[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30680.1

[Show Plain Result]


## Summary of Sequence Search
    1::90
    1::89      4e-29  67%   90 aa  DBHB_PSEAE RecName: Full=DNA-binding protein HU-beta;
    1::89      5e-29  65%   89 aa  DBHB_NEIMB RecName: Full=DNA-binding protein HU-beta;
    1::89      5e-29  65%   89 aa  DBHB_NEIMA RecName: Full=DNA-binding protein HU-beta;
    1::90      8e-27  60%   94 aa  DBH_XYLFT RecName: Full=DNA-binding protein HU;
    1::90      1e-26  54%   90 aa  DBH_STAAW RecName: Full=DNA-binding protein HU;
    1::90      1e-26  54%   90 aa  DBH_STAAS RecName: Full=DNA-binding protein HU;
    1::90      1e-26  54%   90 aa  DBH_STAAR RecName: Full=DNA-binding protein HU;
    1::90      1e-26  54%   90 aa  DBH_STAAN RecName: Full=DNA-binding protein HU;
    1::90      1e-26  54%   90 aa  DBH_STAAM RecName: Full=DNA-binding protein HU;
    1::90      1e-26  54%   90 aa  DBH_STAAC RecName: Full=DNA-binding protein HU;
    1::90      1e-26  54%   90 aa  DBH_BACST RecName: Full=DNA-binding protein HU;AltName:
    1::90      1e-26  54%   90 aa  DBH_BACCL RecName: Full=DNA-binding protein HU;AltName:
    1::90      1e-26  54%   90 aa  DBH_BACCA RecName: Full=DNA-binding protein HU;AltName:
    1::89      1e-26  55%   92 aa  DBH1_BACSU RecName: Full=DNA-binding protein HU 1;AltName:
    1::90      2e-26  60%   90 aa  DBHA_VIBCH RecName: Full=DNA-binding protein HU-alpha;
    1::90      5e-26  59%   94 aa  DBH_XYLFA RecName: Full=DNA-binding protein HU;
    1::89      7e-26  56%   90 aa  DBH1_BACHD RecName: Full=DNA-binding protein HU-1;
    1::88      1e-25  61%   90 aa  DBHB_VIBCH RecName: Full=DNA-binding protein HU-beta;
    1::90      1e-25  57%   90 aa  DBHA_SERMA RecName: Full=DNA-binding protein HU-alpha;AltName:
    1::90      3e-25  54%   90 aa  DBHA_SHIFL RecName: Full=DNA-binding protein HU-alpha;AltName:
    1::90      3e-25  54%   90 aa  DBHA_ECOLI RecName: Full=DNA-binding protein HU-alpha;AltName:
    1::90      3e-25  54%   90 aa  DBHA_ECOL6 RecName: Full=DNA-binding protein HU-alpha;AltName:
    1::90      3e-25  54%   90 aa  DBHA_ECO57 RecName: Full=DNA-binding protein HU-alpha;AltName:
    1::90      6e-25  54%   90 aa  DBHA_SALTY RecName: Full=DNA-binding protein HU-alpha;AltName:
    1::90      6e-25  54%   90 aa  DBHA_SALTI RecName: Full=DNA-binding protein HU-alpha;AltName:
    1::90      1e-24  54%   90 aa  DBH_HAEIN RecName: Full=DNA-binding protein HU;
    1::90      1e-24  57%   90 aa  DBHA_VIBPR RecName: Full=DNA-binding protein HU-alpha;
    1::90      3e-24  56%   90 aa  DBH_PASMU RecName: Full=DNA-binding protein HU;
    1::89      3e-24  54%   91 aa  DBHC_NEIMA RecName: Full=DNA-binding protein HU-beta 2;
    1::90      4e-24  57%   90 aa  DBHA_AERHY RecName: Full=DNA-binding protein HU-alpha;
    1::90      1e-23  51%   92 aa  DBH_BUCAI RecName: Full=DNA-binding protein HU;
    1::89      4e-23  52%   94 aa  DBH_ANASP RecName: Full=DNA-binding protein HU;
    1::89      9e-23  53%   91 aa  DBH1_RHIRD RecName: Full=DNA-binding protein HRL18;
    1::89      9e-23  53%   91 aa  DBH1_RHILE RecName: Full=DNA-binding protein HRL18;
    1::89      1e-22  53%   91 aa  DBH_CLOPA RecName: Full=DNA-binding protein HU;
    1::90      2e-22  49%   90 aa  DBH_BUCAP RecName: Full=DNA-binding protein HU;
    1::90      2e-22  49%   90 aa  DBH2_BACHD RecName: Full=DNA-binding protein HU-1;
    1::89      2e-22  52%   92 aa  DBHA_BURPS RecName: Full=DNA-binding protein HU-alpha;
    3::91      3e-22  48%   91 aa  DBH_STRDO RecName: Full=DNA-binding protein HU;
    3::91      4e-22  48%   91 aa  DBH_STRPY RecName: Full=DNA-binding protein HU;
    3::91      4e-22  48%   91 aa  DBH_STRP8 RecName: Full=DNA-binding protein HU;
    3::91      4e-22  48%   91 aa  DBH_STRP6 RecName: Full=DNA-binding protein HU;
    3::91      4e-22  48%   91 aa  DBH_STRP3 RecName: Full=DNA-binding protein HU;
    3::91      4e-22  48%   91 aa  DBH_STRP1 RecName: Full=DNA-binding protein HU;
    3::91      4e-22  51%   91 aa  DBH_LACLA RecName: Full=DNA-binding protein HU;
    1::90      6e-22  50%   92 aa  DBH_BUCBP RecName: Full=DNA-binding protein HU;
    1::89      8e-22  55%   90 aa  DBHB_SERMA RecName: Full=DNA-binding protein HU-beta;AltName:
    1::89      8e-22  53%   90 aa  DBHA_PSEAE RecName: Full=DNA-binding protein HU-alpha;
    3::91      2e-20  48%   91 aa  DBH_STRMU RecName: Full=DNA-binding protein HU;
    3::91      3e-20  47%   91 aa  DBH_STRTR RecName: Full=DNA-binding protein HU;
    3::91      3e-20  47%   91 aa  DBH_STRGN RecName: Full=DNA-binding protein HU;
    1::95      4e-20  49%  100 aa  DBH_SYNY3 RecName: Full=DNA-binding protein HU;
    1::71      7e-20  62%   90 aa  DBHB_PSEF5 RecName: Full=DNA-binding protein HU-beta;
    4::90      1e-19  49%   92 aa  DBH_CAUCR RecName: Full=DNA-binding protein HU;
    4::90      1e-19  49%   92 aa  DBH_CAUCN RecName: Full=DNA-binding protein HU;
    1::89      2e-19  51%   90 aa  DBHB_SALTY RecName: Full=DNA-binding protein HU-beta;AltName:
    1::89      2e-19  51%   90 aa  DBHB_SALTI RecName: Full=DNA-binding protein HU-beta;AltName:
    1::89      2e-19  51%   90 aa  DBHB_SHIFL RecName: Full=DNA-binding protein HU-beta;AltName:
    1::89      2e-19  51%   90 aa  DBHB_ECOLI RecName: Full=DNA-binding protein HU-beta;AltName:
    1::89      2e-19  51%   90 aa  DBHB_ECOL6 RecName: Full=DNA-binding protein HU-beta;AltName:
    1::89      2e-19  51%   90 aa  DBHB_ECO57 RecName: Full=DNA-binding protein HU-beta;AltName:
    1::89      6e-19  47%   90 aa  DBH_RHIME RecName: Full=DNA-binding protein HRm;
    6::95      3e-18  46%   96 aa  DBH_THET8 RecName: Full=DNA-binding protein HU;AltName:
   12::101     5e-18  44%  116 aa  IHFA_BORA1 RecName: Full=Integration host factor subunit alpha;    
    1::89      5e-18  42%   98 aa  DBH_CAMJR RecName: Full=DNA-binding protein HU;
    1::89      5e-18  42%   98 aa  DBH_CAMJE RecName: Full=DNA-binding protein HU;AltName: Full=HCj;
   12::101     9e-18  44%  113 aa  IHFA_BORPE RecName: Full=Integration host factor subunit alpha;    
   12::101     9e-18  44%  113 aa  IHFA_BORPA RecName: Full=Integration host factor subunit alpha;    
   12::101     9e-18  44%  113 aa  IHFA_BORBR RecName: Full=Integration host factor subunit alpha;    
    1::89      2e-17  46%   91 aa  DBH5_RHILE RecName: Full=DNA-binding protein HRL53;AltName:
    1::90      4e-17  42%   94 aa  IHFB_ACTSZ RecName: Full=Integration host factor subunit beta;   
    1::89      4e-17  39%   93 aa  DBH_GUITH RecName: Full=DNA-binding protein HU homolog;AltName:
   17::106     6e-16  41%  115 aa  IHFA_BURPS RecName: Full=Integration host factor subunit alpha;    
    1::90      8e-16  42%   94 aa  IHFB_HAEIN RecName: Full=Integration host factor subunit beta;   
    1::90      8e-16  42%   94 aa  IHFB_HAEIE RecName: Full=Integration host factor subunit beta;   
    1::90      8e-16  42%   94 aa  IHFB_HAEI8 RecName: Full=Integration host factor subunit beta;   
    1::88      8e-16  45%   92 aa  IHFB_BART1 RecName: Full=Integration host factor subunit beta;   
    4::93      8e-16  40%  104 aa  IHFA_RALSO RecName: Full=Integration host factor subunit alpha;  
    3::92      8e-16  40%  100 aa  IHFA_METFK RecName: Full=Integration host factor subunit alpha;  
    5::94      8e-16  41%  103 aa  IHFA_AZOSB RecName: Full=Integration host factor subunit alpha;  
    1::90      1e-15  39%   95 aa  IHFB_METCA RecName: Full=Integration host factor subunit beta;   
    1::71      1e-15  44%   92 aa  DBH2_BPSPC RecName: Full=DNA-binding protein HU 2;
    1::71      1e-15  44%   92 aa  DBH2_BACSU RecName: Full=SPBc2 prophage-derived DNA-binding
    1::90      1e-15  43%   98 aa  IHFB_HAHCH RecName: Full=Integration host factor subunit beta;   
    1::90      1e-15  42%   94 aa  IHFB_HAEIG RecName: Full=Integration host factor subunit beta;   
    1::90      2e-15  40%   94 aa  IHFB_MANSM RecName: Full=Integration host factor subunit beta;   
    3::92      2e-15  38%   98 aa  IHFA_VIBCM RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-15  38%   98 aa  IHFA_VIBCH RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-15  38%   98 aa  IHFA_VIBC3 RecName: Full=Integration host factor subunit alpha;  
   13::102     2e-15  37%  110 aa  IHFA_DELAS RecName: Full=Integration host factor subunit alpha;    
    3::92      2e-15  40%  100 aa  IHFA_CHRVO RecName: Full=Integration host factor subunit alpha;  
    1::90      3e-15  38%   96 aa  IHFB_DICNV RecName: Full=Integration host factor subunit beta;   
    3::92      3e-15  41%  101 aa  IHFA_NITMU RecName: Full=Integration host factor subunit alpha;  
    1::90      4e-15  39%   95 aa  IHFB_PSEHT RecName: Full=Integration host factor subunit beta;   
    1::90      4e-15  40%   94 aa  IHFB_DECAR RecName: Full=Integration host factor subunit beta;   
    3::92      4e-15  38%   98 aa  IHFA_VIBFM RecName: Full=Integration host factor subunit alpha;  
    3::92      4e-15  38%   98 aa  IHFA_VIBF1 RecName: Full=Integration host factor subunit alpha;  
    3::92      4e-15  37%   98 aa  IHFA_SHELP RecName: Full=Integration host factor subunit alpha;  
   13::102     4e-15  36%  111 aa  IHFA_POLSJ RecName: Full=Integration host factor subunit alpha;    
    3::92      4e-15  38%   98 aa  IHFA_ALISL RecName: Full=Integration host factor subunit alpha;  
    1::90      4e-15  39%   90 aa  DBH_THEMA RecName: Full=DNA-binding protein HU;
    1::90      5e-15  39%   96 aa  IHFB_THISH RecName: Full=Integration host factor subunit beta;   
    5::94      5e-15  39%  103 aa  IHFA_AZOSE RecName: Full=Integration host factor subunit alpha;  
    1::97      5e-15  43%   99 aa  DBH_RICPR RecName: Full=DNA-binding protein HU;
    1::90      7e-15  41%   98 aa  IHFB_SACD2 RecName: Full=Integration host factor subunit beta;   
    1::88      7e-15  45%   94 aa  IHFB_OCHA4 RecName: Full=Integration host factor subunit beta;   
    1::88      7e-15  45%   94 aa  IHFB_BRUSU RecName: Full=Integration host factor subunit beta;   
    1::88      7e-15  45%   94 aa  IHFB_BRUSI RecName: Full=Integration host factor subunit beta;   
    1::88      7e-15  45%   94 aa  IHFB_BRUO2 RecName: Full=Integration host factor subunit beta;   
    1::88      7e-15  45%   94 aa  IHFB_BRUC2 RecName: Full=Integration host factor subunit beta;   
    1::88      7e-15  45%   94 aa  IHFB_BRUAB RecName: Full=Integration host factor subunit beta;   
    1::88      7e-15  45%   94 aa  IHFB_BRUA2 RecName: Full=Integration host factor subunit beta;   
    1::88      7e-15  45%   94 aa  IHFB_BRUA1 RecName: Full=Integration host factor subunit beta;   
    3::92      7e-15  36%  100 aa  IHFA_PSYIN RecName: Full=Integration host factor subunit alpha;  
    6::91      7e-15  37%  100 aa  IHFA_CAUSK RecName: Full=Integration host factor subunit alpha;  
    3::92      7e-15  39%  100 aa  IHFA2_DECAR RecName: Full=Integration host factor subunit alpha
    1::90      9e-15  38%  103 aa  IHFB_XANOP RecName: Full=Integration host factor subunit beta;   
    1::90      9e-15  38%  103 aa  IHFB_XANOM RecName: Full=Integration host factor subunit beta;   
    1::90      9e-15  38%  103 aa  IHFB_XANCP RecName: Full=Integration host factor subunit beta;   
    1::90      9e-15  38%  103 aa  IHFB_XANCB RecName: Full=Integration host factor subunit beta;   
    1::90      9e-15  38%  103 aa  IHFB_XANC8 RecName: Full=Integration host factor subunit beta;   
    1::90      9e-15  38%  103 aa  IHFB_XANAC RecName: Full=Integration host factor subunit beta;   
    3::92      9e-15  39%   98 aa  IHFA_VIBSL RecName: Full=Integration host factor subunit alpha;  
    3::92      9e-15  37%   98 aa  IHFA_PROMH RecName: Full=Integration host factor subunit alpha;  
    3::92      9e-15  40%  102 aa  IHFA_NITEU RecName: Full=Integration host factor subunit alpha;  
    3::92      9e-15  40%  102 aa  IHFA_NITEC RecName: Full=Integration host factor subunit alpha;  
    1::90      1e-14  40%   98 aa  IHFB_TERTT RecName: Full=Integration host factor subunit beta;   
    1::88      1e-14  43%   93 aa  IHFB_RHOSK RecName: Full=Integration host factor subunit beta;   
    1::88      1e-14  43%   93 aa  IHFB_RHOS4 RecName: Full=Integration host factor subunit beta;   
    1::88      1e-14  43%   93 aa  IHFB_RHOS1 RecName: Full=Integration host factor subunit beta;   
    1::88      1e-14  45%   94 aa  IHFB_BRUME RecName: Full=Integration host factor subunit beta;   
    1::88      1e-14  45%   94 aa  IHFB_BRUMB RecName: Full=Integration host factor subunit beta;   
    3::92      1e-14  37%   95 aa  IHFA_VIBVY RecName: Full=Integration host factor subunit alpha;  
    3::92      1e-14  37%   95 aa  IHFA_VIBVU RecName: Full=Integration host factor subunit alpha;  
    4::93      1e-14  36%  102 aa  IHFA_RHOFD RecName: Full=Integration host factor subunit alpha;  
    1::90      2e-14  38%   93 aa  IHFB_HAEPS RecName: Full=Integration host factor subunit beta;   
    3::92      2e-14  36%   97 aa  IHFA_SHEWM RecName: Full=Integration host factor subunit alpha;  
    6::91      2e-14  37%  100 aa  IHFA_CAUCR RecName: Full=Integration host factor subunit alpha;  
    6::91      2e-14  37%  100 aa  IHFA_CAUCN RecName: Full=Integration host factor subunit alpha;  
    1::88      2e-14  43%   95 aa  IHFB_SILST RecName: Full=Integration host factor subunit beta;   
    1::90      2e-14  39%   94 aa  IHFB_PASMU RecName: Full=Integration host factor subunit beta;   
    1::90      2e-14  39%  102 aa  IHFB_HALHL RecName: Full=Integration host factor subunit beta;   
    1::88      2e-14  40%   95 aa  IHFB_DINSH RecName: Full=Integration host factor subunit beta;   
    3::91      2e-14  38%   98 aa  IHFA_DICNV RecName: Full=Integration host factor subunit alpha;  
    1::90      3e-14  37%   94 aa  IHFB_NITMU RecName: Full=Integration host factor subunit beta;   
    1::90      3e-14  37%   92 aa  IHFB_AZOVD RecName: Full=Integration host factor subunit beta;   
    1::90      3e-14  39%   94 aa  IHFB_AZOSB RecName: Full=Integration host factor subunit beta;   
    1::90      3e-14  38%  100 aa  IHFB_ALHEH RecName: Full=Integration host factor subunit beta;   
    4::93      3e-14  38%  103 aa  IHFA_THIDA RecName: Full=Integration host factor subunit alpha;  
    3::92      3e-14  37%   98 aa  IHFA_PSEA6 RecName: Full=Integration host factor subunit alpha;  
    3::92      3e-14  38%  110 aa  IHFA_METCA RecName: Full=Integration host factor subunit alpha;  
    1::97      3e-14  39%   99 aa  DBH_RICCN RecName: Full=DNA-binding protein HU;
    1::90      4e-14  39%  135 aa  IHFB_RALME RecName: Full=Integration host factor subunit beta;   
    1::90      4e-14  40%   94 aa  IHFB_HAES2 RecName: Full=Integration host factor subunit beta;   
    1::90      4e-14  40%   94 aa  IHFB_HAES1 RecName: Full=Integration host factor subunit beta;   
    1::88      4e-14  37%   94 aa  IHFB_DICD3 RecName: Full=Integration host factor subunit beta;   
    3::92      4e-14  34%   99 aa  IHFA_SHEFN RecName: Full=Integration host factor subunit alpha;  
    4::93      4e-14  34%   99 aa  IHFA_PASHA RecName: Full=Integration host factor subunit alpha;  
    1::97      4e-14  42%   99 aa  DBH_RICTY RecName: Full=DNA-binding protein HU;
    1::97      4e-14  39%   99 aa  DBH_RICFE RecName: Full=DNA-binding protein HU;
    1::91      4e-14  44%   93 aa  DBH1_STRLI RecName: Full=DNA-binding protein HU 1;AltName:
    1::91      4e-14  44%   93 aa  DBH1_STRCO RecName: Full=DNA-binding protein HU 1;AltName:
    1::90      5e-14  38%   98 aa  IHFB_MARAV RecName: Full=Integration host factor subunit beta;   
   32::90      5e-14  49%  119 aa  IHFB_BORPD RecName: Full=Integration host factor subunit beta;   
    3::92      5e-14  37%   98 aa  IHFA_VIBPA RecName: Full=Integration host factor subunit alpha;  
    3::92      5e-14  37%   98 aa  IHFA_VIBHB RecName: Full=Integration host factor subunit alpha;  
    3::92      5e-14  34%   98 aa  IHFA_SHESH RecName: Full=Integration host factor subunit alpha;  
    3::92      5e-14  34%   98 aa  IHFA_SHEPW RecName: Full=Integration host factor subunit alpha;  
    3::92      5e-14  34%   98 aa  IHFA_SHEPA RecName: Full=Integration host factor subunit alpha;  
    3::92      5e-14  34%   98 aa  IHFA_SHEHH RecName: Full=Integration host factor subunit alpha;  
    1::97      5e-14  42%  101 aa  DBH_RICBR RecName: Full=DNA-binding protein HU;
    1::90      6e-14  38%  104 aa  IHFB_XYLFT RecName: Full=Integration host factor subunit beta;   
    1::90      6e-14  38%  104 aa  IHFB_XYLFA RecName: Full=Integration host factor subunit beta;   
    1::90      6e-14  38%  104 aa  IHFB_XYLF2 RecName: Full=Integration host factor subunit beta;   
    1::88      6e-14  41%   94 aa  IHFB_XANP2 RecName: Full=Integration host factor subunit beta;   
    1::90      6e-14  37%   94 aa  IHFB_PSEAE RecName: Full=Integration host factor subunit beta;   
    1::90      6e-14  37%   94 aa  IHFB_PSEAB RecName: Full=Integration host factor subunit beta;   
    1::90      6e-14  37%   94 aa  IHFB_PSEA8 RecName: Full=Integration host factor subunit beta;   
    1::90      6e-14  37%   94 aa  IHFB_PSEA7 RecName: Full=Integration host factor subunit beta;   
