------------------------------------------------------------
LLDD_PSEP1      ----------------------------------------------------------------------
LLDD_SHIDS      -----TAGQAGVANLLNLIEKEMKVAMTLTGAKSINEITQDSLVQGLG----------------------
LLDD_PSEPW      ----------------------------------------------------------------------
LLDD_PSEAE      ----------------------------------------------------------------------
LLDD_PSEAB      ----------------------------------------------------------------------
LLDD_PSEA8      ----------------------------------------------------------------------
LLDD_PSEA7      ----------------------------------------------------------------------
LLDD_SHISS      ----------------------------------------------------------------------
LLDD_SHIFL      ----------------------------------------------------------------------
LLDD_SHIF8      ----------------------------------------------------------------------
LLDD_SHIBS      ----------------------------------------------------------------------
LLDD_SHIB3      ----------------------------------------------------------------------
LLDD_ECOSM      ----------------------------------------------------------------------
LLDD_ECOSE      ----------------------------------------------------------------------
LLDD_ECOLU      ----------------------------------------------------------------------
LLDD_ECOLI      ----------------------------------------------------------------------
LLDD_ECOLC      ----------------------------------------------------------------------
LLDD_ECOL6      ----------------------------------------------------------------------
LLDD_ECOL5      ----------------------------------------------------------------------
LLDD_ECOHS      ----------------------------------------------------------------------
LLDD_ECODH      ----------------------------------------------------------------------
LLDD_ECOBW      ----------------------------------------------------------------------
LLDD_ECO8A      ----------------------------------------------------------------------
LLDD_ECO81      ----------------------------------------------------------------------
LLDD_ECO7I      ----------------------------------------------------------------------
LLDD_ECO5E      ----------------------------------------------------------------------
LLDD_ECO57      ----------------------------------------------------------------------
LLDD_ECO55      ----------------------------------------------------------------------
LLDD_ECO27      ----------------------------------------------------------------------
LLDD_ECO24      ----------------------------------------------------------------------
LLDD_XANOR      ----------------------------------------------------------------------
LLDD_XANOP      ----------------------------------------------------------------------
LLDD_XANOM      ----------------------------------------------------------------------
LLDD_XANCP      ----------------------------------------------------------------------
LLDD_XANCB      ----------------------------------------------------------------------
LLDD_XANC8      ----------------------------------------------------------------------
LLDD_XANC5      ----------------------------------------------------------------------
LLDD_XANAC      ----------------------------------------------------------------------
LLDD_SALTY      ----------------------------------------------------------------------
LLDD_SALTI      ----------------------------------------------------------------------
LLDD_SALSV      ----------------------------------------------------------------------
LLDD_SALPK      ----------------------------------------------------------------------
LLDD_SALPC      ----------------------------------------------------------------------
LLDD_SALPB      ----------------------------------------------------------------------
LLDD_SALPA      ----------------------------------------------------------------------
LLDD_SALNS      ----------------------------------------------------------------------
LLDD_SALHS      ----------------------------------------------------------------------
LLDD_SALG2      ----------------------------------------------------------------------
LLDD_SALEP      ----------------------------------------------------------------------
LLDD_SALDC      ----------------------------------------------------------------------
LLDD_SALCH      ----------------------------------------------------------------------
LLDD_SALAR      ----------------------------------------------------------------------
LLDD_SALA4      ----------------------------------------------------------------------
LLDD_HAEDU      ----------------------------------------------------------------------
LLDD_ESCF3      ----------------------------------------------------------------------
LLDD_ERWCT      ----------------------------------------------------------------------
LLDD_ALCFA      ----------------------------------------------------------------------
LLDD_ACIBY      QGVSN-----------------------------------------------------------------
LLDD_ACIBT      QGVSN-----------------------------------------------------------------
LLDD_ACIBS      QGVSN-----------------------------------------------------------------
LLDD_ACIBC      QGVSN-----------------------------------------------------------------
LLDD_ACIB5      QGVSN-----------------------------------------------------------------
LLDD_ACIB3      QGVSN-----------------------------------------------------------------
LLDD_CHRSD      ----------------------------------------------------------------------
LLDD_KLEP7      ----------------------------------------------------------------------
LLDD_KLEP3      ----------------------------------------------------------------------
LLDD_ENTS8      ----------------------------------------------------------------------
LLDD_ENT38      ----------------------------------------------------------------------
LLDD_CITK8      ----------------------------------------------------------------------
LLDD_VIBCM      ----------------------------------------------------------------------
LLDD_VIBCH      ----------------------------------------------------------------------
LLDD_BART1      ----------------------------------------------------------------------
LLDD_PSEFS      ----------------------------------------------------------------------
