[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30665.1

[Show Plain Result]


## Summary of Sequence Search
    1::354
    8::228     1e-35  41%  252 aa  NUC1_CUNEE RecName: Full=Nuclease C1;         EC=3.1.30.-;
   78::294     8e-33  38%  297 aa  NUCG_HUMAN RecName: Full=Endonuclease G, mitochondrial;       
   75::291     1e-32  37%  294 aa  NUCG_MOUSE RecName: Full=Endonuclease G, mitochondrial;       
   80::296     1e-31  38%  299 aa  NUCG_BOVIN RecName: Full=Endonuclease G, mitochondrial;       
   58::300     2e-30  42%  329 aa  NUC1_YEAST RecName: Full=Mitochondrial nuclease;       
   84::296     1e-29  38%  308 aa  NUCG_CAEEL RecName: Full=Endonuclease G, mitochondrial;       
   76::303     7e-29  39%  320 aa  NUC1_SYNRA RecName: Full=Nuclease;         EC=3.1.30.-;AltName:
    4::177     2e-26  39%  195 aa  NUC_BORBU RecName: Full=Putative endonuclease BB_0411;       
   25::261     2e-25  35%  274 aa  NUCA_ANASP RecName: Full=Nuclease;         EC=3.1.30.-;AltName:
    4::300     6e-25  35%  322 aa  PNU1_SCHPO RecName: Full=Nuclease 1, mitochondrial;       
   76::295     2e-24  30%  368 aa  EXOG_HUMAN RecName: Full=Nuclease EXOG, mitochondrial;       
   57::275     7e-24  33%  358 aa  EXOG_XENLA RecName: Full=Nuclease EXOG, mitochondrial;       
   80::295     1e-22  29%  368 aa  EXOG_MOUSE RecName: Full=Nuclease EXOG, mitochondrial;       
   46::260     5e-22  31%  343 aa  EXOG_DANRE RecName: Full=Nuclease EXOG, mitochondrial;       
   38::237     4e-20  34%  266 aa  NUCA_SERMA RecName: Full=Nuclease;         EC=3.1.30.2;AltName:
  461::643     3e-08  34%  664 aa  Y4FB_RHISN RecName: Full=Uncharacterized protein y4fB;
    1::354