    1::88      6e-14  41%  106 aa  IHFB_OLICO RecName: Full=Integration host factor subunit beta;   
    1::90      6e-14  42%  107 aa  IHFB_GRABC RecName: Full=Integration host factor subunit beta;   
   32::90      6e-14  49%  119 aa  IHFB_BORPA RecName: Full=Integration host factor subunit beta;   
    3::92      6e-14  36%   98 aa  IHFA_YERPY RecName: Full=Integration host factor subunit alpha;  
    3::92      6e-14  36%   98 aa  IHFA_YERPS RecName: Full=Integration host factor subunit alpha;  
    3::92      6e-14  36%   98 aa  IHFA_YERPP RecName: Full=Integration host factor subunit alpha;  
    3::92      6e-14  36%   98 aa  IHFA_YERPN RecName: Full=Integration host factor subunit alpha;  
    3::92      6e-14  36%   98 aa  IHFA_YERPG RecName: Full=Integration host factor subunit alpha;  
    3::92      6e-14  36%   98 aa  IHFA_YERPE RecName: Full=Integration host factor subunit alpha;  
    3::92      6e-14  36%   98 aa  IHFA_YERPB RecName: Full=Integration host factor subunit alpha;  
    3::92      6e-14  36%   98 aa  IHFA_YERPA RecName: Full=Integration host factor subunit alpha;  
    3::92      6e-14  36%   98 aa  IHFA_YERP3 RecName: Full=Integration host factor subunit alpha;  
    3::92      6e-14  36%   98 aa  IHFA_YERE8 RecName: Full=Integration host factor subunit alpha;  
    3::92      6e-14  34%   98 aa  IHFA_SHEAM RecName: Full=Integration host factor subunit alpha;  
    3::92      6e-14  36%   98 aa  IHFA_SERP5 RecName: Full=Integration host factor subunit alpha;  
    3::92      6e-14  36%   99 aa  IHFA_SERMA RecName: Full=Integration host factor subunit alpha;  
    1::89      6e-14  33%   99 aa  IHFA_ANADF RecName: Full=Integration host factor subunit alpha;  
    1::88      8e-14  43%   94 aa  IHFB_ROSDO RecName: Full=Integration host factor subunit beta;   
    1::88      8e-14  41%  102 aa  IHFB_RHOP5 RecName: Full=Integration host factor subunit beta;   
    1::90      8e-14  39%  137 aa  IHFB_RALEJ RecName: Full=Integration host factor subunit beta;   
    1::88      8e-14  36%   94 aa  IHFB_PECCP RecName: Full=Integration host factor subunit beta;   
    1::88      8e-14  43%   94 aa  IHFB_MESSB RecName: Full=Integration host factor subunit beta;   
    1::90      8e-14  37%  102 aa  IHFB_MARMS RecName: Full=Integration host factor subunit beta;   
    1::88      8e-14  36%   94 aa  IHFB_ERWCT RecName: Full=Integration host factor subunit beta;   
    1::88      8e-14  41%  103 aa  IHFB_AGRVS RecName: Full=Integration host factor subunit beta;   
    3::92      8e-14  36%   98 aa  IHFA_SODGM RecName: Full=Integration host factor subunit alpha;  
    3::92      8e-14  34%   98 aa  IHFA_PHOLL RecName: Full=Integration host factor subunit alpha;  
    3::92      8e-14  36%   98 aa  IHFA_PECCP RecName: Full=Integration host factor subunit alpha;  
    3::92      8e-14  36%   99 aa  IHFA_ERWT9 RecName: Full=Integration host factor subunit alpha;  
    3::92      8e-14  36%   98 aa  IHFA_ERWCT RecName: Full=Integration host factor subunit alpha;  
    3::92      8e-14  36%   99 aa  IHFA_DICD3 RecName: Full=Integration host factor subunit alpha;  
    1::88      1e-13  41%   94 aa  IHFB_SILPO RecName: Full=Integration host factor subunit beta;   
    1::90      1e-13  34%   95 aa  IHFB_SHESW RecName: Full=Integration host factor subunit beta;   
    1::90      1e-13  34%   95 aa  IHFB_SHEPC RecName: Full=Integration host factor subunit beta;   
    1::90      1e-13  39%  138 aa  IHFB_RALSO RecName: Full=Integration host factor subunit beta;   
    1::90      1e-13  36%   95 aa  IHFB_PSEMY RecName: Full=Integration host factor subunit beta;   
    1::90      1e-13  41%   96 aa  IHFB_PSEA6 RecName: Full=Integration host factor subunit beta;   
    1::88      1e-13  41%  101 aa  IHFB_NITWN RecName: Full=Integration host factor subunit beta;   
    1::88      1e-13  41%  101 aa  IHFB_NITHX RecName: Full=Integration host factor subunit beta;   
    1::88      1e-13  40%   94 aa  IHFB_AZOC5 RecName: Full=Integration host factor subunit beta;   
    3::92      1e-13  34%   98 aa  IHFA_SHESR RecName: Full=Integration host factor subunit alpha;  
    3::92      1e-13  34%   98 aa  IHFA_SHESM RecName: Full=Integration host factor subunit alpha;  
    3::92      1e-13  34%   98 aa  IHFA_SHESA RecName: Full=Integration host factor subunit alpha;  
    3::92      1e-13  34%   98 aa  IHFA_SHEON RecName: Full=Integration host factor subunit alpha;  
    3::92      1e-13  34%   99 aa  IHFA_SHEDO RecName: Full=Integration host factor subunit alpha;  
   13::102     1e-13  33%  123 aa  IHFA_POLNA RecName: Full=Integration host factor subunit alpha;    
    1::89      1e-13  31%  129 aa  IHFA_MYXXD RecName: Full=Integration host factor subunit alpha;  
    1::89      1e-13  31%  129 aa  IHFA_MYXXA RecName: Full=Integration host factor subunit alpha;  
    1::90      1e-13  37%  101 aa  IHFB_STRMK RecName: Full=Integration host factor subunit beta;   
    1::90      1e-13  37%  101 aa  IHFB_STRM5 RecName: Full=Integration host factor subunit beta;   
    1::90      1e-13  34%   95 aa  IHFB_SHEWM RecName: Full=Integration host factor subunit beta;   
    1::90      1e-13  34%   95 aa  IHFB_SHESR RecName: Full=Integration host factor subunit beta;   
    1::90      1e-13  34%   95 aa  IHFB_SHESM RecName: Full=Integration host factor subunit beta;   
    1::90      1e-13  34%   95 aa  IHFB_SHESA RecName: Full=Integration host factor subunit beta;   
    1::90      1e-13  34%   95 aa  IHFB_SHEON RecName: Full=Integration host factor subunit beta;   
    1::88      1e-13  40%  100 aa  IHFB_RHORT RecName: Full=Integration host factor subunit beta;   
    1::88      1e-13  41%   99 aa  IHFB_RHILW RecName: Full=Integration host factor subunit beta;   
    1::88      1e-13  41%   99 aa  IHFB_RHIL3 RecName: Full=Integration host factor subunit beta;   
    1::88      1e-13  41%   99 aa  IHFB_RHIEC RecName: Full=Integration host factor subunit beta;   
    1::88      1e-13  41%   99 aa  IHFB_RHIE6 RecName: Full=Integration host factor subunit beta;   
    1::90      1e-13  36%  101 aa  IHFB_JANMA RecName: Full=Integration host factor subunit beta;   
    1::90      1e-13  36%  101 aa  IHFB_HERAR RecName: Full=Integration host factor subunit beta;   
    1::88      1e-13  41%  102 aa  IHFB_AGRRK RecName: Full=Integration host factor subunit beta;   
    3::93      1e-13  37%  100 aa  IHFA_NEIMF RecName: Full=Integration host factor subunit alpha;  
    3::93      1e-13  37%  100 aa  IHFA_NEIMB RecName: Full=Integration host factor subunit alpha;  
    3::93      1e-13  37%  100 aa  IHFA_NEIMA RecName: Full=Integration host factor subunit alpha;  
    3::93      1e-13  37%  100 aa  IHFA_NEIM0 RecName: Full=Integration host factor subunit alpha;  
    3::93      1e-13  37%   96 aa  IHFA_NEIGO RecName: Full=Integration host factor subunit alpha;  
    1::89      1e-13  31%  113 aa  IHFA_ANASK RecName: Full=Integration host factor subunit alpha;  
    1::89      1e-13  31%  113 aa  IHFA_ANADE RecName: Full=Integration host factor subunit alpha;  
    1::89      1e-13  31%  113 aa  IHFA_ANAD2 RecName: Full=Integration host factor subunit alpha;  
    1::90      2e-13  34%   95 aa  IHFB_SHELP RecName: Full=Integration host factor subunit beta;   
    1::90      2e-13  34%   95 aa  IHFB_SHEDO RecName: Full=Integration host factor subunit beta;   
    1::88      2e-13  43%   94 aa  IHFB_RHILO RecName: Full=Integration host factor subunit beta;   
    1::90      2e-13  35%   95 aa  IHFB_COLP3 RecName: Full=Integration host factor subunit beta;   
    1::88      2e-13  41%  100 aa  IHFB_AGRT5 RecName: Full=Integration host factor subunit beta;   
    3::91      2e-13  37%   99 aa  IHFA_XYLFT RecName: Full=Integration host factor subunit alpha;  
    3::91      2e-13  37%   99 aa  IHFA_XYLFM RecName: Full=Integration host factor subunit alpha;  
    3::91      2e-13  37%   99 aa  IHFA_XYLF2 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  37%   99 aa  IHFA_STRMK RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  37%   99 aa  IHFA_STRM5 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_SHISS RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_SHIFL RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_SHIF8 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_SHIDS RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_SHIBS RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_SHIB3 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   98 aa  IHFA_SHESW RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   98 aa  IHFA_SHEPC RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   98 aa  IHFA_SHEB9 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   98 aa  IHFA_SHEB8 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   98 aa  IHFA_SHEB5 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   98 aa  IHFA_SHEB2 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_SALTY RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_SALTI RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_SALSV RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_SALPK RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_SALPC RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_SALPB RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_SALPA RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_SALNS RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_SALHS RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_SALG2 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_SALEP RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_SALDC RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_SALCH RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_SALAR RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_SALA4 RecName: Full=Integration host factor subunit alpha;  
    6::94      2e-13  33%  102 aa  IHFA_PARDP RecName: Full=Integration host factor subunit alpha;  
    3::93      2e-13  37%  100 aa  IHFA_NEIG2 RecName: Full=Integration host factor subunit alpha;  
    3::93      2e-13  37%  100 aa  IHFA_NEIG1 RecName: Full=Integration host factor subunit alpha;  
    6::94      2e-13  34%  111 aa  IHFA_MESSB RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_KLEP7 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_KLEP3 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  32%   98 aa  IHFA_HAEPS RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_ESCF3 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_ENTS8 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_ENT38 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   98 aa  IHFA_EDWI9 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_ECOUT RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_ECOSM RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_ECOSE RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_ECOLU RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_ECOLI RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_ECOLC RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_ECOL6 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_ECOL5 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_ECOHS RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_ECODH RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_ECOBW RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_ECO8A RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_ECO81 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_ECO7I RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_ECO5E RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_ECO57 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_ECO55 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_ECO45 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_ECO27 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_ECO24 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  36%   97 aa  IHFA_COLP3 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  34%   99 aa  IHFA_CITK8 RecName: Full=Integration host factor subunit alpha;  
    6::94      2e-13  35%  107 aa  IHFA_BRUSI RecName: Full=Integration host factor subunit alpha;  
    1::90      2e-13  34%   95 aa  IHFB_SHESH RecName: Full=Integration host factor subunit beta;   
    1::90      2e-13  34%   95 aa  IHFB_SHEB9 RecName: Full=Integration host factor subunit beta;   
    1::90      2e-13  34%   95 aa  IHFB_SHEB8 RecName: Full=Integration host factor subunit beta;   
    1::90      2e-13  34%   95 aa  IHFB_SHEB5 RecName: Full=Integration host factor subunit beta;   
    1::90      2e-13  34%   95 aa  IHFB_SHEB2 RecName: Full=Integration host factor subunit beta;   
    1::88      2e-13  38%   95 aa  IHFB_PARDP RecName: Full=Integration host factor subunit beta;   
    1::90      2e-13  36%  105 aa  IHFB_NITEU RecName: Full=Integration host factor subunit beta;   
    1::88      2e-13  34%   94 aa  IHFB_ESCF3 RecName: Full=Integration host factor subunit beta;   
    1::88      2e-13  34%   95 aa  IHFB_ERWT9 RecName: Full=Integration host factor subunit beta;   
    1::90      2e-13  35%   93 aa  IHFB_ALISL RecName: Full=Integration host factor subunit beta;   
    6::94      2e-13  34%  112 aa  IHFA_SINMW RecName: Full=Integration host factor subunit alpha;  
    6::94      2e-13  34%  112 aa  IHFA_RHISN RecName: Full=Integration host factor subunit alpha;  
    6::94      2e-13  34%  112 aa  IHFA_RHIME RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  33%  101 aa  IHFA_HALHL RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-13  33%   98 aa  IHFA_AERHH RecName: Full=Integration host factor subunit alpha;  
    1::90      3e-13  35%   93 aa  IHFB_VIBFM RecName: Full=Integration host factor subunit beta;   
    1::90      3e-13  35%   93 aa  IHFB_VIBF1 RecName: Full=Integration host factor subunit beta;   
    1::88      3e-13  36%   94 aa  IHFB_SODGM RecName: Full=Integration host factor subunit beta;   
    1::90      3e-13  34%   95 aa  IHFB_SHEFN RecName: Full=Integration host factor subunit beta;   
    1::88      3e-13  41%  102 aa  IHFB_RHIRD RecName: Full=Integration host factor subunit beta;   
    1::90      3e-13  36%  105 aa  IHFB_NITEC RecName: Full=Integration host factor subunit beta;   
    1::89      3e-13  34%   93 aa  IHFB_IDILO RecName: Full=Integration host factor subunit beta;   
    1::90      3e-13  39%   98 aa  IHFB_GLUDA RecName: Full=Integration host factor subunit beta;   
    1::90      3e-13  36%   98 aa  IHFB_CHRSD RecName: Full=Integration host factor subunit beta;   
    1::88      3e-13  41%  102 aa  IHFB_AGRT9 RecName: Full=Integration host factor subunit beta;   
    1::90      3e-13  38%   93 aa  IHFB_ACTPJ RecName: Full=Integration host factor subunit beta;   
    1::90      3e-13  38%   93 aa  IHFB_ACTP7 RecName: Full=Integration host factor subunit beta;   
    1::90      3e-13  38%   93 aa  IHFB_ACTP2 RecName: Full=Integration host factor subunit beta;   
    3::92      3e-13  37%   99 aa  IHFA_XANOR RecName: Full=Integration host factor subunit alpha;  
    3::92      3e-13  37%   99 aa  IHFA_XANOM RecName: Full=Integration host factor subunit alpha;  
    3::92      3e-13  37%   99 aa  IHFA_XANCP RecName: Full=Integration host factor subunit alpha;  
    3::92      3e-13  37%   99 aa  IHFA_XANCB RecName: Full=Integration host factor subunit alpha;  
    3::92      3e-13  37%   99 aa  IHFA_XANC8 RecName: Full=Integration host factor subunit alpha;  
    3::92      3e-13  37%   99 aa  IHFA_XANC5 RecName: Full=Integration host factor subunit alpha;  
    3::92      3e-13  37%   99 aa  IHFA_XANAC RecName: Full=Integration host factor subunit alpha;  
    3::92      3e-13  32%   99 aa  IHFA_PSEHT RecName: Full=Integration host factor subunit alpha;  
    3::92      3e-13  36%  105 aa  IHFA1_DECAR RecName: Full=Integration host factor subunit alpha
    1::88      4e-13  36%   94 aa  IHFB_YERPY RecName: Full=Integration host factor subunit beta;   
    1::88      4e-13  36%   94 aa  IHFB_YERPS RecName: Full=Integration host factor subunit beta;   
    1::88      4e-13  36%   94 aa  IHFB_YERPP RecName: Full=Integration host factor subunit beta;   
    1::88      4e-13  36%   94 aa  IHFB_YERPN RecName: Full=Integration host factor subunit beta;   
    1::88      4e-13  36%   94 aa  IHFB_YERPG RecName: Full=Integration host factor subunit beta;   
    1::88      4e-13  36%   94 aa  IHFB_YERPE RecName: Full=Integration host factor subunit beta;   
    1::88      4e-13  36%   94 aa  IHFB_YERPB RecName: Full=Integration host factor subunit beta;   
    1::88      4e-13  36%   94 aa  IHFB_YERPA RecName: Full=Integration host factor subunit beta;   
    1::88      4e-13  36%   94 aa  IHFB_YERP3 RecName: Full=Integration host factor subunit beta;   
    1::88      4e-13  40%  103 aa  IHFB_SINMW RecName: Full=Integration host factor subunit beta;   
    1::90      4e-13  34%   95 aa  IHFB_SHEPA RecName: Full=Integration host factor subunit beta;   
    1::88      4e-13  46%   93 aa  IHFB_RHOCS RecName: Full=Integration host factor subunit beta;   
    1::88      4e-13  40%  103 aa  IHFB_RHIME RecName: Full=Integration host factor subunit beta;   
