[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30667.1

[Show Plain Result]


## Summary of Sequence Search
    1::139
   23::104     3e-04  31%  145 aa  Y4WH_RHISN RecName: Full=Uncharacterized protein y4wH;
    1::139

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxSKELNNYSDILNAVKDGKNITIFVDFSNCKPEIKVSGQFSPKSIMIHNDS
Y4WH_RHISN      --------------------SHVLASFPELERALTTGKPVTVTVDLGMCTPSTKTRGGVSIDGYRITSDT


                         .         .         *         .         .         .         .:140
query           IIFSDTHFTRNNPQYLNEPILEYVVYKIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Y4WH_RHISN      LAFADQHFTIDRD---GKPVIQFLRYRI-----------------------------------------