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxNYIKIFILLALTIGGGFSGIFFDKFDLKEKFINFRHAVYNYFTSEPIKHY
NUC1_CUNEE      ----------------------------------------------------------------------
NUCG_HUMAN      ----------------------------------------------------------------------
NUCG_MOUSE      ----------------------------------------------------------------------
NUCG_BOVIN      ----------------------------------------------------------------------
NUC1_YEAST      ----------------------------------------------------------------------
NUCG_CAEEL      ----------------------------------------------------------------------
NUC1_SYNRA      ----------------------------------------------------------------------
NUC_BORBU       ----------------------------------------------------------------------
NUCA_ANASP      ----------------------------------------------------------------------
PNU1_SCHPO      --------------------NLIKSFGLIAI---GAISGVTFTHF---------------YY-----KGY
EXOG_HUMAN      ----------------------------------------------------------------------
EXOG_XENLA      ----------------------------------------------------------------------
EXOG_MOUSE      ----------------------------------------------------------------------
EXOG_DANRE      ----------------------------------------------------------------------
NUCA_SERMA      ----------------------------------------------------------------------
Y4FB_RHISN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TTKDNENITARFFSQSDEGKKQQQQSNEFDNLKQYPPVRTLPAVTDYCHGFLAYGNPSYGVTDGLGQANL
NUC1_CUNEE      ---------------------------------------------------LQFGDP--------GTARD
NUCG_HUMAN      ----------------------------------------------------------------------
NUCG_MOUSE      ----------------------------------------------------------------------
NUCG_BOVIN      ----------------------------------------------------------------------
NUC1_YEAST      -------------------------------------------------GFFKYGFP--------GPIHD
NUCG_CAEEL      ----------------------------------------------------------------------
NUC1_SYNRA      ---------------------------------------------------LKLGNP--------GPVSD
NUC_BORBU       ----------------------------------------------------------------------
NUCA_ANASP      ---------------------------------QVPPLTELPSISVH----LLLGNPSGATPTKLTPDNY
PNU1_SCHPO      QGSDVPDLTPRYTKFDSAG-------------------RALESIYDFATKFFQYGIP--------GPVAD
EXOG_HUMAN      ----------------------------------------------------------------------
EXOG_XENLA      -----------------------------------------------------YGFPLTGT-----EARQ
EXOG_MOUSE      ----------------------------------------------------------------------
EXOG_DANRE      ----------------------------------------------------------FGLPESGAESRF
NUCA_SERMA      -----------------------------------------------------------------GSSNV
Y4FB_RHISN      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YLCRDGYVVGYNYQTKEASWVAFELTKSKVANHLKRDDRFKEDSDVPFVYRATLDDYSRSGYDRGHLASY
NUC1_CUNEE      FLERESYVISYNRRDRVASWTGEHLTADKTGDGVDRDSKFKEDPDVPSLFRSTLADYSGSGFDRGHMAPA
NUCG_HUMAN      ---RESYVLCYDPRTRGALWVVEQLRPERLGDGDRRECDFREDDSVHAYHRATNADYRGSGFDRGHLAAA
NUCG_MOUSE      ---RESYVLSYDPRTRGALWVLEQLRPERLRGDGDRSADFREDDSVHAYHRATNADYRGSGFDRGHLAAA
NUCG_BOVIN      ---RASYVLCYDPRTRGALWVVEQLRPEGLRGDGNRSSDFHEDDSVHAYHRATNADYRGSGFDRGHLAAA
NUC1_YEAST      LQNREEFISCYNRQTQNPYWVLEHITPESLANADRKNSFFKEDEVIPEKFRGKLRDYFRSGYDRGHQAPA
NUCG_CAEEL      ----EDFVLSYDYKTRTAHWVCEHLTPERL-KHAEGVDRFKPDITFPQKFLSQNTDYKCSGFDRGHLAAA
NUC1_SYNRA      LLERSGYILSYNRRDRLAHWVGEHLTSASLGQGVDRDSNFQEDTDIPEMFRAHLKDYVSSGYDRGHQAPA
NUC_BORBU       --------------------LALTLLKSK---KIKRSTKFFEDTNIKGAF-PKLEDYFKSGYDRGHIVSS
NUCA_ANASP      LMVKNQYALSYNNSKGTANWVAWQLNSSWLGN-AERQDNFRPDKTLPAGWRVTPSMYSGSGYDRGHIAPS
PNU1_SCHPO      QRVNHGYMSVFDRRTRNPFYTAETITQESL-NQRKGNRRYSEDDNIPEMFQAKLGDYRGSGYDRGHQVPA
EXOG_HUMAN      --CYTNHALSYDQAKRVPRWVLEHISKSKIMGDADRKHKFKPDPNIPPTFSAFNEDYVGSGWSRGHMAPA
EXOG_XENLA      YI---NHALAYDPAKRTPKWVIEHLSRTKTVGSADRKHKFKPDPNIPKMFSATNEDYLGSGWTRGHMAPA
EXOG_MOUSE      ------HALSYDQAKRVPRWVLEHISKDKIIGDADRKHKFKPDPSVPSAFSALNEDYIGSGWSRGHMAPA
EXOG_DANRE      YT---NHVLSYDQTHRTPRWVAEHLSSTRLLGEANRKQKFRPDPSVPELFTAHNEDYLKSGWSRGHMAPA
NUCA_SERMA      SIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRN--WKTDPALNPADTLAPADYTGANVDRGHQAPL
Y4FB_RHISN      ----------------------------RIPEELQNGDELYGDEPVP----------SKNYFDRGHLVRW


                         .         .         .         +         .         .         .:280
query           ASMDFSKKSADQSFLLSNMSPQKAGLNRQGWERLETDERIWANMYDSIYVYTGPIYKKQKIHKTIGDNKI
NUC1_CUNEE      GDAVATQPAMDQTFYLSNMSPQVGGFNRHYWAYLEGFCRSLTKKFSDVYVFTGPLFGKYTVTYNVLQGNV
NUCG_HUMAN      ANHRWSQKAMDDTFYLSNVAPQVPHLNQNAWNNLEKYSRSLTRSYQNVYVCTGPLFKSYVKYQVIGKNHV
NUCG_MOUSE      ANHRWSQRAMDDTFYLSNVAPQVPHLNQNAWNNLERYSRSLTRTYQNVYVCTGPLFKSYVKYQVIGKNHV
NUCG_BOVIN      ANHRWSQKAMDDTFYLSNVAPQVPHLNQNAWNNLEKYSRSLTRTYQNVYVCTGPLFKSYVKYQVIGKNHV
NUC1_YEAST      ADAKFSQQAMDDTFYLSNMCPQVGGFNRDYWAHLEYFCRGLTKKYKSVRIVTGPLYKKDPIYEVIGNPSI
NUCG_CAEEL      GNHRKSQLAVDQTFYLSNMSPQVGGFNRDKWNDLEMHCRRVAKKMINSYIITGPLYKKYIKYQVIGDNNV
NUC1_SYNRA      ADDLSSQEAMDETFLLSNMAPQGVGFNRHYWAYLEGFMRDLTQNFTDVYVYTGPLFRKNPAYSILGATNV
NUC_BORBU       ADMSFSENAMKDTYFLSNMSPQKSEFNSGIWLKLEKLVREWAISKGYIYIISAGILTENK--GFIGKNKI
NUCA_ANASP      ADRTKTTEDNAATFLMTNMMPQTPDNNRNTWGNLEDYCRELVSQGKELYIVAGPNGSLGKPLK----GKV
PNU1_SCHPO      ADCKFSQEAMNETFYLSNMCPQVGGFNRNYWAYFEDWCRRLTSKYGSVTIMTGPLYLPKKQYRVIGNPNV
EXOG_HUMAN      GNNKFSSKAMAETFYLSNIVPQDFDNNSGYWNRIEMYCRELTERFEDVWVVSGPLTKKIVSYQVIGEDNV
EXOG_XENLA      GDNKFSTEAMAETFYLSNIVPQNYENNAGFWNRMEMYCRDLTKRFEDVWVVSGPLEKKRVTYEVIGADEV
EXOG_MOUSE      GNNKFSSEAMAETFYLSNIVPQNFDNNSGYWNRIEMYCRELTERFEDVWIVSGPLTTKTVSYQVIGEDNV
EXOG_DANRE      GDNKSSEQAMAETFYLSNIVPQNYENNAGFWNRLEMYCRELTEKFSDVWVVSGPLMKKTVSYQLIGKDEV
NUCA_SERMA      ASLAGVSDWESLNYL-SNITPQKSDLNQGAWARLEDQERKLIDRADSVYTVTGPLYERD-MGKLPGTQKA
Y4FB_RHISN      GEIRVAKQANDDTFQWTNCSPQYWGFNQGAWQGLENDENVQAS------VFSGPLFRADDEEH----RGI