    1::88      4e-13  40%  101 aa  IHFB_BRAJA RecName: Full=Integration host factor subunit beta;   
    3::92      4e-13  33%   99 aa  IHFA_ALTMD RecName: Full=Integration host factor subunit alpha;  
    3::92      4e-13  33%  101 aa  IHFA_ALHEH RecName: Full=Integration host factor subunit alpha;  
   36::119     4e-13  39%  122 aa  DBH_DEIRA RecName: Full=DNA-binding protein HU;
    1::90      5e-13  33%   95 aa  IHFB_SHEAM RecName: Full=Integration host factor subunit beta;   
    1::88      5e-13  40%  101 aa  IHFB_RHOPS RecName: Full=Integration host factor subunit beta;   
    1::88      5e-13  40%  101 aa  IHFB_RHOPB RecName: Full=Integration host factor subunit beta;   
    1::88      5e-13  40%  101 aa  IHFB_RHOP2 RecName: Full=Integration host factor subunit beta;   
    1::87      5e-13  40%   94 aa  IHFB_CAUSK RecName: Full=Integration host factor subunit beta;   
    1::88      5e-13  40%  105 aa  IHFB_BRASO RecName: Full=Integration host factor subunit beta;   
    1::88      5e-13  40%  103 aa  IHFB_BRASB RecName: Full=Integration host factor subunit beta;   
    1::88      5e-13  40%   97 aa  IHFB_BEII9 RecName: Full=Integration host factor subunit beta;   
    6::94      5e-13  33%  100 aa  IHFA_RHOCA RecName: Full=Integration host factor subunit alpha;  
    6::94      5e-13  34%  100 aa  IHFA_PHEZH RecName: Full=Integration host factor subunit alpha;  
    6::94      5e-13  34%  107 aa  IHFA_OCHA4 RecName: Full=Integration host factor subunit alpha;  
    6::94      5e-13  34%  107 aa  IHFA_BRUSU RecName: Full=Integration host factor subunit alpha;  
    6::94      5e-13  34%  107 aa  IHFA_BRUME RecName: Full=Integration host factor subunit alpha;  
    6::94      5e-13  34%  107 aa  IHFA_BRUMB RecName: Full=Integration host factor subunit alpha;  
    6::94      5e-13  34%  107 aa  IHFA_BRUC2 RecName: Full=Integration host factor subunit alpha;  
    6::94      5e-13  34%  107 aa  IHFA_BRUAB RecName: Full=Integration host factor subunit alpha;  
    6::94      5e-13  34%  107 aa  IHFA_BRUA2 RecName: Full=Integration host factor subunit alpha;  
    6::94      5e-13  34%  107 aa  IHFA_BRUA1 RecName: Full=Integration host factor subunit alpha;  
    1::90      7e-13  34%   93 aa  IHFB_VIBPA RecName: Full=Integration host factor subunit beta;   
    1::90      7e-13  34%   94 aa  IHFB_VIBHB RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_SHISS RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_SHIFL RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_SHIF8 RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_SHIDS RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_SHIBS RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_SHIB3 RecName: Full=Integration host factor subunit beta;   
    1::90      7e-13  34%   95 aa  IHFB_SHEHH RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  34%   94 aa  IHFB_SERP5 RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_SALTY RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_SALTI RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_SALSV RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_SALPK RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_SALPC RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_SALPB RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_SALPA RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_SALNS RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_SALHS RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_SALG2 RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_SALEP RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_SALDC RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_SALCH RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_SALAR RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_SALA4 RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  40%  104 aa  IHFB_RHOPT RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  40%  104 aa  IHFB_RHOPA RecName: Full=Integration host factor subunit beta;   
    1::90      7e-13  33%   95 aa  IHFB_PSYIN RecName: Full=Integration host factor subunit beta;   
    1::90      7e-13  34%   94 aa  IHFB_PHOLL RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   95 aa  IHFB_KLEP7 RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   95 aa  IHFB_KLEP3 RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  40%   95 aa  IHFB_JANSC RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_ECOUT RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_ECOSM RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_ECOSE RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_ECOLU RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_ECOLI RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_ECOLC RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_ECOL6 RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_ECOL5 RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_ECOHS RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_ECODH RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_ECOBW RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_ECO8A RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_ECO81 RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_ECO7I RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_ECO5E RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_ECO57 RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_ECO55 RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_ECO45 RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_ECO24 RecName: Full=Integration host factor subunit beta;   
    1::88      7e-13  33%   94 aa  IHFB_CITK8 RecName: Full=Integration host factor subunit beta;   
    1::90      7e-13  38%  107 aa  IHFB_BURXL RecName: Full=Integration host factor subunit beta;   
    1::90      7e-13  38%  107 aa  IHFB_BURPP RecName: Full=Integration host factor subunit beta;   
    3::91      7e-13  36%   99 aa  IHFA_XYLFA RecName: Full=Integration host factor subunit alpha;  
    6::94      7e-13  33%  112 aa  IHFA_RHILW RecName: Full=Integration host factor subunit alpha;  
    3::92      7e-13  33%   98 aa  IHFA_PASMU RecName: Full=Integration host factor subunit alpha;  
    3::92      7e-13  33%   99 aa  IHFA_NITOC RecName: Full=Integration host factor subunit alpha;  
    1::89      7e-13  31%  214 aa  DBH_MYCTU RecName: Full=DNA-binding protein HU homolog;AltName:
    1::89      7e-13  31%  200 aa  DBH_MYCLE RecName: Full=DNA-binding protein HU homolog;AltName:
    1::89      7e-13  31%  214 aa  DBH_MYCBO RecName: Full=DNA-binding protein HU homolog;AltName:
    4::91      7e-13  41%   93 aa  DBH1_BIFLO RecName: Full=DNA-binding protein HB1;
    1::88      9e-13  36%   94 aa  IHFB_YERE8 RecName: Full=Integration host factor subunit beta;   
    1::90      9e-13  34%   93 aa  IHFB_VIBVY RecName: Full=Integration host factor subunit beta;   
    1::90      9e-13  34%   93 aa  IHFB_VIBVU RecName: Full=Integration host factor subunit beta;   
    1::90      9e-13  34%   94 aa  IHFB_VIBSL RecName: Full=Integration host factor subunit beta;   
    1::88      9e-13  48%   95 aa  IHFB_RHOCA RecName: Full=Integration host factor subunit beta;   
    1::90      9e-13  40%   93 aa  IHFB_PSEU5 RecName: Full=Integration host factor subunit beta;   
    1::90      9e-13  40%   98 aa  IHFB_PSEPW RecName: Full=Integration host factor subunit beta;   
    1::90      9e-13  40%   98 aa  IHFB_PSEE4 RecName: Full=Integration host factor subunit beta;   
    1::90      9e-13  34%   96 aa  IHFB_PHOPR RecName: Full=Integration host factor subunit beta;   
    1::88      9e-13  40%   96 aa  IHFB_METSB RecName: Full=Integration host factor subunit beta;   
    1::88      9e-13  33%   94 aa  IHFB_ECO27 RecName: Full=Integration host factor subunit beta;   
    1::90      9e-13  38%  107 aa  IHFB_BURP8 RecName: Full=Integration host factor subunit beta;   
    6::94      9e-13  33%  100 aa  IHFA_SILST RecName: Full=Integration host factor subunit alpha;  
    6::94      9e-13  31%  112 aa  IHFA_RHIL3 RecName: Full=Integration host factor subunit alpha;  
    6::94      9e-13  31%  112 aa  IHFA_RHIEC RecName: Full=Integration host factor subunit alpha;  
    6::94      9e-13  31%  112 aa  IHFA_RHIE6 RecName: Full=Integration host factor subunit alpha;  
    3::92      9e-13  36%   98 aa  IHFA_IDILO RecName: Full=Integration host factor subunit alpha;  
    4::93      9e-13  34%  100 aa  IHFA_HAHCH RecName: Full=Integration host factor subunit alpha;  
    6::94      9e-13  33%  101 aa  IHFA_DINSH RecName: Full=Integration host factor subunit alpha;  
    1::86      9e-13  36%  110 aa  IHFA_BDEBA RecName: Full=Integration host factor subunit alpha;  
    6::94      9e-13  31%  112 aa  IHFA_AGRT5 RecName: Full=Integration host factor subunit alpha;  
    6::94      9e-13  31%  112 aa  IHFA_AGRRK RecName: Full=Integration host factor subunit alpha;  
    1::89      9e-13  30%  208 aa  DBH_MYCS2 RecName: Full=DNA-binding protein HU homolog;AltName:
    1::91      9e-13  39%   94 aa  DBH_HELPJ RecName: Full=DNA-binding protein HU;
    1::88      1e-12  33%   94 aa  IHFB_SERMA RecName: Full=Integration host factor subunit beta;   
    1::90      1e-12  40%   98 aa  IHFB_PSEU2 RecName: Full=Integration host factor subunit beta;   
    1::90      1e-12  40%   98 aa  IHFB_PSESM RecName: Full=Integration host factor subunit beta;   
    1::90      1e-12  40%  100 aa  IHFB_PSEPU RecName: Full=Integration host factor subunit beta;   
    1::90      1e-12  40%  100 aa  IHFB_PSEPK RecName: Full=Integration host factor subunit beta;   
    1::90      1e-12  40%   98 aa  IHFB_PSEPG RecName: Full=Integration host factor subunit beta;   
    1::90      1e-12  40%   98 aa  IHFB_PSEPF RecName: Full=Integration host factor subunit beta;   
    1::90      1e-12  40%   98 aa  IHFB_PSEP1 RecName: Full=Integration host factor subunit beta;   
    1::90      1e-12  40%   98 aa  IHFB_PSEFS RecName: Full=Integration host factor subunit beta;   
    1::90      1e-12  37%  101 aa  IHFB_MARMM RecName: Full=Integration host factor subunit beta;   
    1::90      1e-12  42%   99 aa  IHFB_LARHH RecName: Full=Integration host factor subunit beta;   
    1::90      1e-12  38%   93 aa  IHFB_HAEDU RecName: Full=Integration host factor subunit beta;   
    1::88      1e-12  33%   95 aa  IHFB_ENT38 RecName: Full=Integration host factor subunit beta;   
    1::90      1e-12  37%  107 aa  IHFB_BURTA RecName: Full=Integration host factor subunit beta;   
    1::90      1e-12  37%  107 aa  IHFB_BURPS RecName: Full=Integration host factor subunit beta;   
    1::90      1e-12  37%  107 aa  IHFB_BURP6 RecName: Full=Integration host factor subunit beta;   
    1::90      1e-12  37%  107 aa  IHFB_BURP1 RecName: Full=Integration host factor subunit beta;   
    1::90      1e-12  37%  107 aa  IHFB_BURP0 RecName: Full=Integration host factor subunit beta;   
    1::90      1e-12  37%  107 aa  IHFB_BURMS RecName: Full=Integration host factor subunit beta;   
    1::90      1e-12  37%  107 aa  IHFB_BURMA RecName: Full=Integration host factor subunit beta;   
    1::90      1e-12  37%  107 aa  IHFB_BURM9 RecName: Full=Integration host factor subunit beta;   
    1::90      1e-12  37%  107 aa  IHFB_BURM7 RecName: Full=Integration host factor subunit beta;   
    3::92      1e-12  32%  106 aa  IHFA_TOLAT RecName: Full=Integration host factor subunit alpha;  
    3::92      1e-12  34%   99 aa  IHFA_THISH RecName: Full=Integration host factor subunit alpha;  
    6::94      1e-12  31%  100 aa  IHFA_RHOS5 RecName: Full=Integration host factor subunit alpha;  
    6::94      1e-12  31%  100 aa  IHFA_RHOS4 RecName: Full=Integration host factor subunit alpha;  
    6::94      1e-12  31%  100 aa  IHFA_RHOS1 RecName: Full=Integration host factor subunit alpha;  
    4::93      1e-12  33%  100 aa  IHFA_PSEU5 RecName: Full=Integration host factor subunit alpha;  
    4::93      1e-12  33%  100 aa  IHFA_PSEAE RecName: Full=Integration host factor subunit alpha;  
    4::93      1e-12  33%  100 aa  IHFA_PSEAB RecName: Full=Integration host factor subunit alpha;  
    4::93      1e-12  33%  100 aa  IHFA_PSEA7 RecName: Full=Integration host factor subunit alpha;  
    4::93      1e-12  33%  100 aa  IHFA_MARAV RecName: Full=Integration host factor subunit alpha;  
    4::93      1e-12  34%   97 aa  IHFA_LEGPL RecName: Full=Integration host factor subunit alpha;  
    6::95      1e-12  34%   99 aa  IHFA_LEGPH RecName: Full=Integration host factor subunit alpha;  
    4::93      1e-12  34%   97 aa  IHFA_LEGPC RecName: Full=Integration host factor subunit alpha;  
    4::93      1e-12  34%   97 aa  IHFA_LEGPA RecName: Full=Integration host factor subunit alpha;  
    6::94      1e-12  33%  100 aa  IHFA_JANSC RecName: Full=Integration host factor subunit alpha;  
    6::94      1e-12  33%  112 aa  IHFA_AGRVS RecName: Full=Integration host factor subunit alpha;  
    1::90      1e-12  34%   95 aa  IHFB_PROMH RecName: Full=Integration host factor subunit beta;   
    1::88      1e-12  46%  110 aa  IHFB_PARL1 RecName: Full=Integration host factor subunit beta;   
    1::88      1e-12  34%   94 aa  IHFB_EDWI9 RecName: Full=Integration host factor subunit beta;   
    1::88      1e-12  38%   93 aa  IHFB_BUCAP RecName: Full=Integration host factor subunit beta;   
    4::93      1e-12  33%  100 aa  IHFA_PSEA8 RecName: Full=Integration host factor subunit alpha;  
    6::94      1e-12  33%  106 aa  IHFA_MAGSA RecName: Full=Integration host factor subunit alpha;  
    1::90      2e-12  36%   93 aa  IHFB_TOLAT RecName: Full=Integration host factor subunit beta;   
    1::90      2e-12  40%   98 aa  IHFB_PSE14 RecName: Full=Integration host factor subunit beta;   
    1::94      2e-12  35%  104 aa  IHFB_CHRVO RecName: Full=Integration host factor subunit beta;   
    1::87      2e-12  38%   96 aa  IHFB_CAUCR RecName: Full=Integration host factor subunit beta;   
    1::87      2e-12  38%   96 aa  IHFB_CAUCN RecName: Full=Integration host factor subunit beta;   
    1::90      2e-12  37%  107 aa  IHFB_BURM1 RecName: Full=Integration host factor subunit beta;   
    1::90      2e-12  34%   94 aa  IHFB_AERS4 RecName: Full=Integration host factor subunit beta;   
    1::90      2e-12  34%   94 aa  IHFB_AERHH RecName: Full=Integration host factor subunit beta;   
    6::94      2e-12  30%  107 aa  IHFA_RHILO RecName: Full=Integration host factor subunit alpha;  
    4::93      2e-12  33%  100 aa  IHFA_PSEU2 RecName: Full=Integration host factor subunit alpha;  
    4::93      2e-12  33%  100 aa  IHFA_PSESM RecName: Full=Integration host factor subunit alpha;  
    4::93      2e-12  33%  100 aa  IHFA_PSEPF RecName: Full=Integration host factor subunit alpha;  
    4::93      2e-12  33%  100 aa  IHFA_PSEFS RecName: Full=Integration host factor subunit alpha;  
    4::93      2e-12  33%  100 aa  IHFA_PSEF5 RecName: Full=Integration host factor subunit alpha;  
    4::93      2e-12  33%  100 aa  IHFA_PSEE4 RecName: Full=Integration host factor subunit alpha;  
    4::93      2e-12  33%  100 aa  IHFA_PSE14 RecName: Full=Integration host factor subunit alpha;  
    4::93      2e-12  29%   96 aa  IHFA_HAEIN RecName: Full=Integration host factor subunit alpha;  
    4::93      2e-12  29%   96 aa  IHFA_HAEIE RecName: Full=Integration host factor subunit alpha;  
    4::93      2e-12  29%   96 aa  IHFA_HAEI8 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-12  34%  104 aa  IHFA_BUCCC RecName: Full=Integration host factor subunit alpha;  
    5::87      2e-12  34%   90 aa  DBH_THEAC RecName: Full=DNA-binding protein HTa;
    1::91      2e-12  40%   94 aa  DBH_HELPY RecName: Full=DNA-binding protein HU;
    1::90      3e-12  37%  107 aa  IHFB_BURVG RecName: Full=Integration host factor subunit beta;   
    1::90      3e-12  37%  107 aa  IHFB_BURS3 RecName: Full=Integration host factor subunit beta;   
    1::90      3e-12  37%  107 aa  IHFB_BURCM RecName: Full=Integration host factor subunit beta;   
    1::90      3e-12  37%  107 aa  IHFB_BURCJ RecName: Full=Integration host factor subunit beta;   
    1::90      3e-12  37%  107 aa  IHFB_BURCH RecName: Full=Integration host factor subunit beta;   
    1::90      3e-12  37%  107 aa  IHFB_BURCC RecName: Full=Integration host factor subunit beta;   
    1::90      3e-12  37%  107 aa  IHFB_BURCA RecName: Full=Integration host factor subunit beta;   
    1::90      3e-12  37%  107 aa  IHFB_BURA4 RecName: Full=Integration host factor subunit beta;   
    6::94      3e-12  31%  100 aa  IHFA_SILPO RecName: Full=Integration host factor subunit alpha;  
    6::91      3e-12  34%  105 aa  IHFA_RHORT RecName: Full=Integration host factor subunit alpha;  
    4::93      3e-12  33%  100 aa  IHFA_PSEPW RecName: Full=Integration host factor subunit alpha;  
    4::93      3e-12  33%  100 aa  IHFA_PSEPU RecName: Full=Integration host factor subunit alpha;  
    4::93      3e-12  33%  100 aa  IHFA_PSEPK RecName: Full=Integration host factor subunit alpha;  
    4::93      3e-12  33%  100 aa  IHFA_PSEPG RecName: Full=Integration host factor subunit alpha;  