LLDD_VIBPA      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           EIKSYADLYDFIPERCLVDGNIPASFARxxxxxxxxxx
GLUS_METJA      E-------------------------------------
GLTA_BACSU      --------------------------------------
GLTB_SYNY3      TILHQPEVGDDVGRYCQI--------------------
GLTB_AZOBR      --------------------------------------
GLTS_SYNY3      --------------------------------------
GLTB_PORYE      LTKT----------------------------------
GLTB_PORPU      --------------------------------------
GLTB_ANTSP      --------------------------------------
GLTB_CYACA      --------------------------------------
GLTB_ECOLI      --------------------------------------
GLT1_SCHPO      PINNKSKLLDLTP-------------------------
GLSN_MEDSA      VVKGNAKL------------------------------
GLT1_YEAST      AKAINIDLSPILTPAHVIRPGVPTKFTK----------
GLTB1_ARATH     --------------------------------------
GLTB2_ARATH     LVKTHLDL------------------------------
GLTB_MAIZE      --------------------------------------
GLTB_SPIOL      --------------------------------------
LLDD_PSEMY      --------------------------------------
LLDD_STRMK      --------------------------------------
LLDD_STRM5      --------------------------------------
LLDD_HAEIN      --------------------------------------
LLDD_HAEIG      --------------------------------------
LLDD_HAEIE      --------------------------------------
LLDD_HAEI8      --------------------------------------
LLDD_ECOUT      --------------------------------------
LLDD_ECO45      --------------------------------------
LLDD_PSEE4      --------------------------------------
LLDD_ECOK1      --------------------------------------
LLDD_ACTPJ      --------------------------------------
LLDD_ACTP7      --------------------------------------
LLDD_ACTP2      --------------------------------------
LLDD_YERPY      --------------------------------------
LLDD_YERPS      --------------------------------------
LLDD_YERPP      --------------------------------------
LLDD_YERPN      --------------------------------------
LLDD_YERPG      --------------------------------------
LLDD_YERPE      --------------------------------------
LLDD_YERPB      --------------------------------------
LLDD_YERPA      --------------------------------------
LLDD_YERP3      --------------------------------------
LLDD_PSEPK      --------------------------------------
LLDD_PSEPG      --------------------------------------
LLDD_PSEP1      --------------------------------------
LLDD_SHIDS      --------------------------------------
LLDD_PSEPW      --------------------------------------
LLDD_PSEAE      --------------------------------------
LLDD_PSEAB      --------------------------------------
LLDD_PSEA8      --------------------------------------
LLDD_PSEA7      --------------------------------------
LLDD_SHISS      --------------------------------------
LLDD_SHIFL      --------------------------------------
LLDD_SHIF8      --------------------------------------
LLDD_SHIBS      --------------------------------------
LLDD_SHIB3      --------------------------------------
LLDD_ECOSM      --------------------------------------
LLDD_ECOSE      --------------------------------------
LLDD_ECOLU      --------------------------------------
LLDD_ECOLI      --------------------------------------
LLDD_ECOLC      --------------------------------------
LLDD_ECOL6      --------------------------------------
LLDD_ECOL5      --------------------------------------
LLDD_ECOHS      --------------------------------------
LLDD_ECODH      --------------------------------------
LLDD_ECOBW      --------------------------------------
LLDD_ECO8A      --------------------------------------
LLDD_ECO81      --------------------------------------
LLDD_ECO7I      --------------------------------------
LLDD_ECO5E      --------------------------------------
LLDD_ECO57      --------------------------------------
LLDD_ECO55      --------------------------------------
LLDD_ECO27      --------------------------------------
LLDD_ECO24      --------------------------------------
LLDD_XANOR      --------------------------------------
LLDD_XANOP      --------------------------------------
LLDD_XANOM      --------------------------------------
LLDD_XANCP      --------------------------------------
LLDD_XANCB      --------------------------------------
LLDD_XANC8      --------------------------------------
LLDD_XANC5      --------------------------------------
LLDD_XANAC      --------------------------------------
LLDD_SALTY      --------------------------------------
LLDD_SALTI      --------------------------------------
LLDD_SALSV      --------------------------------------
LLDD_SALPK      --------------------------------------
LLDD_SALPC      --------------------------------------
LLDD_SALPB      --------------------------------------
LLDD_SALPA      --------------------------------------
LLDD_SALNS      --------------------------------------
LLDD_SALHS      --------------------------------------
LLDD_SALG2      --------------------------------------
LLDD_SALEP      --------------------------------------
LLDD_SALDC      --------------------------------------
LLDD_SALCH      --------------------------------------
LLDD_SALAR      --------------------------------------
LLDD_SALA4      --------------------------------------
LLDD_HAEDU      --------------------------------------
LLDD_ESCF3      --------------------------------------
LLDD_ERWCT      --------------------------------------
LLDD_ALCFA      --------------------------------------
LLDD_ACIBY      --------------------------------------
LLDD_ACIBT      --------------------------------------
LLDD_ACIBS      --------------------------------------
LLDD_ACIBC      --------------------------------------
LLDD_ACIB5      --------------------------------------
LLDD_ACIB3      --------------------------------------
LLDD_CHRSD      --------------------------------------
LLDD_KLEP7      --------------------------------------
LLDD_KLEP3      --------------------------------------
LLDD_ENTS8      --------------------------------------
LLDD_ENT38      --------------------------------------
LLDD_CITK8      --------------------------------------
LLDD_VIBCM      --------------------------------------
LLDD_VIBCH      --------------------------------------
LLDD_BART1      --------------------------------------
LLDD_PSEFS      --------------------------------------
LLDD_VIBPA      --------------------------------------