                         .         *         .         .         .         .         +:350
query           AVPDYFFKIIYVPSKNQAIAFVMPNARVEKTKIANYRVSIKDIEQCTGLHFLTNISNRDAVINSVSSxxx
NUC1_CUNEE      AVPTHFYKVILVPNKYAYGAFILPNQAIDKTPLTNFKVKLTDVEKASGLTFFDKL---------------
NUCG_HUMAN      AVPTHFFKVLILEAAGGQITYVMPNAPVEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITA---
NUCG_MOUSE      AVPTHFFKVLILEAAGGQISYVMPNAPVDETPLERFLVPIESIERASGLLFVPNILARAGNLKAITA---
NUCG_BOVIN      AVPTHFFKVLILEAAGGQISYVMPNAPVEAIPLEHFLVPIESIERASGLLFVPNILARAGSLKAITA---
NUC1_YEAST      AVPTHFFKLIVAPTANPAAAFVLPNEPINETKLTDFEVPIDALERSTGLELLQKVSKKKALCKEVN----
NUCG_CAEEL      AVPTHFFKVAVTPGKFELESYILPNAVIEDTEISKFHVPLDAVERSAGLEIFARLDPKSIV---------
NUC1_SYNRA      PVPTHFFKIALTTTASSEYAFVLPNQAIDSTPLTNFKVELEAIEKAAGLVFFDKL---------------
NUC_BORBU       LIPKNFYKIVLAINNNDIISFIIPNEKAKDLDLENYVVSVDLIEKKTKIDFFEKLDS-------------
NUCA_ANASP      TVPKSTWKIVVVDSPGSGLEGITANTRVIAVNIPNYKVSVDELESLTGYDFLSNVS--------------
PNU1_SCHPO      AVPTHFFKVIIAPTSSPSVAFVLPNKPIDNFPLKNFAVPVEVVERASGLEILSNVGNRKQLCSEV-----
EXOG_HUMAN      AVPSHLYKVILARRSSVSTAFVVPNEAIGQPQLTEFQVSLQDLEKLSGLVFFPHLDRTSDIRNICS----
EXOG_XENLA      AVPSHLYKVILVREKGSAIAFVVPNSPIGDHQLPEYKVQLEDLEKMSGLLFFPQL---------------
EXOG_MOUSE      AVPSHLYKVILAPESTEPLAFVVPNKAIGQSQLSEFQVSLHDLEKMSGLVFFPRLDRSRDIRNICS----
EXOG_DANRE      AVPTHLYKVILAPSSDALAAFVVPNAPIGQHQLQEFQVSVCDLERESGLVF-------------------
NUCA_SERMA      TIPSAYWKVIFIPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGL---------------------
Y4FB_RHISN      LIPQFFWKVIAVTDKNQDYALDIPFERLNSTKPGNFQVPVAKIIEDTGIVFADEILSADA----------


                         .         .         .         .         *         .         .:420
query           xxxx
NUC1_CUNEE      ----
NUCG_HUMAN      ----
NUCG_MOUSE      ----
NUCG_BOVIN      ----
NUC1_YEAST      ----
NUCG_CAEEL      ----
NUC1_SYNRA      ----
NUC_BORBU       ----
NUCA_ANASP      ----
PNU1_SCHPO      ----
EXOG_HUMAN      ----
EXOG_XENLA      ----
EXOG_MOUSE      ----
EXOG_DANRE      ----
NUCA_SERMA      ----
Y4FB_RHISN      ----