    4::93      3e-12  33%  100 aa  IHFA_PSEP1 RecName: Full=Integration host factor subunit alpha;  
    4::93      3e-12  33%  100 aa  IHFA_PSEMY RecName: Full=Integration host factor subunit alpha;  
    4::93      3e-12  36%   98 aa  IHFA_MARMS RecName: Full=Integration host factor subunit alpha;  
    3::92      3e-12  33%   98 aa  IHFA_MANSM RecName: Full=Integration host factor subunit alpha;  
    3::92      3e-12  33%  103 aa  IHFA_COXBU RecName: Full=Integration host factor subunit alpha;  
    3::92      3e-12  33%  103 aa  IHFA_COXBR RecName: Full=Integration host factor subunit alpha;  
    3::92      3e-12  33%  103 aa  IHFA_COXBN RecName: Full=Integration host factor subunit alpha;  
    3::92      3e-12  33%  103 aa  IHFA_COXB2 RecName: Full=Integration host factor subunit alpha;  
    3::92      3e-12  33%  103 aa  IHFA_COXB1 RecName: Full=Integration host factor subunit alpha;  
    4::93      3e-12  33%  102 aa  IHFA_CHRSD RecName: Full=Integration host factor subunit alpha;  
    6::94      4e-12  33%  101 aa  IHFA_MARMM RecName: Full=Integration host factor subunit alpha;  
    3::91      4e-12  34%   97 aa  IHFA_HAES2 RecName: Full=Integration host factor subunit alpha;  
    3::91      4e-12  34%   97 aa  IHFA_HAES1 RecName: Full=Integration host factor subunit alpha;  
    1::90      6e-12  33%   92 aa  IHFB_VIBCM RecName: Full=Integration host factor subunit beta;   
    1::90      6e-12  33%   92 aa  IHFB_VIBCH RecName: Full=Integration host factor subunit beta;   
    1::90      6e-12  33%   92 aa  IHFB_VIBC3 RecName: Full=Integration host factor subunit beta;   
    4::93      6e-12  29%   96 aa  IHFA_HAEIG RecName: Full=Integration host factor subunit alpha;  
    5::94      7e-12  32%  101 aa  IHFA_SACD2 RecName: Full=Integration host factor subunit alpha;  
    4::93      7e-12  32%  100 aa  IHFA_ALCBS RecName: Full=Integration host factor subunit alpha;  
   23::95      1e-11  40%  104 aa  IHFB_NEIMF RecName: Full=Integration host factor subunit beta;   
   23::95      1e-11  40%  104 aa  IHFB_NEIMB RecName: Full=Integration host factor subunit beta;   
   23::95      1e-11  40%  104 aa  IHFB_NEIMA RecName: Full=Integration host factor subunit beta;   
   23::95      1e-11  40%  104 aa  IHFB_NEIGO RecName: Full=Integration host factor subunit beta;   
    1::88      1e-11  37%   94 aa  IHFB_BUCAT RecName: Full=Integration host factor subunit beta;   
    1::88      1e-11  37%   94 aa  IHFB_BUCAI RecName: Full=Integration host factor subunit beta;   
    1::88      1e-11  37%   94 aa  IHFB_BUCA5 RecName: Full=Integration host factor subunit beta;   
    4::92      1e-11  29%   99 aa  IHFA_PSYCK RecName: Full=Integration host factor subunit alpha;  
    4::92      1e-11  29%   99 aa  IHFA_PSYA2 RecName: Full=Integration host factor subunit alpha;  
    6::94      1e-11  31%  107 aa  IHFA_BART1 RecName: Full=Integration host factor subunit alpha;  
    6::94      1e-11  33%  103 aa  IHFA_BARBK RecName: Full=Integration host factor subunit alpha;  
    3::92      1e-11  30%   98 aa  IHFA_ACTSZ RecName: Full=Integration host factor subunit alpha;  
    4::92      1e-11  30%   98 aa  IHFA_ACIBY RecName: Full=Integration host factor subunit alpha;  
    4::92      1e-11  30%   98 aa  IHFA_ACIBT RecName: Full=Integration host factor subunit alpha;  
    4::92      1e-11  30%   98 aa  IHFA_ACIBS RecName: Full=Integration host factor subunit alpha;  
    4::92      1e-11  30%   98 aa  IHFA_ACIBC RecName: Full=Integration host factor subunit alpha;  
    4::92      1e-11  30%   98 aa  IHFA_ACIB5 RecName: Full=Integration host factor subunit alpha;  
    4::92      1e-11  30%   98 aa  IHFA_ACIB3 RecName: Full=Integration host factor subunit alpha;  
    3::92      2e-11  34%  100 aa  IHFA_BUCAP RecName: Full=Integration host factor subunit alpha;  
    4::92      2e-11  30%   97 aa  IHFA_ACIAD RecName: Full=Integration host factor subunit alpha;  
   10::96      2e-11  32%  130 aa  DBH_UREPA RecName: Full=DNA-binding protein HU;
    8::96      2e-11  27%  100 aa  IHFA_ZYMMO RecName: Full=Integration host factor subunit alpha;  
    6::94      2e-11  30%  105 aa  IHFA_XANP2 RecName: Full=Integration host factor subunit alpha;  
    8::96      2e-11  29%  100 aa  IHFA_ERYLH RecName: Full=Integration host factor subunit alpha;  
    3::88      3e-11  29%   97 aa  IHFA_THICR RecName: Full=Integration host factor subunit alpha;  
    3::92      3e-11  31%   98 aa  IHFA_ACTPJ RecName: Full=Integration host factor subunit alpha;  
    3::92      3e-11  31%   98 aa  IHFA_ACTP7 RecName: Full=Integration host factor subunit alpha;  
    3::92      3e-11  31%   98 aa  IHFA_ACTP2 RecName: Full=Integration host factor subunit alpha;  
    1::90      4e-11  36%   93 aa  IHFB_PASHA RecName: Full=Integration host factor subunit beta;   
    8::96      4e-11  31%  106 aa  IHFA_NITWN RecName: Full=Integration host factor subunit alpha;  
    8::96      4e-11  31%  110 aa  IHFA_NITHX RecName: Full=Integration host factor subunit alpha;  
    8::96      5e-11  29%  100 aa  IHFA_SPHWW RecName: Full=Integration host factor subunit alpha;  
    6::94      5e-11  29%  105 aa  IHFA_AZOC5 RecName: Full=Integration host factor subunit alpha;  
    1::90      8e-11  36%   99 aa  TF1_BPSP1 RecName: Full=Transcription factor 1;
    8::96      8e-11  30%  113 aa  IHFA_RHOP5 RecName: Full=Integration host factor subunit alpha;  
    6::94      1e-10  28%   97 aa  IHFA_SPHAL RecName: Full=Integration host factor subunit alpha;  
    8::96      1e-10  30%  108 aa  IHFA_RHOPB RecName: Full=Integration host factor subunit alpha;  
    8::96      1e-10  30%  119 aa  IHFA_BRASO RecName: Full=Integration host factor subunit alpha;  
    8::96      1e-10  30%  119 aa  IHFA_BRASB RecName: Full=Integration host factor subunit alpha;  
    6::94      1e-10  30%  118 aa  IHFA_RHOPT RecName: Full=Integration host factor subunit alpha;  
    8::96      1e-10  30%  123 aa  IHFA_RHOPS RecName: Full=Integration host factor subunit alpha;  
    6::94      1e-10  30%  118 aa  IHFA_RHOPA RecName: Full=Integration host factor subunit alpha;  
    8::96      1e-10  30%  123 aa  IHFA_RHOP2 RecName: Full=Integration host factor subunit alpha;  
    6::94      1e-10  29%  104 aa  IHFA_BARQU RecName: Full=Integration host factor subunit alpha;  
    6::94      1e-10  29%  108 aa  IHFA_BARHE RecName: Full=Integration host factor subunit alpha;  
    6::91      2e-10  30%  108 aa  IHFA_METEP RecName: Full=Integration host factor subunit alpha;  
    6::91      2e-10  30%  108 aa  IHFA_METC4 RecName: Full=Integration host factor subunit alpha;  
    1::90      2e-10  34%   97 aa  IHFB_BUCCC RecName: Full=Integration host factor subunit beta;   
    8::96      2e-10  29%  114 aa  IHFA_OLICO RecName: Full=Integration host factor subunit alpha;  
    6::91      3e-10  29%  104 aa  IHFA_METS4 RecName: Full=Integration host factor subunit alpha;  
    6::91      4e-10  29%  108 aa  IHFA_METPB RecName: Full=Integration host factor subunit alpha;  
   38::85      5e-10  50%  102 aa  IHFA_BUCAT RecName: Full=Integration host factor subunit alpha;  
   38::85      5e-10  50%  102 aa  IHFA_BUCAI RecName: Full=Integration host factor subunit alpha;  
   38::85      5e-10  50%  102 aa  IHFA_BUCA5 RecName: Full=Integration host factor subunit alpha;  
    3::92      7e-10  30%   98 aa  IHFA_HAEDU RecName: Full=Integration host factor subunit alpha;  
    6::91      9e-10  29%  106 aa  IHFA_METRJ RecName: Full=Integration host factor subunit alpha;  
   22::89      2e-09  35%   94 aa  DBH_AQUAE RecName: Full=DNA-binding protein HU;
    4::94      3e-09  32%  100 aa  DBH_CHLTR RecName: Full=Probable DNA-binding protein HU;
    4::94      3e-09  32%  100 aa  DBH_CHLPN RecName: Full=Probable DNA-binding protein HU;
    4::94      3e-09  32%  100 aa  DBH_CHLMU RecName: Full=Probable DNA-binding protein HU;
    8::95      1e-08  32%  105 aa  DBH_TREPA RecName: Full=DNA-binding protein HU;
   42::88      1e-08  43%  218 aa  DBH2_STRLI RecName: Full=DNA-binding protein HU 2;
   42::88      1e-08  43%  218 aa  DBH2_STRCO RecName: Full=DNA-binding protein HU 2;
    9::103     7e-07  30%  108 aa  DBH_BORPR RecName: Full=DNA-binding protein HBbu;
    9::103     7e-07  31%  108 aa  DBH_BORAF RecName: Full=DNA-binding protein HBbu;
    9::103     9e-07  31%  108 aa  DBH_BORAD RecName: Full=DNA-binding protein HBbu;
    9::103     1e-06  31%  108 aa  DBH_BORJA RecName: Full=DNA-binding protein HBbu;
    9::92      2e-06  33%  104 aa  VHLP_ASFWA RecName: Full=Viral histone-like protein A104R;
    9::92      2e-06  33%  104 aa  VHLP_ASFP4 RecName: Full=Viral histone-like protein A104R;
    9::92      2e-06  33%  104 aa  VHLP_ASFM2 RecName: Full=Viral histone-like protein;
    9::92      2e-06  33%  104 aa  VHLP_ASFK5 RecName: Full=Viral histone-like protein A104R;
    9::92      2e-06  33%  104 aa  VHLP_ASFB7 RecName: Full=Viral histone-like protein;
   38::103     2e-06  35%  108 aa  DBH_BORBU RecName: Full=DNA-binding protein HU;AltName: Full=HBbu;
    9::103     3e-06  29%  108 aa  DBH_BORTU RecName: Full=DNA-binding protein HBbu;
    9::103     4e-06  31%  108 aa  DBH_BORGA RecName: Full=DNA-binding protein HBbu;
   24::87      1e-05  38%   95 aa  HLP_RICPR RecName: Full=Histone-like DNA-binding protein;
   28::87      1e-04  38%   95 aa  HLP_RICRI RecName: Full=Histone-like DNA-binding protein;
   28::87      2e-04  37%   95 aa  HLP_RICTY RecName: Full=Histone-like DNA-binding protein;
    3::87      2e-04  24%   95 aa  HLP_RICCN RecName: Full=Histone-like DNA-binding protein;
    3::87      3e-04  24%   95 aa  HLP_RICMO RecName: Full=Histone-like DNA-binding protein;
   28::87      3e-04  40%   95 aa  HLP_RICFE RecName: Full=Histone-like DNA-binding protein;
  174::204     0.001  52%  541 aa  Y537_SYNY3 RecName: Full=Putative ammonium transporter sll0537;
    1::90

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNKSELVSAIAKEADVTKEVASNTLDATIAAVTKALKNGDSVTLVGFGTFQVKERSPREGRNPKTGETIK
DBHB_PSEAE      MNKSELIDAIAASADIPKAVAGRALDAVIESVTGALKAGDSVVLVGFGTFAVKERAARTGRNPQTGKPIK
DBHB_NEIMB      MNKSELIEAIAQEADISKAAAQKALDATTNAVTTALKQGDTVTLVGFGTFYVGERAERQGRNPKTGEPLT
DBHB_NEIMA      MNKSELIEAIAQEADISKAAAQKALDATTNAVTTALKQGDTVTLVGFGTFYVGERAERQGRNPKTGEPLT
DBH_XYLFT       MNKTELIDGVAAAANLSKVEAGRAIDAVVNEITEALKEGDSVTLVGFGTFQVRQRAERPGRNPKTGEPIM
DBH_STAAW       MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKGRNPQTGKEID
DBH_STAAS       MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKGRNPQTGKEID
DBH_STAAR       MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKGRNPQTGKEID
DBH_STAAN       MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKGRNPQTGKEID
DBH_STAAM       MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKGRNPQTGKEID
DBH_STAAC       MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKGRNPQTGKEID
DBH_BACST       MNKTELINAVAETSGLSKKDATKAVDAVFDSITEALRKGDKVQLIGFGNFEVRERAARKGRNPQTGEEME
DBH_BACCL       MNKTELINAVAETSGLSKKDATKAVDAVFDSITEALRKGDKVQLIGFGNFEVRERAARKGRNPQTGEEME
DBH_BACCA       MNKTELINAVAETSGLSKKDATKAVDAVFDSITEALRKGDKVQLIGFGNFEVRERAARKGRNPQTGEEME
DBH1_BACSU      MNKTELINAVAEASELSKKDATKAVDSVFDTILDALKNGDKIQLIGFGNFEVRERSARKGRNPQTGEEIE
DBHA_VIBCH      MNKTQLIDFIAEKADLTKVQAKAALEATLGAVEGALKDGDQVQLIGFGTFKVNHRSARTGRNPKTGEEIK
DBH_XYLFA       MNKTELIDGVAAAANLSKVEAGRAIDAVVNEITEALKKGDSVTLVGFGTFQVRPRAERPGRNPKSGELIM
DBH1_BACHD      MNKTDLINAVAEQAELSKKDASKAVDAVFESITGALKEGGKVQLVGFGSFEVRERSARKGRNPQTGEEIE
DBHB_VIBCH      MNKTQLVEQIAANADISKASAGRALDAFIEAVSGTLQSGDQVALVGFGTFSVRTRAARTGRNPKTGEEIK
DBHA_SERMA      MNKTQLIDVIADKADLSKAQAKLALESTLAAITESLKEGDAVQLVGFGTFKVNHRSERTGRNPQTGKEIK
DBHA_SHIFL      MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIK
DBHA_ECOLI      MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIK
DBHA_ECOL6      MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIK
DBHA_ECO57      MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIK
DBHA_SALTY      MNKTQLIDVIADKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIK
DBHA_SALTI      MNKTQLIDVIADKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIK
DBH_HAEIN       MNKTDLIDAIANAAELNKKQAKAALEATLDAITASLKEGEPVQLIGFGTFKVNERAARTGRNPQTGAEIQ
DBHA_VIBPR      MNKTQLIDFIAEKADLSKAQAKAALEATLDGVTDALKEGDQVQLIGFGTFKVNHRAARTGRNPKTGAEIQ
DBH_PASMU       MNKTDLIDAIASAAELNKKQAKAALEATLEAISGSLKAGEPVQLIGFGTFKVNSRKARTGRNPQTGAEIK
DBHC_NEIMA      MNKSELIQAIADEAELSKRAAAEFVNAFVSVVTQELKDGNDVTLVGFGTFHAAQSAERQGRNPKTGEPLT
DBHA_AERHY      MNKAQLVDAIAAKADLSKAQAKVALEEIINGITQSLKEGDAVQLVGFGTFKVNHRAGRTGRNPQTGKEIQ
DBH_BUCAI       MNKTQLINVISKKSNLSKIQAKLTLETTLSTIIDSLKKGESVQIVGFGTFKVNLRSSRTGRNPQTGKEIQ
DBH_ANASP       MNKGELVDAVAEKASVTKKQADAVLTAALETIIEAVSSGDKVTLVGFGSFESRERKAREGRNPKTNEKME
DBH1_RHIRD      MNKNELVSAVAEKAGLTKADAASAVDAVFETVQSELKNGGDIRLAGFGSFSVSRREASKGRNPSTGAEVD
DBH1_RHILE      MNKNELVSAVAEKAGLTKADAASAVDAVFETVQSELKNGGDIRLAGFGSFSVSRREASKGRNPSTGAEVD
DBH_CLOPA       MNKAELITSMAEKSKLTKKDAELALKALIESVEEALEKGEKVQLVGFGTFETRERAAREGRNPRTKEVIN
DBH_BUCAP       MNKTQLIKIISKQSNLSKIQIKSTLEKILSAIIESLKKGESVQIVGFGTFKVNSRASRTGRNPQTGKEII
DBH2_BACHD      MNKTELIHQVAERTQMSKKDAGEVVNTVFDVIAESLAQGDSVQLIGFGNFEVRERAARKGRNPQTGEEID
DBHA_BURPS      MNKQELIDAVAAQTGASKAQTGETLDTLLEVIKKAVSKGDSVQLIGFGSFGSGKRAARTGRNPKTGETIK
DBH_STRDO       -NKQDLIAKVAEATELTKKDSAAAVDTVFSSIEGFLSKGEKVQLIGFGNFEVRERAARKGRNPQTGAEIK
DBH_STRPY       -NKQDLIAKVAEATELTKKDSAAAVDAVFSTIEAFLAEGEKVQLIGFGNFEVRERAARKGRNPQTGAEIE
DBH_STRP8       -NKQDLIAKVAEATELTKKDSAAAVDAVFSTIEAFLAEGEKVQLIGFGNFEVRERAARKGRNPQTGAEIE
DBH_STRP6       -NKQDLIAKVAEATELTKKDSAAAVDAVFSTIEAFLAEGEKVQLIGFGNFEVRERAARKGRNPQTGAEIE
DBH_STRP3       -NKQDLIAKVAEATELTKKDSAAAVDAVFSTIEAFLAEGEKVQLIGFGNFEVRERAARKGRNPQTGAEIE
DBH_STRP1       -NKQDLIAKVAEATELTKKDSAAAVDAVFSTIEAFLAEGEKVQLIGFGNFEVRERAARKGRNPQTGAEIE
DBH_LACLA       -NKQDLIAEVAAKTGLTKKDSEKAVNAFGEVVTEFLAKGEKVQLIGFGTFETRERAAREGRNPQTGEAIK
DBH_BUCBP       MNKSELINIISKKSNLSKIQIKNILEITLTAIIQSLKDGNSVQLVGFGTFKVNNRAARIGRNPQTGQTIH
DBHB_SERMA      MNKSQLIXXXXXXXXXXXXXXXXXLDAVIASVTDSLKAGDDVALVGFGSFTVRERSARTGRNPQTGKEIK
DBHA_PSEAE      MRKPELAAAIAEKADLTKEQANRVLNALLDEITGALNRKDSVTLVGFGTFLQRHRGARTGKNPQTGQPVK
DBH_STRMU       -NKQDLIAKVAEATELTKKXXXXXXXXXXXXXXXYLAKGEKVQLIGFGNFEVRERAARKGRNPQTGEEIK
DBH_STRTR       -NKQDLIAKVAEATELTXXXXXXXXXXXXXXIEEFLAAGEKVQLIGFGNFEVRERAARQGRNPQTGETIS
DBH_STRGN       -NKQDLIAKVAAATELTKKDSXXXXXXXXXXXTEYLSKGEKVQLIGFGNFEVRERAARKGRNPQTGKETK
DBH_SYNY3       MNKGELVHAVTDKASITKKEVDAVISAAIDCIMEVVAEGEKVTLVGFGSFEARERKEREGRNPKTGDKML
DBHB_PSEF5      MNKSELIDAIAASADLPKAAAGRALDAVIESVTGALKAGDSVVLVGFGTFSVTDRPARIGRNPQTGKTLE
DBH_CAUCR       --KAELVTAIAEKAGINKNQAKDALEAFIEAVTDSLKSGQDVRLVGFGTFKAVTRAAGTARNPRTGETVN
DBH_CAUCN       --KAELVTAIAEKAGINKNQAKDALEAFIEAVTDSLKSGQDVRLVGFGTFKAVTRAAGTARNPRTGETVN
DBHB_SALTY      MNKSQLIEXXXXXXXXXXXXXXXXXXXXXXSVTESLKEGDDVALVGFGTFAVKERAARTGRNPQTGKEIT
DBHB_SALTI      MNKSQLIEXXXXXXXXXXXXXXXXXXXXXXSVTESLKEGDDVALVGFGTFAVKERAARTGRNPQTGKEIT
DBHB_SHIFL      MNKSQLIXXXXXXXXXXXXXXXXXXXXXXXSVTESLKEGDDVALVGFGTFAVKERAARTGRNPQTGKEIT
DBHB_ECOLI      MNKSQLIXXXXXXXXXXXXXXXXXXXXXXXSVTESLKEGDDVALVGFGTFAVKERAARTGRNPQTGKEIT
DBHB_ECOL6      MNKSQLIXXXXXXXXXXXXXXXXXXXXXXXSVTESLKEGDDVALVGFGTFAVKERAARTGRNPQTGKEIT
DBHB_ECO57      MNKSQLIXXXXXXXXXXXXXXXXXXXXXXXSVTESLKEGDDVALVGFGTFAVKERAARTGRNPQTGKEIT
DBH_RHIME       MNKNELVAAVADKAGLSKXXXXXXXXXXFETIQGELKNGGDIRLVGFGNFSVSRREASKGRNPSTGAEVD
DBH_THET8       VTKADLVDQVAQATGLKKKDVKAMVDALLAKVEEALANGSKVQLTGFGTFEVRKRKARTGVKPGTKEKIK
IHFA_BORA1      LTKAELAELLFERVGLNKREAKDIVDTFFEEIREALARGDSVKLSGFGNFQVRDKPPRPGRNPKTGETIP
DBH_CAMJR       MTKADFISLVAQTAGLXXXXXXXXXXXVISTITDVLAKGDSISFIGFGTFSTQERAAREARVPSTGKTIK
DBH_CAMJE       MTKADFISLVAQTAGLXXXXXXXXXXXVISTITDVLAKGDSISFIGFGTFSTQERAAREARVPSTGKTIK
IHFA_BORPE      LTKAELAELLFERVGLNKREAKDIVDTFFEEIRDALARGDSVKLSGFGNFQVRDKPPRPGRNPKTGETIP
IHFA_BORPA      LTKAELAELLFERVGLNKREAKDIVDTFFEEIRDALARGDSVKLSGFGNFQVRDKPPRPGRNPKTGETIP
IHFA_BORBR      LTKAELAELLFERVGLNKREAKDIVDTFFEEIRDALARGDSVKLSGFGNFQVRDKPPRPGRNPKTGETIP
DBH5_RHILE      MNKNELVSAVAEKAGLTKXXXXXXXXXXXXXXQAELKNKGDIRLAGFGSFTVSHRAATKGRNPSTGAEVD
IHFB_ACTSZ      MTKSELIELLAKKPSISTKIVENSVKEILEQMSGSLENSDRIEIRGFGSFSLHYRQPRLGRNPKTGESVK
DBH_GUITH       MNKSQLISKIAYYTKYSKTDIEKIITSMLEIIVDTVATGEKVTLVGFGSFEARERKAREGRNPRTGEKLF
IHFA_BURPS      LTKAELAELLFDSVGLNKREAKDMVEAFFEVIRDALENGESVKLSGFGNFQLRDKPQRPGRNPKTGEAIP
IHFB_HAEIN      MTKSELMEKLAKQPTLPAKEIENMVKGILEFISQSLENGDRVEVRGFGSFSLHHRQPRLGRNPKTGDSVN
IHFB_HAEIE      MTKSELMEKLAKQPTLSAKEIENMVKDILEFISQSLENGDRVEVRGFGSFSLHHRQPRLGRNPKTGDSVN
IHFB_HAEI8      MTKSELMEKLAKQPTLSAKEIENMVKDILEFISQSLENGDRVEVRGFGSFSLHHRQPRLGRNPKTGDSVN
IHFB_BART1      MVKSELVQIIARHPHLFQRDVENIVNAIFEEISTALANGDRVELRGFGAFSVKSRSARNGRNPRTGEAVA
IHFA_RALSO      LTKAELAEMLFEQVGLNKRESKDMVEAFFDVIREALEQGDSVKLSGFGNFQLRDKPQRPGRNPKTGEIIP
IHFA_METFK      LTKADLADLLFEQVGLNKREAKDMVEAFFEEIRMALEAGDSVKLSGFGNFELRQKSERPGRNPKTGEEIP
IHFA_AZOSB      LTKAELADLLFERVGLNKREAKDMVEGFFEEIRTALERGDSVKLSGFGNFQLRDKPQRPGRNPKTGEEIP
IHFB_METCA      MTKSELIESLAKYPHLSPRDIEHAIKEMIGCMSEALAGGERIEIRGFGSFSLHHRPPRVGRNPKTGESVH
DBH2_BPSPC      MNKTELIAKVAEKQGVSKKEGAPSVEKVFDTISEALKSGEKVSIPGFGTFEVRERAARKGRNPQTGEEID
DBH2_BACSU      MNKTELIAKVAEKQGVSKKEGAPSVEKVFDTISEALKSGEKVSIPGFGTFEVRERAARKGRNPQTGEEID
IHFB_HAHCH      MTKSELVEIIAKQPQLSIKDVELAVKTIIEYMSQSLSQGQRIEIRGFGSFSLHYRAPRVGRNPKTGETVH
IHFB_HAEIG      MTKSELMEKLAKQPTLPAKEIENMVKDILEFISQSLENGDRVEVRGFGSFSLHHRQPRLGRNPKTGDSVN
IHFB_MANSM      MTKSELISLVEKNHSISVKSVENAVKEILEHMSQALESGDRIEIRGFGSFSLHFRQPRVGRNPKTGAQVK
IHFA_VIBCM      LTKAELAEALFEQLGMSKRDAKDTVEVFFEEIRKALESGEQVKLSGFGNFDLRDKNERPGRNPKTGEDIP
IHFA_VIBCH      LTKAELAEALFEQLGMSKRDAKDTVEVFFEEIRKALESGEQVKLSGFGNFDLRDKNERPGRNPKTGEDIP
IHFA_VIBC3      LTKAELAEALFEQLGMSKRDAKDTVEVFFEEIRKALESGEQVKLSGFGNFDLRDKNERPGRNPKTGEDIP
IHFA_DELAS      LTKAQLADLLFDEIGLNKRESKEMVDAFFELISQSLVTGEDVKLSGFGNFQIRTKAPRPGRNPRTGEAIP
IHFA_CHRVO      LTKAELADLLFDQVGLNKREAKDMVESFFEEIRLALESGDSVKLSGFGNFQLRDKPQRPGRNPKTGEEIP
IHFB_DICNV      MTKSELIERLVKYPQLRAQDVEDTVKLMIERICHTLEKGDRVEIRGFGSFSLHYRESRQGRNPKTGESVR
IHFA_NITMU      LTKAELADLLFEKVGFNKREAKDMVESFYEEVRIALQNGDGVKLSGFGNFQLRDKPQRPGRNPKTGEEIP
IHFB_PSEHT      MTKSELIETLAQQAHVPVKDVENAVKEILEQMAGSLSSSDRIEIRGFGSFSLHYRAPRTGRNPKTGETVE
IHFB_DECAR      MTKSELIAQLAERPQLVAKDADFAVKMILDAMSEALVRGDRIEIRGFGSFALNYRPPRVGRNPKSGEKVS
IHFA_VIBFM      LTKADLAETLFEKVGLSKRDAKETVEVFFEEIKQALESGEQVKLSGFGNFDLREKSERPGRNPKTGEDIP
IHFA_VIBF1      LTKADLAETLFEKVGLSKRDAKETVEVFFEEIKQALESGEQVKLSGFGNFDLREKSERPGRNPKTGEDIP
IHFA_SHELP      LTKAEMAEHLFETLGINKRVAKEMVEAFFEEIRQALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_POLSJ      LTKAHLAELLFEQIGLNKRESKDMIDAFFDLISDSLVDGNDVKISGFGNFQIRTKAPRPGRNPRTGEAIP
IHFA_ALISL      LTKADLAETLFEKVGLSKRDAKETVEVFFEEIKQALESGEQVKLSGFGNFDLREKSERPGRNPKTGEDIP
DBH_THEMA       MTKKELIDRVXXXXXXXXXDVKLILDTILETITEALAKGEKVQIVGFGSFEVRKAAARKGVNPQTRKPIT
IHFB_THISH      MTKSELIEILAKQSHLAYKDVELSVKTMLEHLSQALATGDRIEIRGFGSFSLHFRPPRVGRNPKTGETVS
IHFA_AZOSE      LTKAELADLLFERVGLNKREAKDMVEGFFEEIRQALERGECVKLSGFGNFQLRDKPQRPGRNPKTGEEIP
DBH_RICPR       MNKTEFIAFMAAHKTLTKADAEKALNLVIESVISAIKSKHNVNLTGFGSFEIHHRKEREGRNPKTGAKMK
IHFB_SACD2      MTKSELIERIAERQD---QLSAKDIELAVKLVSQALSTGERIEIRGFGSFSLHFRAPRTGRNPKTGESVT
IHFB_OCHA4      MIKSELVQIIARNPHLFQRDVENIVGAVFDEITNALAEGNRVELRGFGAFSVKNRPARSGRNPRTGETVD
IHFB_BRUSU      MIKSELVQIIARNPHLFQRDVENIVGAVFDEITNALAEGNRVELRGFGAFSVKNRPARSGRNPRTGETVD
IHFB_BRUSI      MIKSELVQIIARNPHLFQRDVENIVGAVFDEITNALAEGNRVELRGFGAFSVKNRPARSGRNPRTGETVD
IHFB_BRUO2      MIKSELVQIIARNPHLFQRDVENIVGAVFDEITNALAEGNRVELRGFGAFSVKNRPARSGRNPRTGETVD
IHFB_BRUC2      MIKSELVQIIARNPHLFQRDVENIVGAVFDEITNALAEGNRVELRGFGAFSVKNRPARSGRNPRTGETVD
IHFB_BRUAB      MIKSELVQIIARNPHLFQRDVENIVGAVFDEITNALAEGNRVELRGFGAFSVKNRPARSGRNPRTGETVD
IHFB_BRUA2      MIKSELVQIIARNPHLFQRDVENIVGAVFDEITNALAEGNRVELRGFGAFSVKNRPARSGRNPRTGETVD
IHFB_BRUA1      MIKSELVQIIARNPHLFQRDVENIVGAVFDEITNALAEGNRVELRGFGAFSVKNRPARSGRNPRTGETVD
IHFA_PSYIN      LTKAEIAADLSVKIGLSKREAKEFVESFFEEIKATLENGEAVKISGFGGFELKDKSERPGRNPKTGEDIP
IHFA_CAUSK      LTRADLCEAVHEEVGLTRQDCAGLVERTLDLVAEALEKGETVKLSGFGVFQVRDKRARMGRNPKTGEPAE
IHFA2_DECAR     LTKAELADLLFEKVGLNKREAKDMVEAFFEEIRNALEVGDGVKLSGFGNFQLRDKPQRPGRNPKTGQEIP
IHFB_XANOP      MTKSELIEILARQAHLKSDDVDLAVKSLLEMMGQALSDGDRIEIRGFGSFSLHYRPPRLGRNPKTGESVA
IHFB_XANOM      MTKSELIEILARQAHLKSDDVDLAVKSLLEMMGQALSDGDRIEIRGFGSFSLHYRPPRLGRNPKTGESVA
IHFB_XANCP      MTKSELIEILARQAHLKSDDVDLAVKSLLEMMGQALSDGDRIEIRGFGSFSLHYRPPRLGRNPKTGESVA
IHFB_XANCB      MTKSELIEILARQAHLKSDDVDLAVKSLLEMMGQALSDGDRIEIRGFGSFSLHYRPPRLGRNPKTGESVA
IHFB_XANC8      MTKSELIEILARQAHLKSDDVDLAVKSLLEMMGQALSDGDRIEIRGFGSFSLHYRPPRLGRNPKTGESVA
IHFB_XANAC      MTKSELIEILARQAHLKSDDVDLAVKSLLEMMGQALSDGDRIEIRGFGSFSLHYRPPRLGRNPKTGESVA
IHFA_VIBSL      LTKADLAENLFETLGYSKRDAKETVEVFFEEVRKALENGEQVKLSGFGNFDLREKNERPGRNPKTGEDIP
IHFA_PROMH      LTKAEMAENLFEKLGVSKRDAKDLVEAFFEEVRRSLENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_NITEU      LTKAELTDLLFENIGLNKREAKEIVECFYEEMRAALQNGDGVKLSGFGNFQLRTKPQRPGRNPKTGEEIP
IHFA_NITEC      LTKAELTDLLFENIGLNKREAKEIVECFYEEMRTALQNGDGVKLSGFGNFQLRTKPQRPGRNPKTGEEIP
IHFB_TERTT      MTKSELIERIAERQD---QLSAKDIELAVKLISQCLANGDRIEIRGFGSFSLHYRAPRTGRNPKTGESVE
IHFB_RHOSK      MIRSELIQKIADEPHLTQRHVERIVNTVFEEIIEALARGDRVELRGFGAFSVKARDARVGRNPRTGEAVE
IHFB_RHOS4      MIRSELIQKIADEPHLTQRHVERIVNTVFEEIIEALARGDRVELRGFGAFSVKARDARVGRNPRTGEAVE
IHFB_RHOS1      MIRSELIQKIADEPHLTQRHVERIVNTVFEEIIEALARGDRVELRGFGAFSVKARDARVGRNPRTGEAVE
IHFB_BRUME      MIKSELVQIIARNPHLFQRDVVNIVGAVFDEITNALAEGNRVELRGFGAFSVKNRPARSGRNPRTGETVD
IHFB_BRUMB      MIKSELVQIIARNPHLFQRDVVNIVGAVFDEITNALAEGNRVELRGFGAFSVKNRPARSGRNPRTGETVD
IHFA_VIBVY      LTKADLAENLFEKLGFSKRDAKDTVEVFFEEIRKALENGEQVKLSGFGNFDLRDKNERPGRNPKTGEDIP
IHFA_VIBVU      LTKADLAENLFEKLGFSKRDAKDTVEVFFEEIRKALENGEQVKLSGFGNFDLRDKNERPGRNPKTGEDIP
IHFA_RHOFD      LTKAQLAELLFEKIGLNKRESKDMVDAFFDLVADSLLKGEDVKISGFGNFQIRTKAPRPGRNPRTGETIP
IHFB_HAEPS      MTKSELIALVAQYPSLSVKSVDESVKEILEQIMGSLEQGERIEVRGFGSFSLHYRQPRVGRNPKTGESVK
IHFA_SHEWM      LTKAEMAEHLFETLGINKRVAKEMVEAFFEEIRQALESGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_CAUCR      LTRADLCEAVHEEVGLTRQDCAGLVERTLDLVAEALEQGETVKLSGFGVFQVRAKRARMGRNPKTGEPAE
IHFA_CAUCN      LTRADLCEAVHEEVGLTRQDCAGLVERTLDLVAEALEQGETVKLSGFGVFQVRAKRARMGRNPKTGEPAE
IHFB_SILST      MIRSELIQKIADEPHLYQRDVERIVNTVFEEVTNAMSRGDRVELRGFGAFSVKKRDARVGRNPRTGETVH
IHFB_PASMU      MTKSELIERLVQKCHVAAKDVENAVKEILDQMSFALESGKRIEVRGFGSFSLHYRQPRLGRNPKTGEQVK
IHFB_HALHL      MTKSELIEAIAKQPHLAHKDVEDAVKKMLEHMSETLANGKRIEIRGFGSFSLHHRPARMGRNPKTGEPVA
IHFB_DINSH      MIRSELIQIVADEPHLYQRDVERIVNTVFEEIIEAMSNGDRVELRGFGAFSVKHRDARTGRNPRTGEAVA
IHFA_DICNV      LTKADIVEAIIAQIGIPRPEAREIVDDLFEEIRSCLATGEPVKLSGFGNFELRDKNQRPGRNPKTGEEIP
IHFB_NITMU      MTKSELIARLARHPQLGTKDAELAVKVILDAMAKSLSQGQRIEIRGFGSFDLNYRPPRVGRNPKSGEKVR
IHFB_AZOVD      MTKSELIERIVQQGQLSAKDVELAIKTMLEQMSQALATGDRIEIRGFGSFSLHYRAPRVGRNPKTGQTVR
IHFB_AZOSB      MTKSELIAQLAARPQLVAKDADYAVKMILDAMSDALARGDRIEIRGFGSFALNYRPPRVGRNPKSGEKVH
IHFB_ALHEH      MTKSELIEVIAKQQHLAHKDVELAVKTLLEQMSETLASGERIEIRGFGSFSLHHRPPRIGRNPKTGEPVA
IHFA_THIDA      LTKADLAELLFEKVGLNKREAKDVVESFFDEIRLALEKGDIVKLSGFGNFQCREKPQRPGRNPKTGEEMP
IHFA_PSEA6      LTKAEMAEHLFEKLGMNKRDAKDLVEAFFEEVREALESGEQVKLSGFGNFDLRQKSERPGRNPKTGEDIP
IHFA_METCA      LTKADMVERLFSELGLNKRDAKELVDQFFEVIKASLESGRSVKLSGFGNFDLRDKRQRPGRNPKTGEEIP
DBH_RICCN       MNKTEFIAFMASHKTLTKAEAEKALNLVLDSVISAIKSHHNINITGFGSFEIHHRKAREGRNPKTGAKMK
IHFB_RALME      MTKSELVEKLAARPQLLLRDADISVKTILDAMSEALADGHRIEIRGFGSFGLNKRPPRVGRNPKSGERVL
IHFB_HAES2      MTKSELIENLASNPNVPLKDIENAVKDILEQLSQALENGERIEIRGFGSFSLHFRQSRIGRNPKTGEKVD
IHFB_HAES1      MTKSELIENLASNPNVPLKDIENAVKDILEQLSQALENGERIEIRGFGSFSLHFRQSRIGRNPKTGEKVD
IHFB_DICD3      MTKSELIERLAQQSHIPAKVVEDAVKEMLEQMATTLASGDRIEIRGFGSFSLHYRAPRVGRNPKTGEKVE
IHFA_SHEFN      LTKAEMAEHLFETLGINKRVAKEMVESFFEEIREALESGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_PASHA      LTKIEIAENLIEKFGLEKRVANEFVELFFEEIRSSLENGEEVKLSGFGNFSLREKKARPGRNPKTGENVA
DBH_RICTY       MNKTEFIAYMAAHKTLTKADAEKALNLVIDSVISAIKSKHNVNLTGFGSFEIHHRKAREGRNPKTGAKMT
DBH_RICFE       MNKTEFIAFMASHKTLTKADAEKALNLVLDSVISAIKSHHNINITGFGSFEIHHRKAREGRNPKTGAKMK
DBH1_STRLI      MNRSELVAALADRAEVTRKDADAVLAAFAEVVGDIVSKGDEVTIPGFLTFERTHRAARTARNPQTGEPIQ
DBH1_STRCO      MNRSELVAALADRAEVTRKDADAVLAAFAEVVGDIVSKGDEVTIPGFLTFERTHRAARTARNPQTGEPIQ
IHFB_MARAV      MTKSELVELIAKQTQLSVKDVELAVKSIIEHMSQSLADGQRIEIRGFGSFSLHHRAARTGRNPKTGDAVQ
IHFB_BORPD      ------------------------------AMTQALASGQRIEIRGFGSFSLSQRSPRVGRNPKSGEQVL
IHFA_VIBPA      LTKAELAENLFDKLGFSKRDAKETVEVFFEEIRKALESGEQVKLSGFGNFDLRDKNERPGRNPKTGEDIP
IHFA_VIBHB      LTKAELAENLFDKLGFSKRDAKETVEVFFEEIRKALESGEQVKLSGFGNFDLRDKNERPGRNPKTGEDIP
IHFA_SHESH      LTKAEMAEHLFETLGINKRVAKEMVETFFEEIRQALESGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SHEPW      LTKAEMAEHLFETLGINKRVAKEMVETFFEEIRQALESGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SHEPA      LTKAEMAEHLFETLGINKRVAKEMVETFFEEIRQALESGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SHEHH      LTKAEMAEHLFETLGINKRVAKEMVETFFEEIRQALESGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
DBH_RICBR       MNKTEFIAFMTEXXSFTKADAEKALNWVLESIISATKHQHSVNITGFGSFGIQSRKSREGRNPKTGAKMT
IHFB_XYLFT      MTKSELIEILTKQAHLKSDDVDLAVKSLLEMMGGALSGGDRIEIRGFGSFSLHYRPPRCGRNPKTGESVA
IHFB_XYLFA      MTKSELIEILTKQAHLKSDDVDLAVKSLLEMMGGALSEGDRIEIRGFGSFSLHYRPPRCGRNPKTGESVA
IHFB_XYLF2      MTKSELIEILTKQAHLKSDDVDLAVKSLLEMMGGALSGGDRIEIRGFGSFSLHYRPPRCGRNPKTGESVA
IHFB_XANP2      MIKSELVQKIAENPHLYQRDVENIVNAILEQVASALERGDRVELRGFGAFSVKKRDARVGRNPRTGKQVD
IHFB_PSEAE      MTKSELIERIVTQGQLSAKDVELAIKTMLEQMSQALATGDRIEIRGFGSFSLHYRAPRVGRNPKTGESVR
IHFB_PSEAB      MTKSELIERIVTQGQLSAKDVELAIKTMLEQMSQALATGDRIEIRGFGSFSLHYRAPRVGRNPKTGESVR
IHFB_PSEA8      MTKSELIERIVTQGQLSAKDVELAIKTMLEQMSQALATGDRIEIRGFGSFSLHYRAPRVGRNPKTGESVR
IHFB_PSEA7      MTKSELIERIVTQGQLSAKDVELAIKTMLEQMSQALATGDRIEIRGFGSFSLHYRAPRVGRNPKTGESVR
IHFB_OLICO      MIKSELVQRIAEHPHLYQRDVENIVNAILEEIVSALARGDRVELRGFGAFSVKHRPARAGRNPRTGEHVP
IHFB_GRABC      MTKSELIASLKADNPHLTERDVETIVSTIFEISNALARGARVELRGFGAFTIKRRDARVGRNPRTGETVS
IHFB_BORPA      ------------------------------AMTQALASGQRIEIRGFGSFSLSQRSPRIGRNPKSGEQVL
IHFA_YERPY      LTKAEMSEHLFEKLGLSKRDAKDLVELFFEEVRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_YERPS      LTKAEMSEHLFEKLGLSKRDAKDLVELFFEEVRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_YERPP      LTKAEMSEHLFEKLGLSKRDAKDLVELFFEEVRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_YERPN      LTKAEMSEHLFEKLGLSKRDAKDLVELFFEEVRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_YERPG      LTKAEMSEHLFEKLGLSKRDAKDLVELFFEEVRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_YERPE      LTKAEMSEHLFEKLGLSKRDAKDLVELFFEEVRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_YERPB      LTKAEMSEHLFEKLGLSKRDAKDLVELFFEEVRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_YERPA      LTKAEMSEHLFEKLGLSKRDAKDLVELFFEEVRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_YERP3      LTKAEMSEHLFEKLGLSKRDAKDLVELFFEEVRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_YERE8      LTKAEMSEHLFEKLGLSKRDAKDLVELFFEEVRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SHEAM      LTKAEMAEHLFETLGINKRVAKEMVETFFEEIRSALESGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SERP5      LTKAEMSEHLFEKLGLSKRDAKDLVELFFEEVRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SERMA      LTKAEMSEHLFEKLGLSKRDAKDLVELFFEEVRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ANADF      MTKADIIESVYEKVGFSKKEAAEIVEMVFDTIKETLERGEKIKISGFGNFIVREKKSRVGRNPQTGEEIE
IHFB_ROSDO      MIRSELIQKIADEPHLYQRDVERIVNTIFEEVTGAMARGDRVELRGFGAFSVKKRDARIGRNPRTGETVH
IHFB_RHOP5      MIKSELVQRIAEHPHLYQRDVENIVNAILEEIVAALARGDRVELRGFGAFSVKHRPARAGRNPRTGEHVP
IHFB_RALEJ      MTKSELVEKLAARPQLLLRDADISVKTILDAMSDALADGHRIEIRGFGSFGLNRRPPRVGRNPKSGERVL
IHFB_PECCP      MTKSELIERLAQQSHIPAKVVEDAVKEMLEQMASTLAEGDRIEIRGFGSFSLHYRAPRVGRNPKTGDKVE
IHFB_MESSB      MIKSELVQTIARNPHLFLRDVENIVNAIFDEITEALAQGNRVELRGFGAFSVKNRPARTGRNPRTGESVH
IHFB_MARMS      MTKSELIELIDQQSHLPVKDVEQAIKAMLEHMSDSLANGERIEIRGFGSFSLHYRAPRIGRNPKTGESVE
IHFB_ERWCT      MTKSELIERLAQQSHIPAKVVEDAVKEMLEQMASTLAEGDRIEIRGFGSFSLHYRAPRVGRNPKTGDKVE
IHFB_AGRVS      MIKSELVQIVARNPHLYHRDVENIVNAVLDEITDALASGNRVELRGFGAFSVKNRPSRTGRNPRTGDTVF
IHFA_SODGM      LTKAEMSEYLFEKLGLSKRDAKEIVELFFEEVRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_PHOLL      LTKAEMSENLFEKLGISKRDAKDLVELFFEEVRRSLENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_PECCP      LTKAEMSEYLFEKLGLSKRDAKELVELFFEEVRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ERWT9      LTKAEMSEYLFEKLGLSKRDAKELVELFFEEVRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ERWCT      LTKAEMSEYLFEKLGLSKRDAKELVELFFEEVRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_DICD3      LTKAEMSEYLFEKLGLSKRDAKELVELFFEEVRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFB_SILPO      MIRSELIQKIADEPHLYQRDVERIVNTVFEEVTDAMARGDRVELRGFGAFSVKKRDARIGRNPRTGDTVH
IHFB_SHESW      MTKSELIEKLARQSQLSAKEVESAIKEMLEQMATTLESGDRIEIRGFGSFSLHYRAPRTGRNPKTGSSVE
IHFB_SHEPC      MTKSELIEKLARQSQLSAKEVESAIKEMLEQMATTLESGDRIEIRGFGSFSLHYRAPRTGRNPKTGSSVE
IHFB_RALSO      MTKSELVEKLAARPQLLLRDADIAVKTILDAMSDALADGHRIEIRGFGSFGLNRRPPRVGRNPKSGEKVL
IHFB_PSEMY      MTKSELIERIVTQGQLSSKDVELAIKTMLEQMSQALATGDRIEIRGFGSFSLHYRAPRVGRNPKTGQSVR
IHFB_PSEA6      MTKSELIERLADKA---RHVPSRDVELAIKEMAQTLQKGERIEIRGFGSFSLHYRAPRVGRNPKTGETVE
IHFB_NITWN      MIKSELVQRIAEHPHLYQRDVENIVNAILDEIVAALARGDRVELRGFGAFSVKHRPARAGRNPRTGEHVP
IHFB_NITHX      MIKSELVQRIAEHPHLYQRDVENIVNAILDEIVTALARGDRVELRGFGAFSVKHRPARAGRNPRTGEHVP
IHFB_AZOC5      MIKSELVQKIAENPHLYQRDVENIVNAILDQIVDALAQGDRVELRGFGAFSVKQREARTGRNPRTGKQVD
IHFA_SHESR      LTKAEMAEHLFETLGINKRVAKEMVESFFEEIRGALESGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SHESM      LTKAEMAEHLFETLGINKRVAKEMVESFFEEIRGALESGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SHESA      LTKAEMAEHLFETLGINKRVAKEMVESFFEEIRGALESGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SHEON      LTKAEMAEHLFETLGINKRVAKEMVESFFEEIRGALESGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SHEDO      LTKAEMAEHLFETLGLNKRVAKEMVESFFEEIREALESGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_POLNA      LTKAHLAELLFEQIGLNKRESKEMIDAFFELISDRLVEGKDVKISGFGNFQIRTKAPRPGRNPRTGEAIP
IHFA_MYXXD      MTKADIIEGVYEKVGFSKKESAEIVELVFDTLKETLERGDKIKISGFGNFQVRQKKARVGRNPQTGKEIE
IHFA_MYXXA      MTKADIIEGVYEKVGFSKKESAEIVELVFDTLKETLERGDKIKISGFGNFQVRQKKARVGRNPQTGKEIE
IHFB_STRMK      MTKSELIEILARQAHLKADDVDLAVKSLLEMMGGSLSAGDRIEIRGFGSFSLHYRPPRLGRNPKTGESVA
IHFB_STRM5      MTKSELIEILARQAHLKADDVDLAVKSLLEMMGGSLSAGDRIEIRGFGSFSLHYRPPRLGRNPKTGESVA
IHFB_SHEWM      MTKSELIEKLARQSQLSAKEVESAIKEMLEQMAQTLEGGDRIEIRGFGSFSLHFRAPRTGRNPKTGTSVE
IHFB_SHESR      MTKSELIEKLARQSQLSAKEVEGAIKEMLEQMATTLESGDRIEIRGFGSFSLHYRAPRTGRNPKTGSSVE
IHFB_SHESM      MTKSELIEKLARQSQLSAKEVEGAIKEMLEQMATTLESGDRIEIRGFGSFSLHYRAPRTGRNPKTGSSVE
IHFB_SHESA      MTKSELIEKLARQSQLSAKEVEGAIKEMLEQMATTLESGDRIEIRGFGSFSLHYRAPRTGRNPKTGSSVE
IHFB_SHEON      MTKSELIEKLARQSQLSAKEVEGAIKEMLEQMATTLESGDRIEIRGFGSFSLHYRAPRTGRNPKTGSSVE
IHFB_RHORT      MTKSELIARIARNPHLYQRDVERIVSTIFDEIADALARGDRVELRGFGAFSVKRRDARMGRNPRTGETVD
IHFB_RHILW      MIKSELVQIVARNPHLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKNRPSRSGRNPRTGDTVF
IHFB_RHIL3      MIKSELVQIVARNPHLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKNRPSRSGRNPRTGDTVF
IHFB_RHIEC      MIKSELVQIVARNPHLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKNRPSRSGRNPRTGDTVF
IHFB_RHIE6      MIKSELVQIVARNPHLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKNRPSRSGRNPRTGDTVF
IHFB_JANMA      MTKSELIARLAERPQLVAKDADYAVKTILDAMSDALATGQRIEIRGFGSFALNSRPPRIGRNPKSGDKVM
IHFB_HERAR      MTKSELIARLAERPQLVAKDADYAVKTILDAMSDALATGQRIEIRGFGSFALNSRPPRIGRNPKSGDKVM
IHFB_AGRRK      MIKSELVQIVARNPHLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKNRPSRSGRNPRTGDTVF
IHFA_NEIMF      LTKAELADILVKVSNVTKNDAKEIVELFFEEIRSTLASGEEIKISGFGNFQLRDKPQRPGRNPKTGEEVP
IHFA_NEIMB      LTKAELADILVKVSNVTKNDAKEIVELFFEEIRSTLASGEEIKISGFGNFQLRDKPQRPGRNPKTGEEVP
IHFA_NEIMA      LTKAELADILVKVSNVTKNDAKEIVELFFEEIRSTLASGEEIKISGFGNFQLRDKPQRPGRNPKTGEEVP
IHFA_NEIM0      LTKAELADILVKVSNVTKNDAKEIVELFFEEIRSTLASGEEIKISGFGNFQLRDKPQRPGRNPKTGEEVP
IHFA_NEIGO      LTKAELADILVKVSNVTKNSAKEIVELFFEEIRSTLASGEEIKISGFGNFQLRDKPQRPGRNPKTGEEVP
IHFA_ANASK      MTKADIIESVYEKVGFSKKEAAEIVEMVFDTIKETLERGEKIKISGFGNFIVRDKKSRVGRNPQTGEEIE
IHFA_ANADE      MTKADIIESVYEKVGFSKKEAAEIVEMVFDTIKETLERGEKIKISGFGNFIVRDKKSRVGRNPQTGEEIE
IHFA_ANAD2      MTKADIIESVYEKVGFSKKEAAEIVEMVFDTIKETLERGEKIKISGFGNFIVRDKKSRVGRNPQTGEEIE
IHFB_SHELP      MTKSELIEKLARQSQLSAKEVESAIKEMLEQMATTLEGGDRIEIRGFGSFSLHYRAPRTGRNPKTGTSVE
IHFB_SHEDO      MTKSELIEKLARQSQLSAKEVESAIKEMLEQMATTLEGGDRIEIRGFGSFSLHYRAPRTGRNPKTGTSVE
IHFB_RHILO      MIKSELVQIIARNPHLFLRDVENIVGAIFDEITDALAEGNRVELRGFGAFSVKNRPARTGRNPRTGESVE
IHFB_COLP3      MTKSELIEKLAKLSHLSAKEVEKSIKEILELMAQSLSKGERIEIRGFGSFSLHYRAPRVGRNPKTGESVE
IHFB_AGRT5      MIKSELVQIVARNPHLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKNRPSRSGRNPRTGESVF
IHFA_XYLFT      LTKAEMVERLFDEVGLNKREAKEFVDAFFDLLRDALEQGKEIKLSGFGNFELRCKNQRPGRNPKTGEEIP
IHFA_XYLFM      LTKAEMVERLFDEVGLNKREAKEFVDAFFDLLRDALEQGKEIKLSGFGNFELRCKNQRPGRNPKTGEEIP
IHFA_XYLF2      LTKAEMVERLFDEVGLNKREAKEFVDAFFDLLRDALEQGKEIKLSGFGNFELRCKNQRPGRNPKTGEEIP
IHFA_STRMK      LTKAEMAEKLFDEVGLNKREAKEFVDAFFDVLREALEQGRQVKLSGFGNFDLRRKNQRPGRNPKTGEEIP
IHFA_STRM5      LTKAEMAEKLFDEVGLNKREAKEFVDAFFDVLREALEQGRQVKLSGFGNFDLRRKNQRPGRNPKTGEEIP
IHFA_SHISS      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SHIFL      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SHIF8      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SHIDS      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SHIBS      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SHIB3      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SHESW      LTKAEMAEHLFETLGMNKRVAKEMVESFFEEIRGALESGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SHEPC      LTKAEMAEHLFETLGMNKRVAKEMVESFFEEIRGALESGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SHEB9      LTKAEMAEHLFETLGMNKRVAKEMVESFFEEIRGALESGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SHEB8      LTKAEMAEHLFETLGMNKRVAKEMVESFFEEIRGALESGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SHEB5      LTKAEMAEHLFETLGMNKRVAKEMVESFFEEIRGALESGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SHEB2      LTKAEMAEHLFETLGMNKRVAKEMVESFFEEIRGALESGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SALTY      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SALTI      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SALSV      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SALPK      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SALPC      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SALPB      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SALPA      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SALNS      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SALHS      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SALG2      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SALEP      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SALDC      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SALCH      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SALAR      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_SALA4      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_PARDP      LTRMDLAEAVFREVGLSRHESAQLVESVLGHISDALVRGEQVKISSFGTFSVRDKNERIGRNPKTGEEVP
IHFA_NEIG2      LTKAELADILVKVSNVTKNDAKEIVELFFEEIRSTLASGEEIKISGFGNFQLRDKPQRPGRNPKTGEEVP
IHFA_NEIG1      LTKAELADILVKVSNVTKNDAKEIVELFFEEIRSTLASGEEIKISGFGNFQLRDKPQRPGRNPKTGEEVP
IHFA_MESSB      VTRADLAEAVYRKVGLSRTESAQIVEMVLQEVCDAIVRGETVKLSSFATFQVREKNERVGRNPKTGEEVP
IHFA_KLEP7      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_KLEP3      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_HAEPS      LTKIEIAENLVERCGLDKRIAKQFVEDFFEEIRRSLESGEEVKLSGFGNFTVRDKKARPGRNPKTGEDVA
IHFA_ESCF3      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ENTS8      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ENT38      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_EDWI9      LTKAEMSEHLFEKLGLSKRDAKDLVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ECOUT      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ECOSM      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ECOSE      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ECOLU      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ECOLI      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ECOLC      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ECOL6      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ECOL5      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ECOHS      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ECODH      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ECOBW      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ECO8A      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ECO81      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ECO7I      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ECO5E      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ECO57      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ECO55      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ECO45      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ECO27      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_ECO24      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_COLP3      LTKAEVAEHLFEKVGLSKRDAKDMVEIFFEEIRETLESGDQVKLSGFGNFDLRLKSERPGRNPKTGEDIP
IHFA_CITK8      LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
IHFA_BRUSI      VTRADLVEAVYRKVGLSRTESAALVEMILDEVCDAIVNGETVKLSSFATFQVRDKNERIGRNPKTGEEVP
IHFB_SHESH      MTKSELIEKLARQSQMSAKEVESAIKEMLEQMAQTLEGGDRIEIRGFGSFSLHFRAPRTGRNPKTGTSVD
IHFB_SHEB9      MTKSELIEKLARQSQLSAKEVEGAIKEMLEQMATTLESGDRIEIRGFGSFSLHYRAPRTGRNPKTGSSVD
IHFB_SHEB8      MTKSELIEKLARQSQLSAKEVEGAIKEMLEQMATTLESGDRIEIRGFGSFSLHYRAPRTGRNPKTGSSVD
IHFB_SHEB5      MTKSELIEKLARQSQLSAKEVEGAIKEMLEQMATTLESGDRIEIRGFGSFSLHYRAPRTGRNPKTGSSVD
IHFB_SHEB2      MTKSELIEKLARQSQLSAKEVEGAIKEMLEQMATTLESGDRIEIRGFGSFSLHYRAPRTGRNPKTGSSVD
IHFB_PARDP      MIRSELIQKISEEPHLFQRDVERIVNTVFEEIIDAMARGDRVELRGFGAFSVKKRDARQGRNPRTGETVS
IHFB_NITEU      MTKSELISKLAERPQLLAKDAELVVKIILDAMAKSLSRGERIEIRGFGSFDLNYRPSRVGRNPKSGEKVH
IHFB_ESCF3      MTKSELIERLAQQSHIPAKVVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_ERWT9      MTKSELIERLAQQSHIPAKVVEDAVKEMLEHMATTLSEGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_ALISL      MTKSELIEQLSKKPQLSAKQVEDTVKEVLEQMATTLEGGDRIEIRGFGSFSLHYREPRLGRNPKTGDKVE
IHFA_SINMW      VTRADLAESVFRKVGLSRTESAELVETVIDEICNAIVRGESVKLSSFATFQVRDKNERIGRNPKTGEEVP
IHFA_RHISN      VTRADLAESVFRKVGLSRTESAELVETVIDEICNAIVRGESVKLSSFATFQVRDKNERIGRNPKTGEEVP
IHFA_RHIME      VTRADLAESVFRKVGLSRTESAELVETVIDEICNAIVRGESVKLSSFATFQVRDKNERIGRNPKTGEEVP
IHFA_HALHL      LTKADMAERLFEEVGLNKREAKELVELFFEEIRTALENGEPVKLSSFGNFELRDKNERPGRNPKTGEEIP
IHFA_AERHH      LTKADIAEHLFTQLGMSKREAKDMVEAFFEEIRQALERGEQVKISGFGNFDLREKNQRPGRNPKTGEDIP
IHFB_VIBFM      MTKSELIEQLSKKPQLSAKQVEDTVKEILEQMATTLEGGDRIEIRGFGSFSLHYREPRLGRNPKTGDKVE
IHFB_VIBF1      MTKSELIEQLSKKPQLSAKQVEDTVKEILEQMATTLEGGDRIEIRGFGSFSLHYREPRLGRNPKTGDKVE
IHFB_SODGM      MTKSELIERLAQHAHIQAKVVEDAVKEMLEHMATTLASGERIEIRGFGSFSLHYRAPRIGRNPKTGDRVE
IHFB_SHEFN      MTKSELIEKLARQSQLSAKEVESAIKEMLEQMATTLETGDRIEIRGFGSFSLHYRAPRTGRNPKTGTSVD
IHFB_RHIRD      MIKSELVDFVAKNPYLHRRDAENAVDAVLDEITGALERGERVDIRSFGTFVVRHRPARSGRNPLNGNAVF
IHFB_NITEC      MTKSELISKLAERPQLLAKDAELVVKIILDAMAKSLARGERIEIRGFGSFDLNYRPSRVGRNPKSGEKVH
IHFB_IDILO      MTKSELIERLTLKHELPPKQVEASVKEILEQMVQSLSQGKRVEIRGFGSFSLHYRAPRVGRNPKTGDPVE
IHFB_GLUDA      MTKSELIAELAANPHLLSRDVELIVQTIFSEISAALARGDRVELRGFGAFTVKKRDARTGRNPRTGEMVA
IHFB_CHRSD      MTKSELIEQIARQPELSAKEVEAAVKIILEDITQSLSSGGRVEIRGFGSFSLHFREPRTGRNPKTGDPVD
IHFB_AGRT9      MIKSELVDFVAKNPYLHRRDAENAVDAVLDEITGALERGERVDIRSFGTFVVRHRPARSGRNPLNGNAVF
IHFB_ACTPJ      MTKSELINLVSLNPALQVKSVEDGVKEILEQIMLFLERGERVEVRGFGSFSLHYRQPRVGRNPKTGESVK
IHFB_ACTP7      MTKSELINLVSLNPALQVKSVEDGVKEILEQIMLFLERGERVEVRGFGSFSLHYRQPRVGRNPKTGESVK
IHFB_ACTP2      MTKSELINLVSLNPALQVKSVEDGVKEILEQIMLFLERGERVEVRGFGSFSLHYRQPRVGRNPKTGESVK
IHFA_XANOR      LTKAEMAERLFDEVGLNKREAKEFVDAFFDVLRDALEQGRQVKLSGFGNFDLRRKNQRPGRNPKTGEEIP
IHFA_XANOM      LTKAEMAERLFDEVGLNKREAKEFVDAFFDVLRDALEQGRQVKLSGFGNFDLRRKNQRPGRNPKTGEEIP
IHFA_XANCP      LTKAEMAERLFDEVGLNKREAKEFVDAFFDVLRDALEQGRQVKLSGFGNFDLRRKNQRPGRNPKTGEEIP
IHFA_XANCB      LTKAEMAERLFDEVGLNKREAKEFVDAFFDVLRDALEQGRQVKLSGFGNFDLRRKNQRPGRNPKTGEEIP
IHFA_XANC8      LTKAEMAERLFDEVGLNKREAKEFVDAFFDVLRDALEQGRQVKLSGFGNFDLRRKNQRPGRNPKTGEEIP
IHFA_XANC5      LTKAEMAERLFDEVGLNKREAKEFVDAFFDVLRDALEQGRQVKLSGFGNFDLRRKNQRPGRNPKTGEEIP
IHFA_XANAC      LTKAEMAERLFDEVGLNKREAKEFVDAFFDVLRDALEQGRQVKLSGFGNFDLRRKNQRPGRNPKTGEEIP
IHFA_PSEHT      LTKADIAEHLFEKLGINKKDAKDLVEAFFEEIRSALEKGEQIKLSGFGNFDLRDKKERPGRNPKTGEDIP
IHFA1_DECAR     ITKADLAEHLSNEIGFNNREAKEVVEAFFKELSDCLERGEEIKLAGFGVFSMRNKPERPGRNPKTGEEIP
IHFB_YERPY      MTKSELIERLAQQSHVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGDKVE
IHFB_YERPS      MTKSELIERLAQQSHVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGDKVE
IHFB_YERPP      MTKSELIERLAQQSHVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGDKVE
IHFB_YERPN      MTKSELIERLAQQSHVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGDKVE
IHFB_YERPG      MTKSELIERLAQQSHVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGDKVE
IHFB_YERPE      MTKSELIERLAQQSHVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGDKVE
IHFB_YERPB      MTKSELIERLAQQSHVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGDKVE
IHFB_YERPA      MTKSELIERLAQQSHVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGDKVE
IHFB_YERP3      MTKSELIERLAQQSHVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGDKVE
IHFB_SINMW      MIKSELVQIVARNPHLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKNRPSRSGRNPRTGDSVF
IHFB_SHEPA      MTKSELIEKLARQSQLSAKEVEAAIKEMLEQMADTLETGDRIEIRGFGSFSLHYRAPRTGRNPKTGTSVE
IHFB_RHOCS      MTKSELILRLAEQRDVEKIVTT-----IFDEITDALARGDRVELRGFGAFSVKKRDARLGRNPRTGETVD
IHFB_RHIME      MIKSELVQIVARNPHLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKNRPSRSGRNPRTGDSVF
IHFB_BRAJA      MIKSELVQRIAEHPHLYQRDVENIVNAILEEIVAALARGDRVELRGFGAFSVKHRPARAGRNPRTGAHVP
IHFA_ALTMD      LTKAEMAEHLFEKLGINKRDAKDLVELFFEEIKGALESGEQVKLSGFGNFDLRDKNERPGRNPKTGEDIP
IHFA_ALHEH      LTKADMAERLFEEVGLNKREAKELVESFFEEIRQALEDGVPVKLSGFGNFDLRDKNERPGRNPKTGEEIP
DBH_DEIRA       --KTQLVEMVADQTGLTKKQSEEAISSMLECVVSALQSGKSVGLPGLGTLSVKETAARTGVRPGTSEKIQ
IHFB_SHEAM      MTKSELIEKLARQSQLSAKEVESAVKEMLEQMATTLESGERIEIRGFGSFSLHYRAPRTGRNPKTGTSVE
IHFB_RHOPS      MIKSELVQRIAEHPHLYQRDVENIVNAILDEIVDALARGDRVELRGFGAFSVKHRPARAGRNPRTGAHVP
IHFB_RHOPB      MIKSELVQRIAEHPHLYQRDVENIVNAILDEIVAALARGDRVELRGFGAFSVKHRPARAGRNPRTGAHVP
IHFB_RHOP2      MIKSELVQRIAEHPHLYQRDVENIVNAILDEIVDALARGDRVELRGFGAFSVKHRPARAGRNPRTGAHVP
IHFB_CAUSK      MIKSELIARLANEPHLTQKDVERVVGVILERMIGALEDGGRVELRGFGALSVRSRPARAGRNPRTGETVD
IHFB_BRASO      MIKSELVQRIAEHPHLYQRDVENIVNAILDEIVAALARGDRVELRGFGAFSVKHRPARAGRNPRTGAHVP
IHFB_BRASB      MIKSELVQRIAEHPHLYQRDVENIVNAILDEIVAALARGDRVELRGFGAFSVKHRPARAGRNPRTGAHVP
IHFB_BEII9      MIKSELVQRIARNPHLYLRDVEKIVNAILDEITRALSRGDRVELRGFGAFSVKRRDARLGRNPRTGAHVP
IHFA_RHOCA      LTRMDLSEAVFREVGLSRNESAQLVETVLQHMSDALVRGETVKISSFGTFSVRDKTSRMGRNPKTGEEVP
IHFA_PHEZH      VTRADLCEAVHEQVGLTRQDCAELVERVLELMCQALERGEQVKLSGFGVFQVRSKRARMGRNPKTGEPAA
IHFA_OCHA4      VTRADLAEAVYRKVGLSRTESAALVEMILDEVCDAIVNGETVKLSSFATFQVRDKNERIGRNPKTGEEVP
IHFA_BRUSU      VTRADLAEAVYRKVGLSRTESAALVEMILDEVCDAIVNGETVKLSSFATFQVRDKNERIGRNPKTGEEVP
IHFA_BRUME      VTRADLAEAVYRKVGLSRTESAALVEMILDEVCDAIVNGETVKLSSFATFQVRDKNERIGRNPKTGEEVP
IHFA_BRUMB      VTRADLAEAVYRKVGLSRTESAALVEMILDEVCDAIVNGETVKLSSFATFQVRDKNERIGRNPKTGEEVP
IHFA_BRUC2      VTRADLAEAVYRKVGLSRTESAALVEMILDEVCDAIVNGETVKLSSFATFQVRDKNERIGRNPKTGEEVP
IHFA_BRUAB      VTRADLAEAVYRKVGLSRTESAALVEMILDEVCDAIVNGETVKLSSFATFQVRDKNERIGRNPKTGEEVP
IHFA_BRUA2      VTRADLAEAVYRKVGLSRTESAALVEMILDEVCDAIVNGETVKLSSFATFQVRDKNERIGRNPKTGEEVP
IHFA_BRUA1      VTRADLAEAVYRKVGLSRTESAALVEMILDEVCDAIVNGETVKLSSFATFQVRDKNERIGRNPKTGEEVP
IHFB_VIBPA      MTKSELIERLAEQTHLSAKEVEDAVKDILEHMASTLESGDRIEIRGFGSFSLHYREPRVGRNPKTGDKVE
IHFB_VIBHB      MTKSELIERLAEQTHLSAKEVEDAVKDILEHMASTLESGDRIEIRGFGSFSLHYREPRVGRNPKTGDKVE
IHFB_SHISS      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_SHIFL      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_SHIF8      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_SHIDS      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_SHIBS      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_SHIB3      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_SHEHH      MTKSELIEKLARQSQLSAKEVEAAIKEMLEQMADTLEAGDRIEIRGFGSFSLHYRAPRTGRNPKTGTSVE
IHFB_SERP5      MTKSELIERLAQQSHVPAKAVEDAVKEMLEHMAATLADGERIEIRGFGSFSLHYRAPRVGRNPKTGDKVE
IHFB_SALTY      MTKSELIERLAQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_SALTI      MTKSELIERLAQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_SALSV      MTKSELIERLAQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_SALPK      MTKSELIERLAQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_SALPC      MTKSELIERLAQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_SALPB      MTKSELIERLAQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_SALPA      MTKSELIERLAQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_SALNS      MTKSELIERLAQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_SALHS      MTKSELIERLAQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_SALG2      MTKSELIERLAQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_SALEP      MTKSELIERLAQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_SALDC      MTKSELIERLAQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_SALCH      MTKSELIERLAQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_SALAR      MTKSELIERLAQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_SALA4      MTKSELIERLAQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_RHOPT      MIKSELVQRIAEHPHLYQRDVENIVNAILDEIVDALARGDRVELRGFGAFSVKHRPARAGRNPRTGAHVP
IHFB_RHOPA      MIKSELVQRIAEHPHLYQRDVENIVNAILDEIVDALARGDRVELRGFGAFSVKHRPARAGRNPRTGAHVP
IHFB_PSYIN      MTKSDLIERLSKHFQLSVKEVEDSVKETLTLMANSLAQGERIEVRGFGSFSLHYRAPRVGRNPKTGDRVE
IHFB_PHOLL      MTKSELIERLAQQSHISAKTVEDAVKEILDHMAITLADGERIEVRGFGSFSLHYRAPRVGRNPKTGDKVE
IHFB_KLEP7      MTKSELIERLAQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_KLEP3      MTKSELIERLAQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_JANSC      MIRSELIQKLSDEPHLYQRDVERIVNSIFEEVIDALAAGDRVELRGFGAFSVKKRDARIGRNPRTGESVS
IHFB_ECOUT      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_ECOSM      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_ECOSE      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_ECOLU      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_ECOLI      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_ECOLC      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_ECOL6      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_ECOL5      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_ECOHS      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_ECODH      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_ECOBW      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_ECO8A      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_ECO81      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_ECO7I      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_ECO5E      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_ECO57      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_ECO55      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_ECO45      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_ECO24      MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_CITK8      MTKSELIERLAQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_BURXL      MTKSELVAQLATRPQLVLKDADFAVKTMLDAMSEALANGHRIEIRGFGSFGLNRRPSRVGRNPKSGEKVL
IHFB_BURPP      MTKSELVAQLAARPQLVLKDADFAVKTMLDAMSEALANGHRIEIRGFGSFGLNRRPSRVGRNPKSGEKVL
IHFA_XYLFA      LTKAEMVERLFDEVGLNKREAKEFVDTFFDLLRDALEQGRQIKLSGFGNFELRCKNQRPGRNPKTGEEIP
IHFA_RHILW      VTRADLAESVFRKVGLSRTESAELVETVIDEVCNAIVRGETVKLSSFATFQVRDKNERIGRNPKTGEEVP
IHFA_PASMU      LTKVELADNLIEKLHLNKRDAKELVENFFEEIRVALETGEDVKLSGFGNFELRDKSSRPGRNPKTGESVP
IHFA_NITOC      LTKADMTETLYQELGLNKREAKEIVEMFFEDIRCALEQGEAVKLSGFGNFELRDKGERPGRNPKTGEEIP
DBH_MYCTU       MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVFEQXXXXXXXXXNPRTGETVK
DBH_MYCLE       MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVFEQXXXXXXXXXNPRTGETVK
DBH_MYCBO       MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVFEQXXXXXXXXXNPRTGETVK
DBH1_BIFLO      -NKSDLVSKIAQKSNLTKAQAEAAVNAFQDVFVEAMKSGEGLKLTGLFSAERVKRAARTGRNPRTGEQID
IHFB_YERE8      MTKSELIERLAQQSHVPTKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGAKVE
IHFB_VIBVY      MTKSELIERLAEQTHLSAKEIEDAVKDILEHMASTLESGDRIEIRGFGSFSLHYREPRVGRNPKTGDKVE
IHFB_VIBVU      MTKSELIERLAEQTHLSAKEIEDAVKDILEHMASTLESGDRIEIRGFGSFSLHYREPRVGRNPKTGDKVE
IHFB_VIBSL      MTKSELIERLAEQTHLSAKEIEDAVKDILEHMASTLESGDRIEIRGFGSFSLHYREPRVGRNPKTGDKVE
IHFB_RHOCA      MIRSELIAKIAEERDVEKIV--NTI---FEEIIEAMARGDRVELRGFGAFSVKKRDARTGRNPRTGTSVA
IHFB_PSEU5      MTKSELIERIVTQQGLLSELAIKTM---LEQMAQALATGERIEIRGFGSFSLHYRAPRVGRNPKTGQSVS
IHFB_PSEPW      MTKSELIERIVTHQGLLSELAIKTM---LEQMSQCLATGDRIEIRGFGSFSLHYRAPRVGRNPKTGQSVE
IHFB_PSEE4      MTKSELIDRIVTHQGLLSELAIKTM---LEQMSQCLATGDRIEIRGFGSFSLHYRAPRVGRNPKTGQSVS
IHFB_PHOPR      MTKSELIERLSQQTHLSAKQVEDAIKEILEHMAGTLAEGDRIEIRGFGSFSLHYRAPRVGRNPKTGDKVE
IHFB_METSB      MIKSELVQRIARNPHLYLRDVEKIVNAILDEITNALSRGDRVELRGFGAFSVKHRDARVGRNPRTGAHVS
IHFB_ECO27      MTKSELIERLAQQSHIPAKTVEDAVKDMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_BURP8      MTKSELVAQLATRPQLVLKDADFAVKTMLDAMSDALANGHRIEIRGFGSFGLNRRPSRVGRNPKSGEKVL
IHFA_SILST      ITRMDLSEAVFREVGLSRNESAQLVESMLQHMSDALVRGEQVKISSFGTFSVRDKSARVGRNPKTGEEVP
IHFA_RHIL3      VTRADLAESVFRKVGLSRTESAELVETVIDEICNAIVRGETVKLSSFATFQVRDKNERIGRNPKTGEEVP
IHFA_RHIEC      VTRADLAESVFRKVGLSRTESAELVETVIDEICNAIVRGETVKLSSFATFQVRDKNERIGRNPKTGEEVP
IHFA_RHIE6      VTRADLAESVFRKVGLSRTESAELVETVIDEICNAIVRGETVKLSSFATFQVRDKNERIGRNPKTGEEVP
IHFA_IDILO      LTKAELAEVLFDKYGVSKQDAKVLVEDFFEEIRVALERGEQVKLSGFGNFELRTKNQRPGRNPKTGEEIP
IHFA_HAHCH      LTKADMAERLYQEVGLNKREAKEMVEAFFDEVRDALSHNEQVKLSGFGNFDLRDKKQRPGRNPKTGEEIP
IHFA_DINSH      LTRMDLSDAVFREVGLSRNESAQLVESILTHMSDALVRGESVKISSFGTFSVRDKSARIGRNPKTGEEVP
IHFA_BDEBA      MTKADIVENVYQKIGFSKKEASELVELVFDTLKTVLQDGEKVKISGFGNFVVRGKNERIGRNPQTGEQIK
IHFA_AGRT5      VTRADLAESVFRKVGLSRTESAELVETIIDEICNAITRGEVVKLSSFATFQIREKNERIGRNPKTGEEVP
IHFA_AGRRK      VTRADLAESVFRKVGLSRTESAELVETVIDEICNAIVRGETVKLSSFATFQVRDKNERIGRNPKTGEEVP
DBH_MYCS2       MNKAELIDVLTTKMGTDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVFEQXXXXXXXXXNPRTGETVK
DBH_HELPJ       MNKAEFIDLVKKAGKYSKREAEEAINAFTLAVETALSKGESVELVGFGKFETAEQKGKEGKVPGSDKTYK
IHFB_SERMA      MTKSELIERLAQQSHIPAKAVEDAVKEMLEHMAATLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGDKVE
IHFB_PSEU2      MTKSELIERIVTHQGLLSELAIKTM---LEQMSQCLATGDRIEIRGFGSFSLHYRAPRVGRNPKTGQSVS
IHFB_PSESM      MTKSELIERIVTHQGLLSELAIKTM---LEQMSQCLATGDRIEIRGFGSFSLHYRAPRVGRNPKTGQSVS
IHFB_PSEPU      MTKSELIERIVTHQGLLSELAIKTM---LEQMSQCLATGDRIEIRGFGSFSLHYRAPRVGRNPKTGQSVS
IHFB_PSEPK      MTKSELIERIVTHQGLLSELAIKTM---LEQMSQCLATGDRIEIRGFGSFSLHYRAPRVGRNPKTGQSVS
IHFB_PSEPG      MTKSELIERIVTHQGLLSELAIKTM---LEQMSQCLATGDRIEIRGFGSFSLHYRAPRVGRNPKTGQSVS
IHFB_PSEPF      MTKSELIERIVTHQGLLSELAIKTM---LEQMSQCLATGDRIEIRGFGSFSLHYRAPRVGRNPKTGQSVS
IHFB_PSEP1      MTKSELIERIVTHQGLLSELAIKTM---LEQMSQCLATGDRIEIRGFGSFSLHYRAPRVGRNPKTGQSVS
IHFB_PSEFS      MTKSELIERIVTHQGLLSELAIKTM---LEQMSQCLATGDRIEIRGFGSFSLHYRAPRVGRNPKTGQSVS
IHFB_MARMM      MIKSELIDQLAENPHLYHRDVERVVNTILDGITDALARGERVELRGFGAFSVRHRPARVGRNPRTGESVA
IHFB_LARHH      MTKSELIARLAERYPVAKELAVKTI---LDAMAVSLASGQRIEIRGFGSFDLNYRPPRTGRNPKSGSSVH
IHFB_HAEDU      MTKSELIEKIALNPSLPEKAVEDGVKDILENIMLTLEQAKRVEIRGFGSFSLHYRQPRIGRNPKTGASVK
IHFB_ENT38      MTKSELIERLAQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVD
IHFB_BURTA      MTKSELVAQLASRPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQ
IHFB_BURPS      MTKSELVAQLASRPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQ
IHFB_BURP6      MTKSELVAQLASRPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQ
IHFB_BURP1      MTKSELVAQLASRPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQ
IHFB_BURP0      MTKSELVAQLASRPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQ
IHFB_BURMS      MTKSELVAQLASRPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQ
IHFB_BURMA      MTKSELVAQLASRPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQ
IHFB_BURM9      MTKSELVAQLASRPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQ
IHFB_BURM7      MTKSELVAQLASRPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQ
IHFA_TOLAT      LTKADIAEHLFTELGISKRDAKELVETFFEDIRLALESGEQVKISGFGNFELRTKNERPGRNPKTGEDIP
IHFA_THISH      LTKADMSERLFEELGLNKREAKELVEMFFEEVRMALERGEQVKLSGFGNFTLRDKNQRPGRNPKTGEEIP
IHFA_RHOS5      LTRMDLSEAVFREVGLSRNESAQLVESVLQHVSDALASGETVKISSFGTFTVRDKSARIGRNPKTGDEVP
IHFA_RHOS4      LTRMDLSEAVFREVGLSRNESAQLVESVLQHVSDALASGETVKISSFGTFTVRDKSARIGRNPKTGDEVP
IHFA_RHOS1      LTRMDLSEAVFREVGLSRNESAQLVESVLQHVSDALASGETVKISSFGTFTVRDKSARIGRNPKTGDEVP
IHFA_PSEU5      LTKAEMAERLYEELGLNKREAKELVELFFEEIRQALEHNEQVKLSGFGNFDLRDKRQRPGRNPKTGEEIP
IHFA_PSEAE      LTKAEIAERLYEELGLNKREAKELVELFFEEIRQALEHNEQVKLSGFGNFDLRDKRQRPGRNPKTGEEIP
IHFA_PSEAB      LTKAEIAERLYEELGLNKREAKELVELFFEEIRQALEHNEQVKLSGFGNFDLRDKRQRPGRNPKTGEEIP
IHFA_PSEA7      LTKAEIAERLYEELGLNKREAKELVELFFEEIRQALEHNEQVKLSGFGNFDLRDKRQRPGRNPKTGEEIP
IHFA_MARAV      LTKADMAERLYEELGLNKREAKEMVEAFFDEIRGALSHNEQVKLSGFGNFDLRDKKQRPGRNPKTGEEIP
IHFA_LEGPL      LSKAIMAETLCDELKLNKPVAKEMVENFFEELRHALENGQHVKLSGFGNFTLRDKPQRPGRNPKTGEEIP
IHFA_LEGPH      LSKAIMAETLCDELKLNKPVAKEMVENFFEELRHALENGQHVKLSGFGNFTLRDKPQRPGRNPKTGEEIP
IHFA_LEGPC      LSKAIMAETLCDELKLNKPVAKEMVENFFEELRHALENGQHVKLSGFGNFTLRDKPQRPGRNPKTGEEIP
IHFA_LEGPA      LSKAIMAETLCDELKLNKPVAKEMVENFFEELRHALENGQHVKLSGFGNFTLRDKPQRPGRNPKTGEEIP
IHFA_JANSC      LTRMDLSEAVFREVGLSRNESSELVERVLQLMSDALVDGEQVKVSSFGTFSVRSKTARVGRNPKTGEEVP
IHFA_AGRVS      VTRADLAESVFRKVGLSRTESAELVETVIDEICNAIVRGEMVKLSSFATFQVRAKNERIGRNPKTGEEVP
IHFB_PROMH      MTKSELIERLAGQSHLSAKTVEEAVKEMLDHMADTLADGERIEVRGFGSFSLHYRAPRTGRNPKTGDKVE
IHFB_PARL1      MIKSELVARLAQQRDVER-IVSTIFDE----ISAALARGDRVELRGFGAFSVKSRPARTGRNPRTGEPVH
IHFB_EDWI9      MTKSELIERLAQQPHLPAKAVEDAVKEMLEHMAATLADGERIEIRGFGSFSLHYRAPRIGRNPKTGEKVE
IHFB_BUCAP      MTKSELFERIARKAHISNKIIECAVKEMLEYISISLSKGKRIEIRGFGTFSLHYRSSRIGRNPKTGKKIK
IHFA_PSEA8      LTKAEIAERLYEELGLNKREAKELVELFFEEIRQALEQNEQVKLSGFGNFDLRDKRQRPGRNPKTGEEIP
IHFA_MAGSA      ITRAQLSEAVYQEVGLSRNESADLLEAVLDEISGALAKGDAVKISSFGSFSVRSKGQRIGRNPKTGEEVP
IHFB_TOLAT      MTKSDLIERLSSSQ---QHLAAKDVEAAVREILECLESGNRIEIRGFGSFSLHYRAPRVGRNPKTGEKVE
IHFB_PSE14      MTKSELIERIVTHQGLLSELAIKTM---LEQMSQCLATGDRIEIRGFGSFSLHYRAPRVGRNPKTGRSVS
IHFB_CHRVO      MTKSELIARLSERAERNSQLVYKDAELAVKTILDAMANGSRIEIRGFGSFDLNYRPPRVGRNPKSGASVS
IHFB_CAUCR      MIKSELIARLANEPHLTQKDVERVVGVILERMIGALEDGGRVELRGFGALSVRSRPARTGRNPRTGEAVD
IHFB_CAUCN      MIKSELIARLANEPHLTQKDVERVVGVILERMIGALEDGGRVELRGFGALSVRSRPARTGRNPRTGEAVD
IHFB_BURM1      MTKSELVAQLASRPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQ
IHFB_AERS4      MTKSDLIEQLASRMHMPAKDVEAAIKEILEQMASTLQNGDRIEIRGFGSFSLHYRAPRVGRNPKTGDKVE
IHFB_AERHH      MTKSDLIEQLASRMHMPAKDVEAAIKEILEQMASTLQNGDRIEIRGFGSFSLHYRAPRVGRNPKTGDKVE
IHFA_RHILO      LTRADLAEAVYRKVGLSRTESAELVEAVLDEICEAIVRGETVKLSSFATFHVRSKNERIGRNPKTGEEVP
IHFA_PSEU2      LTKAEMAERLYEELGLNKREAKELVELFFEEIRHALEDNEQVKLSGFGNFDLRDKRQRPGRNPKTGEEIP
IHFA_PSESM      LTKAEMAERLYEELGLNKREAKELVELFFEEIRHALEDNEQVKLSGFGNFDLRDKRQRPGRNPKTGEEIP
IHFA_PSEPF      LTKAEMAERLYEELGLNKREAKELVELFFEEIRHALEDNEQVKLSGFGNFDLRDKRQRPGRNPKTGEEIP
IHFA_PSEFS      LTKAEMAERLYEELGLNKREAKELVELFFEEIRHALEDNEQVKLSGFGNFDLRDKRQRPGRNPKTGEEIP
IHFA_PSEF5      LTKAEMAERLYEELGLNKREAKELVELFFEEIRHALEDNEQVKLSGFGNFDLRDKRQRPGRNPKTGEEIP
IHFA_PSEE4      LTKAEMAERLYEELGLNKREAKELVELFFEEIRHALEDNEQVKLSGFGNFDLRDKRQRPGRNPKTGEEIP
IHFA_PSE14      LTKAEMAERLYEELGLNKREAKELVELFFEEIRHALEDNEQVKLSGFGNFDLRDKRQRPGRNPKTGEEIP
IHFA_HAEIN      ITKLDIIEYLSDKYHLSKQDTKNVVENFLEEIRLSLESGQDVKLSGFGNFELRDKSSRPGRNPKTGDVVP
IHFA_HAEIE      ITKLDIIEYLSDKYHLSKQDTKNVVENFLEEIRLSLESGQDVKLSGFGNFELRDKSSRPGRNPKTGDVVA
IHFA_HAEI8      ITKLDIIEYLSDKYHLSKQDTKNVVENFLEEIRLSLESGQDVKLSGFGNFELRDKSSRPGRNPKTGDVVP
IHFA_BUCCC      LTKAEISDYLFHKLELSKQNIKDLVEIFFEEVRKSLELGESVKLSGFGNFYLRDKKQRPGRNPKTGEYIP
DBH_THEAC       ---SELSKEVAKKANTTQKVARTVIKSFLDEIVSQANGGQKINLAGFGIFERRTQGPRKARNPQTKKVIE
DBH_HELPY       MNKAEFIDLV-KEAGKSKREAEEAISAFTLAVETALSKGESVELIGFGKFETAEQKGKEGKVPGSDKTYK
IHFB_BURVG      MTKSELVAQLARFPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQ
IHFB_BURS3      MTKSELVAQLASRPQLVLKDADFAVKTMLDAMSDALAKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQ
IHFB_BURCM      MTKSELVAQLARFPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQ
IHFB_BURCJ      MTKSELVAQLASRPQLVLKDADFAVKTMLDAMSDALAKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQ
IHFB_BURCH      MTKSELVAQLASRPQLVLKDADFAVKTMLDAMSDALAKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQ
IHFB_BURCC      MTKSELVAQLASRPQLVLKDADFAVKTMLDAMSDALAKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQ
IHFB_BURCA      MTKSELVAQLASRPQLVLKDADFAVKTMLDAMSDALAKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQ
IHFB_BURA4      MTKSELVAQLARFPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARVGRNPKSGEKVQ
IHFA_SILPO      LTRMDLSEAVFREVGLSRNESAQLVESMLNHMSDALVRGEQVKISSFGTFSVRDKSARVGRNPKTGEEVP
IHFA_RHORT      ITRAQLSEAVYQEVGLSRNESADLLEMVLNEMSEALVEGDTVKISSFGSFSVREKGERVGRNPKTGEEVP
IHFA_PSEPW      LTKAEMAERLYEELGLNKREAKELVELFFEEIRHALEENEQVKLSGFGNFDLRDKRQRPGRNPKTGEEIP
IHFA_PSEPU      LTKAEMAERLYEELGLNKREAKELVELFFEEIRHALEENEQVKLSGFGNFDLRDKRQRPGRNPKTGEEIP
IHFA_PSEPK      LTKAEMAERLYEELGLNKREAKELVELFFEEIRHALEENEQVKLSGFGNFDLRDKRQRPGRNPKTGEEIP
IHFA_PSEPG      LTKAEMAERLYEELGLNKREAKELVELFFEEIRHALEENEQVKLSGFGNFDLRDKRQRPGRNPKTGEEIP
IHFA_PSEP1      LTKAEMAERLYEELGLNKREAKELVELFFEEIRHALEENEQVKLSGFGNFDLRDKRQRPGRNPKTGEEIP
IHFA_PSEMY      LTKAEMAERLYEELGLNKREAKELVELFFEEIRQALELNEQVKLSGFGNFDLRDKRQRPGRNPKTGEEIP
IHFA_MARMS      LTKADLAENLVDSIGLSKKDAKDLVEGFFDVVRSSLIERQQVKLSGFGNFEVREKSQRPGRNPKTGEEIP
IHFA_MANSM      LTKVELADNLIEKHGLNKSEAKALVEDFFEEIRVALEKGNDVKLSGFGNFELREKASRPGRNPKTGESVP
IHFA_COXBU      LTKADLSEHLFNVVGLNKREAKDLVELFFKEISLSLERGEPVKLSGFGNFNLRDKGERPGRNPKTGEEIP
IHFA_COXBR      LTKADLSEHLFNVVGLNKREAKDLVELFFKEISLSLERGEPVKLSGFGNFNLRDKGERPGRNPKTGEEIP
IHFA_COXBN      LTKADLSEHLFNVVGLNKREAKDLVELFFKEISLSLERGEPVKLSGFGNFNLRDKGERPGRNPKTGEEIP
IHFA_COXB2      LTKADLSEHLFNVVGLNKREAKDLVELFFKEISLSLERGEPVKLSGFGNFNLRDKGERPGRNPKTGEEIP
IHFA_COXB1      LTKADLSEHLFNVVGLNKREAKDLVELFFKEISLSLERGEPVKLSGFGNFNLRDKGERPGRNPKTGEEIP
IHFA_CHRSD      LTKADLAEHLHAELGFSKREAKSMVEAFFEEIRSCLRENEQVKLSGFGNFDLRDKRERPGRNPKTGEEIP
IHFA_MARMM      LTRADLAESVYREVGLSRQESADLVQSVLAMVSDNLAAGQSVKLSSFGSFLLRDKRGRVGRNPKTGVEVP
IHFA_HAES2      LTKIELKNSLIEQG-LNKLEAKKVVEGFFEQIRVSLENGEDVKLSGFGNFELRDKSSRPGRNPKTGEAIP
IHFA_HAES1      LTKIELKNSLIEQG-LNKLEAKKVVEGFFEQIRVSLENGEDVKLSGFGNFELRDKSSRPGRNPKTGEAIP
IHFB_VIBCM      MTKSELIERLAEQTHLSAKEIEDAVKNILEHMASTLEAGERIEIRGFGSFSLHYREPRVGRNPKTGDKVE
IHFB_VIBCH      MTKSELIERLAEQTHLSAKEIEDAVKNILEHMASTLEAGERIEIRGFGSFSLHYREPRVGRNPKTGDKVE
IHFB_VIBC3      MTKSELIERLAEQTHLSAKEIEDAVKNILEHMASTLEAGERIEIRGFGSFSLHYREPRVGRNPKTGDKVE
IHFA_HAEIG      ITKLDIIEYLSDKYHLSKQDTKNVVENFLEEIRLSLEFGQDVKLSGFGNFELRDKSSRPGRNPKTGDVVP
IHFA_SACD2      LTKADLAEKLYEELGFNKREAKELVEHFFEEIRNSLEDNEQVKLSGFGNFDLRDKKQRPGRNPKTGEEIP
IHFA_ALCBS      LTKADMAERLFEELGLNKREAKEMVEMFFEEIRHSLEDNIPVKLSGFGNFDLRDKSERPGRNPKTGEEIP
IHFB_NEIMF      ---------LAKDVEYSVKVLVDTM-------TRSLARGQRIEIRGFGSFDLNHRPARIGRNPKTGERVE
IHFB_NEIMB      ---------LAKDVEYSVKVLVDTM-------TRSLARGQRIEIRGFGSFDLNHRPARIGRNPKTGERVE
IHFB_NEIMA      ---------LAKDVEYSVKVLVDTM-------TRSLARGQRIEIRGFGSFDLNHRPARIGRNPKTGERVE
IHFB_NEIGO      ---------LAKDVEYSVKVLVDTM-------TRSLARGQRIEIRGFGSFDLNHRPARIGRNPKTGERVE
IHFB_BUCAT      MIKSELFERIAEQKNISNKMIERAAKEMLEHMIISLANGKRIEIRGFGSFSLHYRSSRIGRNPKTGKSVK
IHFB_BUCAI      MIKSELFERIAEQKNISNKMIERAAKEMLEHMIISLANGKRIEIRGFGSFSLHYRSSRIGRNPKTGKSVK
IHFB_BUCA5      MIKSELFERIAEQKNISNKMIERAAKEMLEHMIISLANGKRIEIRGFGSFSLHYRSSRIGRNPKTGKSVK
IHFA_PSYCK      LTKSDMIEHLMNHLNLTRQEGRCLVENFFDELSESLIDGKEVKLSGFGNFELKDKNSRPGRNPKTGEPVA
IHFA_PSYA2      LTKSDMIEHLMSHLNLTRQEGRCLVENFFDELSESLIDGKEVKLSGFGNFELKDKNSRPGRNPKTGEPVA
IHFA_BART1      VTRADLASVVCKKVGLSHTESAALVELVLDEICNSLVRGEAVKLSSFATFQVRSKNERIGRNPKTGVEAP
IHFA_BARBK      VTRADLASAVCRKVGLSYTESAALVELILSEISDSLVKGEMVKLSCFATFQVRSKSRRIGRNPKTGIEAP
IHFA_ACTSZ      LTKVEIAENLTRKLELNKTEAKAMVESFFEEIRATLADGHNVKLSGFGNFELRDKASRPGRNPKTGENIP
IHFA_ACIBY      LTKADMADHLSELTSLNRREAKQMVELFFDEISQALIAGEQVKLSGFGNFELRDKRERPGRNPKTGEEIP
IHFA_ACIBT      LTKADMADHLSELTSLNRREAKQMVELFFDEISQALIAGEQVKLSGFGNFELRDKRERPGRNPKTGEEIP
IHFA_ACIBS      LTKADMADHLSELTSLNRREAKQMVELFFDEISQALIAGEQVKLSGFGNFELRDKRERPGRNPKTGEEIP
IHFA_ACIBC      LTKADMADHLSELTSLNRREAKQMVELFFDEISQALIAGEQVKLSGFGNFELRDKRERPGRNPKTGEEIP
IHFA_ACIB5      LTKADMADHLSELTSLNRREAKQMVELFFDEISQALIAGEQVKLSGFGNFELRDKRERPGRNPKTGEEIP
IHFA_ACIB3      LTKADMADHLSELTSLNRREAKQMVELFFDEISQALIAGEQVKLSGFGNFELRDKRERPGRNPKTGEEIP
IHFA_BUCAP      VTKAAISENLFEKLKLTKRDSKXXXXXXXXXXRKSLEKGEDVKLSGFGNFQLKNKKERPGRNPRTGENIL
IHFA_ACIAD      LTKADMADHLSELTSLNRREAKQMVELFFDEISQALIAGEHVKLSGFGNFELRDKRERPGRNPKTGEEIP
DBH_UREPA       --RSQMIDELSKMLNIEKKQTKAFMDTYEAFLILELSRAKEVRLGNIGKFKVSVRAERKGINPKTGETVI
IHFA_ZYMMO      LTRADITDMLYHEVGLSRADSAKMIEQMLGHITDALKKGENVKISGFGSFILRDKNERVGRNPKTGIEVP
IHFA_XANP2      VTRADLCEAVYQQVGLSRTESAQLVEMVLKEIADCLARGETVKLSSFGSFVVREKGERVGRNPKTGEEVP
IHFA_ERYLH      LTRADLAEAINRKMGFSRAESLDMVEAILEHMCGALRKGENVKISGFGSFVLRDKKERIGRNPKTGVEVP
IHFA_THICR      LTKADIAETLSDKFGFNKRESKELVEQFYDEMSEVLVKGEQIKLSGFGNFELKDKSARPGRNPRTGEDVP
IHFA_ACTPJ      LTKIELAESLVEKCGFDKRIAKLFVEQFFEEIRSSLEKGEEVKLSGFGNFSLREKNARPGRNPKTGEXXX
IHFA_ACTP7      LTKIELAESLVEKCGFDKRIAKLFVEQFFEEIRSSLEKGEEVKLSGFGNFSLREKNARPGRNPKTGEXXX
IHFA_ACTP2      LTKIELAESLVEKCGFDKRIAKLFVEQFFEEIRSSLEKGEEVKLSGFGNFSLREKNARPGRNPKTGEXXX
IHFB_PASHA      MTKSELIESLAKNPSLPIKMVEHCVKXXXXXXXXXXXXXXRIEVRGFGSFSLHYRQPRLGRNPKTGESVL
IHFA_NITWN      VTRVDLCEAVYKKVGLSRTESSAFVELVLKEITDCLEKGETVKLSSFGSFMVRKKGQRIGRNPKTGTEVP
IHFA_NITHX      VTRVDLCEAVYKKVGLSRTESSAFVELVLKEITDCLEKGETVKLSSFGSFMVRKKGQRIGRNPKTGTEVP
IHFA_SPHWW      LTRADLSEEVHREIGLSRADSAAVVEQVLEHMCLALARGENVKISGFGSFILREKGQRIGRNPKTGVEVP
IHFA_AZOC5      ITRADLCEAVYQQVGLSRTESAALVEMVLREIADCLAKGETVKLSSFGSFVVRDKGQRVGRNPKTGEEVP
TF1_BPSP1       MNKTELIKAIAQDTELTQVSVSKMLASFEKITTETVAKGDKVQLTGFLNIKPVARQARKGFNPQTQEALE
IHFA_RHOP5      VTRVDLCEAVYQKVGLSRTESSAFVELVLKEITDCLEKGETVKLSSFGSFMVRQKGQRIGRNPKTGTEVP
IHFA_SPHAL      LTRADIASRINQQIGLSRNESAAIVESILDHMSDALAAGQNVKISGFGTFVLRDKAQRIGRNPKTGVEVP
IHFA_RHOPB      VTRVDLCEAVYQKVGLSRTESSAFVELVLKEITDCLEKGETVKLSSFGSFMVRKKGQRIGRNPKTGTEVP
IHFA_BRASO      VTRVDLCEAVYQKVGLSRTESSAFVELVLKEITDCLERGETVKLSSFGSFMVRKKGQRIGRNPKTGTEVP
IHFA_BRASB      VTRVDLCEAVYQKVGLSRTESSAFVELVLKEITDCLERGETVKLSSFGSFMVRKKGQRIGRNPKTGTEVP
IHFA_RHOPT      VTRVDLCEAVYQKVGLSRTESSAFVELVLKEITDCLERGETVKLSSFGSFLVRQKGQRIGRNPKTGTEVP
IHFA_RHOPS      VTRVDLCEAVYQKVGLSRTESSAFVELVLKEITDCLEKGETVKLSSFGSFLVRQKGQRIGRNPKTGTEVP
IHFA_RHOPA      VTRVDLCEAVYQKVGLSRTESSAFVELVLKEITDCLERGETVKLSSFGSFLVRQKGQRIGRNPKTGTEVP
IHFA_RHOP2      VTRVDLCEAVYQKVGLSRTESSAFVELVLKEITDCLEKGETVKLSSFGSFLVRQKGQRIGRNPKTGTEVP
IHFA_BARQU      VTRADLASVVCRKVGLSHTESAALVELVLNEICNSLVRGEAVKLSSFATFQVRNKNERIGRNPKTGVEAP
IHFA_BARHE      VTRADLASVVCRKVGLSHTESAALVELVLNEICNSLVRGEAVKLSSFATFQVRKKNERVGRNPKTGVEAP
IHFA_METEP      VTRADLSEAVYQQVGLSRAESAALVETVLAEICTCLSSGETVKLSSFGSFVVRSKGKRIGRNPKTGVEVE
IHFA_METC4      VTRADLSEAVYQQVGLSRAESAALVETVLAEICTCLSSGETVKLSSFGSFVVRSKGKRIGRNPKTGVEVE
IHFB_BUCCC      MIKSELFERITKKTYIPAKIIEYVVKNILEYMSLSLEKGNRIEIRGFGSFSLHYRFARIGRNPKTGEKVY
IHFA_OLICO      VTRVDLCEAVYQKVGLSRTESAAFVELVLKEITDCLEKGETVKLSSFGSFMVRKKGERIGRNPKTGTEVP
IHFA_METS4      VTRADLTEAVYQRVGLSRTESAALVETVLSEICTCLASGETVKLSSFGSFVVRDKGKRVGRNPKTGVEVA
IHFA_METPB      VTRADLSEAVYQQVGLSRAESAALVETVLGEICNCLSSGETVKLSSFGSFVVRSKGKRIGRNPKTGVEVE
IHFA_BUCAT      -----------------------------------LEKGEAVKLSGFGNFQIKKKKARPGRNPRTGEIFL
IHFA_BUCAI      -----------------------------------LEKGEAVKLSGFGNFQIKKKKARPGRNPRTGEIFL
IHFA_BUCA5      -----------------------------------LEKGEAVKLSGFGNFQIKKKKARPGRNPRTGEIFL
IHFA_HAEDU      LTKVEFTASLISKYGFDKSVAKQFVEQFFEEIRVALANGQEVKLSGFGNFSLRKKNARPGRNPKTGEXXX
IHFA_METRJ      VTRADLSEAVYHQVGLSRTESAALVETVLSEICSCLASGETVKLSSFGSFVVRSKGKRVGRNPKTGVEVA
DBH_AQUAE       ---------------IQKKEVYNLVSEVFTIIQECLLKGEKVKISGFGTFVVKTRKPKKGMNIKKREIVE
DBH_CHLTR       MTKKKLISTISQDHKIHPNHVRTVIQNFLDKMTDALVQGDRLEFRDFGVLQVVERKPKVGRNPKNAAVIH
DBH_CHLPN       MTKKKLISTISQDHKIHPNHVRTVIQNFLDKMTDALVKGDRLEFRDFGVLQVVERKPKVGRNPKNAAVIH
DBH_CHLMU       MTKKKLISTISQDHKIHPNHVRTVIQNFLDKMTDALVQGDRLEFRDFGVLQVVERKPKVGRNPKNAAVIH
DBH_TREPA       --RSFVVDALCDEVDLSRRHXXXXXXXXXXXXXXXLERGETVELRDFGVFESRVRKASVGKSIKTGEVVS
DBH2_STRLI      ------------------------------------------SVTGFGSFEKVDRPARYARNPQTGERVR
DBH2_STRCO      ------------------------------------------SVTGFGSFEKVDRPARYARNPQTGERVR
DBH_BORPR       VTKSDIVNQISSNEKLEKKYIRLVVDAFFEELKNSLCLNNVIEFRSFGTFELRKRKGRQNRNPQTGEYVN
DBH_BORAF       VTKSDIVDQISNNLKLEKKYIRLVIDAFFEELKSNLCSNNVIEFRSFGTFEVRKRKGRNARNPQTGEYVK
DBH_BORAD       VTKSDIVDQISNNLKLEKKYIRLVIDAFFEELKSNLCSNNVIEFRSFGTFEVRKRRGRNARNPQTGEYVK
DBH_BORJA       VTKSDIVDQISNNLKLEKKYIRLVIDAFFEELKGNLCSNNVIEFRSFGTFEVRKRKGRNARNPQTGEYVK
VHLP_ASFWA      ITKQELYSLVAADTQLNKALIERIFTSQQKIIQNALKHNQEVIIIKFTVVTVKAKPARQGHNPATGEPIQ
VHLP_ASFP4      ITKQELYSLVAADTQLNKALIERIFTSQQKIIQNALKHNQEVIIIKFTVVTVKAKPARQGHNPATGEPIQ
VHLP_ASFM2      ITKQELYSLVAADTQLNKALIERIFTSQQKIIQNALKHNQEVIIIKFTVVTVKAKPARQGHNPATGEPIQ
VHLP_ASFK5      ITKQELYSLVAADTQLNKALIERIFTSQQKIIQNALKHNQEVIIIKFTVVTVKAKPARQGHNPATGEPIQ
VHLP_ASFB7      ITKQELYSLVAADTQLNKALIERIFTSQQKIIQNALKHNQEVIIIKFTVVTVKAKPARQGHNPATGEPIQ
DBH_BORBU       ------------------------IDAFFEELKSNLCSNNVIEFRSFGTFEVRKRKGRNARNPQTGEYVK
DBH_BORTU       VTKSDIVNQISSNEKLEKKYIRLVVDAFFEELKNSLCLNNVIEFRSFGTFELRKRKGRQNRNPQTGEYVN
DBH_BORGA       ITKSDIVDQISNNLKLEKKYIRLVIDAFFEELKGNLCLNNVIEFRSFGTFEVRKRKGRNARNPQTGEYVK
HLP_RICPR       ------------------EAIVNTVFSNILEIAKVQK----LTLKNFGSFEVKQKTPRPGINFHTKSPVM
HLP_RICRI       ----------------------HTVFSNILEIAKAQK----LTLKNFGSFEVKQKNPRPGINFHTKALVI
HLP_RICTY       ----------------------NTVFSNILEIAKVQK----LTLKNFGSFEVKQKKQRPGINFHTKSPVM
HLP_RICCN       ITKAKIAAMLSSKLGFSNNLCEEIVHTVFSNILEIAKE-QKLTLKNFGSFEVKQKNPRPGINFHTKAPVI
HLP_RICMO       ITKEKIAAMLSSKLGFSNNLCEEIVHTVFSNILEIAKE-QKLTLKNFGSFEVKQKNPRPGINFHTKAPVI
HLP_RICFE       ----------------------NTVFFNILEIAKEQK----LTLKNFGSFEVKQKNPRPGINFHTKSPII
Y537_SYNY3      --------------------------------------------IGLATILVV--GPRQGRFPKTGKTLK


                         .         .         *         .         .         .         .:140
query           IPASKVPSFKASKGLKDAVK
DBHB_PSEAE      IAAAKIPGFKAGKALKDAV-
DBHB_NEIMB      IAAAKTPKFRAGKALKDAL-
DBHB_NEIMA      IAAAKTPKFRAGKALKDAL-
DBH_XYLFT       IAASNNPSFKPGKALKDAVK
DBH_STAAW       IPASKVPAFKAGKALKDAVK
DBH_STAAS       IPASKVPAFKAGKALKDAVK
DBH_STAAR       IPASKVPAFKAGKALKDAVK
DBH_STAAN       IPASKVPAFKAGKALKDAVK
DBH_STAAM       IPASKVPAFKAGKALKDAVK
DBH_STAAC       IPASKVPAFKAGKALKDAVK
DBH_BACST       IPASKVPAFKPGKALKDAVK
DBH_BACCL       IPASKVPAFKPGKALKDAVK
DBH_BACCA       IPASKVPAFKPGKALKDAVK
DBH1_BACSU      IPASKVPAFKPGKALKDAV-
DBHA_VIBCH      IAAANVPAFVAGKALKDAIK
DBH_XYLFA       IAASNNPSFKPGKALKDAVK
DBH1_BACHD      IPATKNPAFKPGKQLKDAV-
DBHB_VIBCH      IAEAKVPSFKAGKALKDA--
DBHA_SERMA      IAAANVPAFVSGKALKDAVK
DBHA_SHIFL      IAAANVPAFVSGKALKDAVK
DBHA_ECOLI      IAAANVPAFVSGKALKDAVK
DBHA_ECOL6      IAAANVPAFVSGKALKDAVK
DBHA_ECO57      IAAANVPAFVSGKALKDAVK
DBHA_SALTY      IAAANVPAFVSGKALKDAVK
DBHA_SALTI      IAAANVPAFVSGKALKDAVK
DBH_HAEIN       IAASKVPAFVSGKALKDAIK
DBHA_VIBPR      IAAANVPAFVAGKALKDAVK
DBH_PASMU       IAASKVPAFVAGKALKDAVK
DBHC_NEIMA      IAARKTPKFRSGKALKDAV-
DBHA_AERHY      IAAANVPSFVAGKALKDAVK
DBH_BUCAI       IPATKVPSFTSGKTLKNAIK
DBH_ANASP       IPATRVPAFSAGKLFREKV-
DBH1_RHIRD      IPARNVPKFSAGKGLKDAV-
DBH1_RHILE      IPARNVPKFSAGKGLKDAV-
DBH_CLOPA       IPATTVPVFKAGKEFKDKV-
DBH_BUCAP       IPATKVPSFISGKTLKNAIK
DBH2_BACHD      IAATKTPAFKAGKQLKDAVK
DBHA_BURPS      IPAAKTVKFTAGKAFKDAV-
DBH_STRDO       IAASKVPAFKAGKALKDAVK
DBH_STRPY       IAASKVPAFKAGKALKDAVK
DBH_STRP8       IAASKVPAFKAGKALKDAVK
DBH_STRP6       IAASKVPAFKAGKALKDAVK
DBH_STRP3       IAASKVPAFKAGKALKDAVK
DBH_STRP1       IAASKVPAFKAGKALKDAVK
DBH_LACLA       IAATVVPAFKAGKALKDAVK
DBH_BUCBP       ISATKTPVFISGKTFKTAIK
DBHB_SERMA      IAARKVPAFRAGKALKDAV-
DBHA_PSEAE      IKASNTVAFKPGKALRDAV-
DBH_STRMU       IKASKVPAFKAGKALKDAVK
DBH_STRTR       IAASKVPAFKAGKALKDAVK
DBH_STRGN       IAASKVPAFKAGKALKDAVK
DBH_SYNY3       IPATKVPAFSAGKMFKDKV-
DBHB_PSEF5      I-------------------
DBH_CAUCR       RPASKTARFQVGEGLKSSL-
DBH_CAUCN       RPASKTARFQVGEGLKSSL-
DBHB_SALTY      IAAAKVPSFRAGKALKDAV-
DBHB_SALTI      IAAAKVPSFRAGKALKDAV-
DBHB_SHIFL      IAAAKVPSFRAGKALKDAV-
DBHB_ECOLI      IAAAKVPSFRAGKALKDAV-
DBHB_ECOL6      IAAAKVPSFRAGKALKDAV-
DBHB_ECO57      IAAAKVPSFRAGKALKDAV-
DBH_RHIME       IPARNVPKFTAGKGLKDAV-
DBH_THET8       IPATQYPAFKPGKALKDKVK
IHFA_BORA1      IAARRVVTFHASQKLKSTVE
DBH_CAMJR       VPATRVAKFKVGKNLKEAV-
DBH_CAMJE       VPATRVAKFKVGKNLKEAV-
IHFA_BORPE      IAARRVVTFHASQKLKSVVE
IHFA_BORPA      IAARRVVTFHASQKLKSVVE
IHFA_BORBR      IAARRVVTFHASQKLKSVVE
DBH5_RHILE      IPARNVPKFTPGKGLKDAV-
IHFB_ACTSZ      LDAKCVPHFKAGKELKERV-
DBH_GUITH       LPASRIPTFSVGNFFRNKV-
IHFA_BURPS      IAARRVVTFHASQKLKALVE
IHFB_HAEIN      LSAKSVPYFKAGKELKARV-
IHFB_HAEIE      LSAKSVPYFKAGKELKARV-
IHFB_HAEI8      LSAKSVPYFKAGKELKARV-
IHFB_BART1      VDEKWIPFFKTGKDLRD---
IHFA_RALSO      ITARRVVTFHASQKLKALVE
IHFA_METFK      ITARRVVTFHASQKLKSKVE
IHFA_AZOSB      ITARRVVTFHASQKLKAAVE
IHFB_METCA      LPSRRVPHFKPGKELRDRV-
DBH2_BPSPC      I-------------------
DBH2_BACSU      I-------------------
IHFB_HAHCH      LPAKYVPHFKPGKELRDEV-
IHFB_HAEIG      LSAKSVPYFKAGKELKARV-
IHFB_MANSM      LDAKCVPHFKAGKELRERV-
IHFA_VIBCM      ITARRVVTFRPGQKLKARVE
IHFA_VIBCH      ITARRVVTFRPGQKLKARVE
IHFA_VIBC3      ITARRVVTFRPGQKLKARVE
IHFA_DELAS      IEARRVVTFHASSKLKEQIQ
IHFA_CHRVO      ITARRVVTFHASQKLKGMVE
IHFB_DICNV      VPAKSIPYFRAGKELRERV-
IHFA_NITMU      ITARRVVTFHASQKLKAMVE
IHFB_PSEHT      LDGKHVPHFKPGKELRDRV-
IHFB_DECAR      VPAKWVPHFKAGKELRERV-
IHFA_VIBFM      ISARRVVTFKPGQKLKARVE
IHFA_VIBF1      ISARRVVTFKPGQKLKARVE
IHFA_SHELP      ISARRVVTFRPGQKLKSRVE
IHFA_POLSJ      IQARRVVTFHASHKLKDQIQ
IHFA_ALISL      ISARRVVTFKPGQKLKARVE
DBH_THEMA       IPERKVPKFKPGKALKEKVK
IHFB_THISH      LPGKYVPHFKPGKELRERV-
IHFA_AZOSE      ITARRVVTFHASQKLKAAVE
DBH_RICPR       IDAYNQPTFRAGRKLKEA--
IHFB_SACD2      LPGKYVPHFKPGKEMRDRV-
IHFB_OCHA4      VEEKWVPFFKTGKELRD---
IHFB_BRUSU      VEEKWVPFFKTGKELRD---
IHFB_BRUSI      VEEKWVPFFKTGKELRD---
IHFB_BRUO2      VEEKWVPFFKTGKELRD---
IHFB_BRUC2      VEEKWVPFFKTGKELRD---
IHFB_BRUAB      VEEKWVPFFKTGKKLRD---
IHFB_BRUA2      VEEKWVPFFKTGKKLRD---
IHFB_BRUA1      VEEKWVPFFKTGKKLRD---
IHFA_PSYIN      IAARRVVTFRAGQKLKELVE
IHFA_CAUSK      IEPRRVIGFRASQVMK----
IHFA2_DECAR     ITARRVVTFHASQKLKSDVE
IHFB_XANOP      LPGKHVPHFKPGKELRERV-
IHFB_XANOM      LPGKHVPHFKPGKELRERV-
IHFB_XANCP      LPGKHVPHFKPGKELRERV-
IHFB_XANCB      LPGKHVPHFKPGKELRERV-
IHFB_XANC8      LPGKHVPHFKPGKELRERV-
IHFB_XANAC      LPGKHVPHFKPGKELRERV-
IHFA_VIBSL      ISARRVVTFRPGQKLKARVE
IHFA_PROMH      ITARRVVTFRPGQKLKSRVE
IHFA_NITEU      ISARRVVTFHASQKLKSMVE
IHFA_NITEC      ISARRVVTFHASQKLKSMVE
IHFB_TERTT      LEGKFVPHFKPGKEMRDRV-
IHFB_RHOSK      VEDKKVPFFKTGKLLRD---
IHFB_RHOS4      VEDKKVPFFKTGKLLRD---
IHFB_RHOS1      VEDKKVPFFKTGKLLRD---
IHFB_BRUME      VEEKWVPFFKTGKKLRD---
IHFB_BRUMB      VEEKWVPFFKTGKKLRD---
IHFA_VIBVY      ITARRVVTFRPGQKLKARVE
IHFA_VIBVU      ITARRVVTFRPGQKLKARVE
IHFA_RHOFD      IQARRVVTFHAGYKLKEQIQ
IHFB_HAEPS      LDAKYVPHFKAGKELKERV-
IHFA_SHEWM      ISARRVVTFRPGQKLKSRVE
IHFA_CAUCR      IEPRRVIGFRASQVMK----
IHFA_CAUCN      IEPRRVIGFRASQVMK----
IHFB_SILST      VEEKHVPFFKTGKLLRD---
IHFB_PASMU      LDAKSVPHFKAGKELRERV-
IHFB_HALHL      LPAKYVPHFKPGKELRERV-
IHFB_DINSH      VEAKSVPFFKTGKLLRD---
IHFA_DICNV      ITARRVVSFKAGQKLKARV-
IHFB_NITMU      VPEKYVPHFKAGKEMRERV-
IHFB_AZOVD      LDGKFVPHFKPGKELRDRV-
IHFB_AZOSB      VPEKYVPHFKAGKELRERV-
IHFB_ALHEH      LPGKYVPHFKPGKELRDRV-
IHFA_THIDA      ISARRVVTFHASQKLKSQVE
IHFA_PSEA6      IKARRVVTFRPGQKLKSRVE
IHFA_METCA      ITARRVVTFKAGQKLKATVE
DBH_RICCN       IDAYNQPTFRAGRKMKEA--
IHFB_RALME      VPEKRVPHFKAGKELRERV-
IHFB_HAES2      LSAKYVPHFKAGKELKERV-
IHFB_HAES1      LSAKYVPHFKAGKELKERV-
IHFB_DICD3      LEGKYVPHFKPGKELRD---
IHFA_SHEFN      ISARRVVTFRPGQKLKSRVE
IHFA_PASHA      VSARRVVVFKAGQKLRERVE
DBH_RICTY       IDAYNQPTFRAGRKLKEA--
DBH_RICFE       IDAYNQPTFRAGRKMKEA--
DBH1_STRLI      IPAGYSVKVSAGSKLKEAAK
DBH1_STRCO      IPAGYSVKVSAGSKLKEAAK
IHFB_MARAV      LPAKFVPHFKPGKELREQV-
IHFB_BORPD      VPGKQVPHFKAGKELRERV-
IHFA_VIBPA      ITARRVVTFRPGQKLKARVE
IHFA_VIBHB      ITARRVVTFRPGQKLKARVE
IHFA_SHESH      ISARRVVTFRPGQKLKSRVE
IHFA_SHEPW      ISARRVVTFRPGQKLKSRVE
IHFA_SHEPA      ISARRVVTFRPGQKLKSRVE
IHFA_SHEHH      ISARRVVTFRPGQKLKSRVE
DBH_RICBR       IPAYKQPVFKAGSKLKEA--
IHFB_XYLFT      LPGKYVPHFKPGKELRERV-
IHFB_XYLFA      LPGKYVPHFKPGKELRERV-
IHFB_XYLF2      LPGKYVPHFKPGKELRERV-
IHFB_XANP2      VSEKTVPYFKTGKEMRE---
IHFB_PSEAE      LDGKFVPHFKPGKELRDRV-
IHFB_PSEAB      LDGKFVPHFKPGKELRDRV-
IHFB_PSEA8      LDGKFVPHFKPGKELRDRV-
IHFB_PSEA7      LDGKFVPHFKPGKELRDRV-
IHFB_OLICO      VEQKSVPFFKTGKEMRE---
IHFB_GRABC      VDEKVVPFFKAGKELRERV-
IHFB_BORPA      VPGKQVPHFKAGKELRERV-
IHFA_YERPY      ITARRVVTFRPGQKLKSRVE
IHFA_YERPS      ITARRVVTFRPGQKLKSRVE
IHFA_YERPP      ITARRVVTFRPGQKLKSRVE
IHFA_YERPN      ITARRVVTFRPGQKLKSRVE
IHFA_YERPG      ITARRVVTFRPGQKLKSRVE
IHFA_YERPE      ITARRVVTFRPGQKLKSRVE
IHFA_YERPB      ITARRVVTFRPGQKLKSRVE
IHFA_YERPA      ITARRVVTFRPGQKLKSRVE
IHFA_YERP3      ITARRVVTFRPGQKLKSRVE
IHFA_YERE8      ITARRVVTFRPGQKLKSRVE
IHFA_SHEAM      ISARRVVTFRPGQKLKSRVE
IHFA_SERP5      ITARRVVTFRPGQKLKSRVE
IHFA_SERMA      ITARRVVTFRPGQKLKSRVE
IHFA_ANADF      ISARRVLTFRPSQVLKNAL-
IHFB_ROSDO      VEEKHVPFFKTGKLLRD---
IHFB_RHOP5      VEQKSVPFFKTGKEMRE---
IHFB_RALEJ      VPEKRVPHFKAGKELRERV-
IHFB_PECCP      LEGKYVPHFKPGKELRD---
IHFB_MESSB      VEEKWVPFFKTGKELRE---
IHFB_MARMS      LSAKYVPHFKPGKELRELV-
IHFB_ERWCT      LEGKYVPHFKPGKELRD---
IHFB_AGRVS      VEEKWVPFFKTGKELRE---
IHFA_SODGM      ITARRVVTFRPGQKLKSRVE
IHFA_PHOLL      ITARRVVTFRPGQKLKSRVE
IHFA_PECCP      ITARRVVTFRPGQKLKSRVE
IHFA_ERWT9      ITARRVVTFRPGQKLKSRVE
IHFA_ERWCT      ITARRVVTFRPGQKLKSRVE
IHFA_DICD3      ITARRVVTFRPGQKLKSRVE
IHFB_SILPO      VEEKHVPFFKTGKLLRD---
IHFB_SHESW      LEGKYVPHFKPGKELRERV-
IHFB_SHEPC      LEGKYVPHFKPGKELRERV-
IHFB_RALSO      VPEKRVPHFKAGKELRERV-
IHFB_PSEMY      LDGKFVPHFKPGKELRDRV-
IHFB_PSEA6      LDGKHVPHFKPGKELRERV-
IHFB_NITWN      VDQKSVPFFKTGKEMRE---
IHFB_NITHX      VDQKSVPFFKTGKEMRE---
IHFB_AZOC5      VSSKVVPYFKTGKEMRE---
IHFA_SHESR      ISARRVVTFRPGQKLKTRVE
IHFA_SHESM      ISARRVVTFRPGQKLKTRVE
IHFA_SHESA      ISARRVVTFRPGQKLKTRVE
IHFA_SHEON      ISARRVVTFRPGQKLKTRVE
IHFA_SHEDO      ISARRVVTFRPGQKLKARVE
IHFA_POLNA      IESRRVVTFHASHKLKEQIQ
IHFA_MYXXD      ISARRVLTFRPSQVLKSAL-
IHFA_MYXXA      ISARRVLTFRPSQVLKSAL-
IHFB_STRMK      LPGKHVPHFKPGKELRERV-
IHFB_STRM5      LPGKHVPHFKPGKELRERV-
IHFB_SHEWM      LDGKYVPHFKPGKELRERV-
IHFB_SHESR      LEGKYVPHFKPGKELRERV-
IHFB_SHESM      LEGKYVPHFKPGKELRERV-
IHFB_SHESA      LEGKYVPHFKPGKELRERV-
IHFB_SHEON      LEGKYVPHFKPGKELRERV-
IHFB_RHORT      VDAKVAPYFKTGKQLRE---
IHFB_RHILW      VEEKWVPFFKTGKELRE---
IHFB_RHIL3      VEEKWVPFFKTGKELRE---
IHFB_RHIEC      VEEKWVPFFKTGKELRE---
IHFB_RHIE6      VEEKWVPFFKTGKELRE---
IHFB_JANMA      VPEKRVPHFKPGKQLRERV-
IHFB_HERAR      VPEKRVPHFKPGKQLRERV-
IHFB_AGRRK      VEEKWVPFFKTGKELRE---
IHFA_NEIMF      ITARRVVTFHASQKLKSMVE
IHFA_NEIMB      ITARRVVTFHASQKLKSMVE
IHFA_NEIMA      ITARRVVTFHASQKLKSMVE
IHFA_NEIM0      ITARRVVTFHASQKLKSMVE
IHFA_NEIGO      ITARRVVTFHASQKLKGMVE
IHFA_ANASK      ISARRVLTFRPSQVLKNAL-
IHFA_ANADE      ISARRVLTFRPSQVLKNAL-
IHFA_ANAD2      ISARRVLTFRPSQVLKNAL-
IHFB_SHELP      LEGKYVPHFKPGKELRERV-
IHFB_SHEDO      LDGKYVPHFKPGKELRERV-
IHFB_RHILO      VEEKWVPFFKTGKELRE---
IHFB_COLP3      LSGKYVPHFKPGKELRERV-
IHFB_AGRT5      VEEKWVPFFKTGKELRE---
IHFA_XYLFT      ISARTVVTFRSGQKLKERV-
IHFA_XYLFM      ISARTVVTFRSGQKLKERV-
IHFA_XYLF2      ISARTVVTFRSGQKLKERV-
IHFA_STRMK      ISARTVVTFRPGQKLKERVE
IHFA_STRM5      ISARTVVTFRPGQKLKERVE
IHFA_SHISS      ITARRVVTFRPGQKLKSRVE
IHFA_SHIFL      ITARRVVTFRPGQKLKSRVE
IHFA_SHIF8      ITARRVVTFRPGQKLKSRVE
IHFA_SHIDS      ITARRVVTFRPGQKLKSRVE
IHFA_SHIBS      ITARRVVTFRPGQKLKSRVE
IHFA_SHIB3      ITARRVVTFRPGQKLKSRVE
IHFA_SHESW      ISARRVVTFRPGQKLKTRVE
IHFA_SHEPC      ISARRVVTFRPGQKLKTRVE
IHFA_SHEB9      ISARRVVTFRPGQKLKTRVE
IHFA_SHEB8      ISARRVVTFRPGQKLKTRVE
IHFA_SHEB5      ISARRVVTFRPGQKLKTRVE
IHFA_SHEB2      ISARRVVTFRPGQKLKTRVE
IHFA_SALTY      ITARRVVTFRPGQKLKSRVE
IHFA_SALTI      ITARRVVTFRPGQKLKSRVE
IHFA_SALSV      ITARRVVTFRPGQKLKSRVE
IHFA_SALPK      ITARRVVTFRPGQKLKSRVE
IHFA_SALPC      ITARRVVTFRPGQKLKSRVE
IHFA_SALPB      ITARRVVTFRPGQKLKSRVE
IHFA_SALPA      ITARRVVTFRPGQKLKSRVE
IHFA_SALNS      ITARRVVTFRPGQKLKSRVE
IHFA_SALHS      ITARRVVTFRPGQKLKSRVE
IHFA_SALG2      ITARRVVTFRPGQKLKSRVE
IHFA_SALEP      ITARRVVTFRPGQKLKSRVE
IHFA_SALDC      ITARRVVTFRPGQKLKSRVE
IHFA_SALCH      ITARRVVTFRPGQKLKSRVE
IHFA_SALAR      ITARRVVTFRPGQKLKSRVE
IHFA_SALA4      ITARRVVTFRPGQKLKSRVE
IHFA_PARDP      ITPRRVLSFRPSHLMKDRV-
IHFA_NEIG2      ITARRVVTFHASQKLKGMVE
IHFA_NEIG1      ITARRVVTFHASQKLKGMVE
IHFA_MESSB      ISPRRVMTFKASNVLKSRI-
IHFA_KLEP7      ITARRVVTFRPGQKLKSRVE
IHFA_KLEP3      ITARRVVTFRPGQKLKSRVE
IHFA_HAEPS      VSARRVVVFKAGQKLRERVE
IHFA_ESCF3      ITARRVVTFRPGQKLKSRVE
IHFA_ENTS8      ITARRVVTFRPGQKLKSRVE
IHFA_ENT38      ITARRVVTFRPGQKLKSRVE
IHFA_EDWI9      ITARRVVTFRPGQKLKCRVE
IHFA_ECOUT      ITARRVVTFRPGQKLKSRVE
IHFA_ECOSM      ITARRVVTFRPGQKLKSRVE
IHFA_ECOSE      ITARRVVTFRPGQKLKSRVE
IHFA_ECOLU      ITARRVVTFRPGQKLKSRVE
IHFA_ECOLI      ITARRVVTFRPGQKLKSRVE
IHFA_ECOLC      ITARRVVTFRPGQKLKSRVE
IHFA_ECOL6      ITARRVVTFRPGQKLKSRVE
IHFA_ECOL5      ITARRVVTFRPGQKLKSRVE
IHFA_ECOHS      ITARRVVTFRPGQKLKSRVE
IHFA_ECODH      ITARRVVTFRPGQKLKSRVE
IHFA_ECOBW      ITARRVVTFRPGQKLKSRVE
IHFA_ECO8A      ITARRVVTFRPGQKLKSRVE
IHFA_ECO81      ITARRVVTFRPGQKLKSRVE
IHFA_ECO7I      ITARRVVTFRPGQKLKSRVE
IHFA_ECO5E      ITARRVVTFRPGQKLKSRVE
IHFA_ECO57      ITARRVVTFRPGQKLKSRVE
IHFA_ECO55      ITARRVVTFRPGQKLKSRVE
IHFA_ECO45      ITARRVVTFRPGQKLKSRVE
IHFA_ECO27      ITARRVVTFRPGQKLKSRVE
IHFA_ECO24      ITARRVVTFRPGQKLKSRVE
IHFA_COLP3      ISARKVVTFRPGQKLKSRVE
IHFA_CITK8      ITARRVVTFRPGQKLKSRVE
IHFA_BRUSI      ILPRRVMTFKASNVLKQRI-
IHFB_SHESH      LDGKYVPHFKPGKELRERV-
IHFB_SHEB9      LEGKYVPHFKPGKELRERV-
IHFB_SHEB8      LEGKYVPHFKPGKELRERV-
IHFB_SHEB5      LEGKYVPHFKPGKELRERV-
IHFB_SHEB2      LEGKYVPHFKPGKELRERV-
IHFB_PARDP      VDEKHVPFFKTGKLLRE---
IHFB_NITEU      VPEKYVPHFKAGKKMRELI-
IHFB_ESCF3      LEGKYVPHFKPGKELRD---
IHFB_ERWT9      LEGKYVPHFKPGKELRD---
IHFB_ALISL      LDGKFVPHFKPGKELRERV-
IHFA_SINMW      ISPRRVMTFKASNVLKQRV-
IHFA_RHISN      ISPRRVMTFKASNVLKQRV-
IHFA_RHIME      ISPRRVMTFKASNVLKQRV-
IHFA_HALHL      ISARRVVTFRPGQKLKSRVE
IHFA_AERHH      ISARRVVTFRPGQKLKARVE
IHFB_VIBFM      LDGKFVPHFKPGKELRERV-
IHFB_VIBF1      LDGKFVPHFKPGKELRERV-
IHFB_SODGM      LEGKYVPHFKPGKELRD---
IHFB_SHEFN      LEGKYVPHFKPGKELRERV-
IHFB_RHIRD      IEEKWVPFFRAGKEIRD---
IHFB_NITEC      VPEKYVPHFKAGKKMRELI-
IHFB_IDILO      LDGKYVPHFKAGKELRERV-
IHFB_GLUDA      VDEKVVPFFKAGKELRERV-
IHFB_CHRSD      LQGKYVPHFKPGKELREQV-
IHFB_AGRT9      IEEKWVPFFRAGKEIRD---
IHFB_ACTPJ      LDAKYVPHFKAGKDLKERV-
IHFB_ACTP7      LDAKYVPHFKAGKDLKERV-
IHFB_ACTP2      LDAKYVPHFKAGKDLKERV-
IHFA_XANOR      ISARTVVTFRPGQKLKERVE
IHFA_XANOM      ISARTVVTFRPGQKLKERVE
IHFA_XANCP      ISARTVVTFRPGQKLKERVE
IHFA_XANCB      ISARTVVTFRPGQKLKERVE
IHFA_XANC8      ISARTVVTFRPGQKLKERVE
IHFA_XANC5      ISARTVVTFRPGQKLKERVE
IHFA_XANAC      ISARTVVTFRPGQKLKERVE
IHFA_PSEHT      ISARRVVTFRPGQKLKTRVE
IHFA1_DECAR     ITARRVVTFHASGCLKSAVE
IHFB_YERPY      LEGKYVPHFKPGKELRD---
IHFB_YERPS      LEGKYVPHFKPGKELRD---
IHFB_YERPP      LEGKYVPHFKPGKELRD---
IHFB_YERPN      LEGKYVPHFKPGKELRD---
IHFB_YERPG      LEGKYVPHFKPGKELRD---
IHFB_YERPE      LEGKYVPHFKPGKELRD---
IHFB_YERPB      LEGKYVPHFKPGKELRD---
IHFB_YERPA      LEGKYVPHFKPGKELRD---
IHFB_YERP3      LEGKYVPHFKPGKELRD---
IHFB_SINMW      VEEKWVPFFKTGKELRE---
IHFB_SHEPA      LEGKYVPHFKPGKELRERV-
IHFB_RHOCS      VNQKFIPFFKTGKQLRE---
IHFB_RHIME      VEEKWVPFFKTGKELRE---
IHFB_BRAJA      VDQKSVPFFKTGKEMRE---
IHFA_ALTMD      IKARRVVTFRPGQKLKSRVE
IHFA_ALHEH      ISARRVVTFRPGQKLKSRVE
DBH_DEIRA       IPAGKKVAFKVASTLK----
IHFB_SHEAM      LEGKYVPHFKPGKELRERV-
IHFB_RHOPS      VDQKSVPFFKTGKEMRE---
IHFB_RHOPB      VDQKSVPFFKTGKEMRE---
IHFB_RHOP2      VDQKSVPFFKTGKEMRE---
IHFB_CAUSK      VRAKHVPFFKSGKELR----
IHFB_BRASO      VDQKSVPFFKTGKEMRE---
IHFB_BRASB      VDQKSVPFFKTGKEMRE---
IHFB_BEII9      VEEKSVPFFKTGKEMRE---
IHFA_RHOCA      ISPRRVLSFRPSHLMKDRV-
IHFA_PHEZH      IEPRRVIGFRASQVMKARV-
IHFA_OCHA4      ILPRRVMTFKASNVLKQRI-
IHFA_BRUSU      ILPRRVMTFKASNVLKQRI-
IHFA_BRUME      ILPRRVMTFKASNVLKQRI-
IHFA_BRUMB      ILPRRVMTFKASNVLKQRI-
IHFA_BRUC2      ILPRRVMTFKASNVLKQRI-
IHFA_BRUAB      ILPRRVMTFKASNVLKQRI-
IHFA_BRUA2      ILPRRVMTFKASNVLKQRI-
IHFA_BRUA1      ILPRRVMTFKASNVLKQRI-
IHFB_VIBPA      LEGKYVPHFKPGKELRERV-
IHFB_VIBHB      LEGKYVPHFKPGKELRERV-
IHFB_SHISS      LEGKYVPHFKPGKELRD---
IHFB_SHIFL      LEGKYVPHFKPGKELRD---
IHFB_SHIF8      LEGKYVPHFKPGKELRD---
IHFB_SHIDS      LEGKYVPHFKPGKELRD---
IHFB_SHIBS      LEGKYVPHFKPGKELRD---
IHFB_SHIB3      LEGKYVPHFKPGKELRD---
IHFB_SHEHH      LEGKYVPHFKPGKELRERV-
IHFB_SERP5      LDGKYVPHFKPGKELRD---
IHFB_SALTY      LEGKYVPHFKPGKELRD---
IHFB_SALTI      LEGKYVPHFKPGKELRD---
IHFB_SALSV      LEGKYVPHFKPGKELRD---
IHFB_SALPK      LEGKYVPHFKPGKELRD---
IHFB_SALPC      LEGKYVPHFKPGKELRD---
IHFB_SALPB      LEGKYVPHFKPGKELRD---
IHFB_SALPA      LEGKYVPHFKPGKELRD---
IHFB_SALNS      LEGKYVPHFKPGKELRD---
IHFB_SALHS      LEGKYVPHFKPGKELRD---
IHFB_SALG2      LEGKYVPHFKPGKELRD---
IHFB_SALEP      LEGKYVPHFKPGKELRD---
IHFB_SALDC      LEGKYVPHFKPGKELRD---
IHFB_SALCH      LEGKYVPHFKPGKELRD---
IHFB_SALAR      LEGKYVPHFKPGKELRD---
IHFB_SALA4      LEGKYVPHFKPGKELRD---
IHFB_RHOPT      VDQKTVPFFKTGKEMRE---
IHFB_RHOPA      VDQKTVPFFKTGKEMRE---
IHFB_PSYIN      LDGKYVPHFKPGKALRERV-
IHFB_PHOLL      LEGKYVPHFKPGKELRDRV-
IHFB_KLEP7      LEGKYVPHFKPGKELRD---
IHFB_KLEP3      LEGKYVPHFKPGKELRD---
IHFB_JANSC      VEEKHVPFFKAGKLLRD---
IHFB_ECOUT      LEGKYVPHFKPGKELRD---
IHFB_ECOSM      LEGKYVPHFKPGKELRD---
IHFB_ECOSE      LEGKYVPHFKPGKELRD---
IHFB_ECOLU      LEGKYVPHFKPGKELRD---
IHFB_ECOLI      LEGKYVPHFKPGKELRD---
IHFB_ECOLC      LEGKYVPHFKPGKELRD---
IHFB_ECOL6      LEGKYVPHFKPGKELRD---
IHFB_ECOL5      LEGKYVPHFKPGKELRD---
IHFB_ECOHS      LEGKYVPHFKPGKELRD---
IHFB_ECODH      LEGKYVPHFKPGKELRD---
IHFB_ECOBW      LEGKYVPHFKPGKELRD---
IHFB_ECO8A      LEGKYVPHFKPGKELRD---
IHFB_ECO81      LEGKYVPHFKPGKELRD---
IHFB_ECO7I      LEGKYVPHFKPGKELRD---
IHFB_ECO5E      LEGKYVPHFKPGKELRD---
IHFB_ECO57      LEGKYVPHFKPGKELRD---
IHFB_ECO55      LEGKYVPHFKPGKELRD---
IHFB_ECO45      LEGKYVPHFKPGKELRD---
IHFB_ECO24      LEGKYVPHFKPGKELRD---
IHFB_CITK8      LEGKYVPHFKPGKELRD---
IHFB_BURXL      VPEKYVPHFKPGKELRERV-
IHFB_BURPP      VPEKYVPHFKPGKELRERV-
IHFA_XYLFA      ISARTVVTFRSGQKLKERV-
IHFA_RHILW      ISPRRVMTFKASNVLKTRI-
IHFA_PASMU      VSARRVVAFKPGQKLRARVE
IHFA_NITOC      ITARRVVTFRPGQKLKARVE
DBH_MYCTU       VKPTSVPAFRPGAQFKAVV-
DBH_MYCLE       VKPTSVPAFRPGAQFKAVV-
DBH_MYCBO       VKPTSVPAFRPGAQFKAVV-
DBH1_BIFLO      IPASYGVRISAGSLLKKAV-
IHFB_YERE8      LEGKYVPHFKPGKELRD---
IHFB_VIBVY      LEGKYVPHFKPGKELRERV-
IHFB_VIBVU      LEGKYVPHFKPGKELRERV-
IHFB_VIBSL      LEGKYVPHFKPGKELRERV-
IHFB_RHOCA      VDEKHVPFFKTGKLLRD---
IHFB_PSEU5      LDGKFVPHFKPGKELRDRV-
IHFB_PSEPW      LEGKFVPHFKPGKELRDRV-
IHFB_PSEE4      LEGKYVPHFKPGKELRDRV-
IHFB_PHOPR      LDGKYVPHFKPGKELRDRV-
IHFB_METSB      VDEKVVPFFKTGKEMRE---
IHFB_ECO27      LEGKYVPHFKPGKELRD---
IHFB_BURP8      VPEKHVPHFKPGKELRERV-
IHFA_SILST      IQPRRVLTFRPSHLMKDRV-
IHFA_RHIL3      ISPRRVMTFKASNVLKTRI-
IHFA_RHIEC      ISPRRVMTFKASNVLKTRI-
IHFA_RHIE6      ISPRRVMTFKASNVLKTRI-
IHFA_IDILO      ISARRVVTFKPGQKFKSRVE
IHFA_HAHCH      ITARRVVTFRPGQKLKAKVE
IHFA_DINSH      IHPRRVLTFRPSHLMKERV-
IHFA_BDEBA      ISARRVLTFRPSQVLK----
IHFA_AGRT5      ISPRRVMTFKASNVLKQRI-
IHFA_AGRRK      ISPRRVMTFKASNVLKTRI-
DBH_MYCS2       VKPTSVPAFRPGAQFKAVI-
DBH_HELPJ       TEDKRVPKFKPGKILKQKVE
IHFB_SERMA      LDGKYVPHFKPGKELRD---
IHFB_PSEU2      LDGKFVPHFKPGKELRDRV-
IHFB_PSESM      LDGKFVPHFKPGKELRDRV-
IHFB_PSEPU      LEGKFVPHFKPGKELRDRV-
IHFB_PSEPK      LEGKFVPHFKPGKELRDRV-
IHFB_PSEPG      LEGKFVPHFKPGKELRDRV-
IHFB_PSEPF      LDGKFVPHFKPGKELRDRV-
IHFB_PSEP1      LEGKFVPHFKPGKELRDRV-
IHFB_PSEFS      LDGKFVPHFKPGKELRDRV-
IHFB_MARMM      VKEKHVPFFKTGKELRERV-
IHFB_LARHH      VPEKFVPHFKAGKELRERV-
IHFB_HAEDU      LDAKYVPHFKAGKDLKERV-
IHFB_ENT38      LEGKYVPHFKPGKELRD---
IHFB_BURTA      VPEKHVPHFKPGKELRERV-
IHFB_BURPS      VPEKHVPHFKPGKELRERV-
IHFB_BURP6      VPEKHVPHFKPGKELRERV-
IHFB_BURP1      VPEKHVPHFKPGKELRERV-
IHFB_BURP0      VPEKHVPHFKPGKELRERV-
IHFB_BURMS      VPEKHVPHFKPGKELRERV-
IHFB_BURMA      VPEKHVPHFKPGKELRERV-
IHFB_BURM9      VPEKHVPHFKPGKELRERV-
IHFB_BURM7      VPEKHVPHFKPGKELRERV-
IHFA_TOLAT      ITARRVVTFRPGQKLKSRVE
IHFA_THISH      ISARRVVTFRPGQKLKARVE
IHFA_RHOS5      ISPRRVLTFRPSHLMKERV-
IHFA_RHOS4      ISPRRVLTFRPSHLMKERV-
IHFA_RHOS1      ISPRRVLTFRPSHLMKERV-
IHFA_PSEU5      ITARRVVTFRPGQKLKARVE
IHFA_PSEAE      ITARRVVTFRPGQKLKARVE
IHFA_PSEAB      ITARRVVTFRPGQKLKARVE
IHFA_PSEA7      ITARRVVTFRPGQKLKARVE
IHFA_MARAV      ISARRVVTFRPGQKLKQKVE
IHFA_LEGPL      VEARRVVTFKPGLKLKTKIE
IHFA_LEGPH      VEARRVVTFKPGLKLKTKIE
IHFA_LEGPC      VEARRVVTFKPGLKLKTKIE
IHFA_LEGPA      VEARRVVTFKPGLKLKTKIE
IHFA_JANSC      ISPRRVLTFRPSHLMKDRV-
IHFA_AGRVS      ISPRKVMTFKASNVLKQRI-
IHFB_PROMH      LEGKYVPHFKPGKELRDRV-
IHFB_PARL1      VDEKSVPFFKTGKELRE---
IHFB_EDWI9      LEGKYVPHFKPGKELRD---
IHFB_BUCAP      LNERYIPYFKPGKQLRD---
IHFA_PSEA8      ITARRVVTFRPGQKLKARVE
IHFA_MAGSA      ITPRRVLVFRPSQLLKKKI-
IHFB_TOLAT      LLAKSVPHFKPGKELRERV-
IHFB_PSE14      LDG<