[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30683.1

[Show Plain Result]


## Summary of Sequence Search
    1::109
    1::109     5e-60 100%  109 aa  HFQ_FRATM RecName: Full=Protein hfq;
    1::109     2e-59  99%  109 aa  HFQ_FRATW RecName: Full=Protein hfq;
    1::109     2e-59  99%  109 aa  HFQ_FRATO RecName: Full=Protein hfq;
    1::109     2e-59  99%  109 aa  HFQ_FRATN RecName: Full=Protein hfq;
    1::109     2e-59  99%  109 aa  HFQ_FRATH RecName: Full=Protein hfq;
    1::109     2e-59  99%  109 aa  HFQ_FRATF RecName: Full=Protein hfq;
    1::109     6e-59  97%  109 aa  HFQ_FRATT RecName: Full=Protein hfq;
    1::109     6e-59  97%  109 aa  HFQ_FRAT1 RecName: Full=Protein hfq;
    1::109     5e-56  93%  109 aa  HFQ_FRAP2 RecName: Full=Protein hfq;
    1::87      2e-28  67%   91 aa  HFQ_HAEIN RecName: Full=Protein hfq;
    1::85      3e-28  67%   89 aa  HFQ_ALHEH RecName: Full=Protein hfq;
    1::88      7e-28  61%   88 aa  HFQ_VIBFM RecName: Full=Protein hfq;
    1::88      7e-28  61%   88 aa  HFQ_VIBF1 RecName: Full=Protein hfq;
    1::91      9e-28  60%   92 aa  HFQ_XANCP RecName: Full=Protein hfq;
    1::91      9e-28  60%   92 aa  HFQ_XANCB RecName: Full=Protein hfq;
    1::91      9e-28  60%   92 aa  HFQ_XANC8 RecName: Full=Protein hfq;
    1::91      1e-27  60%   92 aa  HFQ_XANOR RecName: Full=Protein hfq;
    1::91      1e-27  60%   92 aa  HFQ_XANOM RecName: Full=Protein hfq;
    1::91      1e-27  60%   92 aa  HFQ_XANC5 RecName: Full=Protein hfq;
    1::91      1e-27  60%   92 aa  HFQ_XANAC RecName: Full=Protein hfq;
    1::85      2e-27  64%   85 aa  HFQ_PHOPR RecName: Full=Protein hfq;
    1::91      2e-27  62%   92 aa  HFQ_XYLFA RecName: Full=Protein hfq;
    1::70      2e-27  74%   90 aa  HFQ_NITOC RecName: Full=Protein hfq;
    1::88      3e-27  62%   88 aa  HFQ_VIBSL RecName: Full=Protein hfq;
    1::89      3e-27  62%   90 aa  HFQ_HALHL RecName: Full=Protein hfq;
    1::70      3e-27  74%   82 aa  HFQ_ALTMD RecName: Full=Protein hfq;
    1::92      4e-27  63%   93 aa  HFQ_SHESH RecName: Full=Protein hfq;
    1::70      4e-27  74%   86 aa  HFQ_PSEE4 RecName: Full=Protein hfq;
    1::88      4e-27  61%   88 aa  HFQ_ALISL RecName: Full=Protein hfq;
    1::91      6e-27  62%   92 aa  HFQ_XYLFT RecName: Full=Protein hfq;
    1::91      6e-27  62%   92 aa  HFQ_XYLFM RecName: Full=Protein hfq;
    1::91      6e-27  62%   92 aa  HFQ_XYLF2 RecName: Full=Protein hfq;
    1::68      6e-27  75%   96 aa  HFQ_PASMU RecName: Full=Protein hfq;
    1::70      6e-27  73%   83 aa  HFQ_MARAV RecName: Full=Protein hfq;
    1::68      6e-27  75%   96 aa  HFQ_MANSM RecName: Full=Protein hfq;
    1::70      6e-27  73%   83 aa  HFQ_HAHCH RecName: Full=Protein hfq;
    1::68      6e-27  75%   91 aa  HFQ_HAEIG RecName: Full=Protein hfq;
    1::68      6e-27  75%   91 aa  HFQ_HAEIE RecName: Full=Protein hfq;
    1::68      6e-27  75%   91 aa  HFQ_HAEI8 RecName: Full=Protein hfq;
    1::68      6e-27  75%   99 aa  HFQ_ACTSZ RecName: Full=Protein hfq;
    1::70      8e-27  74%   91 aa  HFQ_STRMK RecName: Full=Protein hfq;
    1::70      8e-27  74%   91 aa  HFQ_STRM5 RecName: Full=Protein hfq;
    1::84      8e-27  63%   84 aa  HFQ_PSEU5 RecName: Full=Protein hfq;
    1::68      1e-26  75%   86 aa  HFQ_VIBVY RecName: Full=Protein hfq;
    1::68      1e-26  75%   86 aa  HFQ_VIBVU RecName: Full=Protein hfq;
    1::68      1e-26  75%   87 aa  HFQ_VIBPA RecName: Full=Protein hfq;
    1::68      1e-26  75%   87 aa  HFQ_VIBHB RecName: Full=Protein hfq;
    1::68      1e-26  75%   87 aa  HFQ_VIBCM RecName: Full=Protein hfq;
    1::68      1e-26  75%   87 aa  HFQ_VIBCH RecName: Full=Protein hfq;
    1::68      1e-26  75%   87 aa  HFQ_VIBC3 RecName: Full=Protein hfq;
    1::92      1e-26  62%   92 aa  HFQ_SHELP RecName: Full=Protein hfq;
    1::92      1e-26  64%   92 aa  HFQ_SHEHH RecName: Full=Protein hfq;
    1::90      1e-26  61%   91 aa  HFQ_SHEAM RecName: Full=Protein hfq;
    1::83      1e-26  65%   83 aa  HFQ_PSEA6 RecName: Full=Protein hfq;
    1::70      1e-26  73%   88 aa  HFQ_CELJU RecName: Full=Protein hfq;
    1::74      1e-26  70%   84 aa  HFQ_AZOVD RecName: Full=Protein hfq;
    1::81      2e-26  68%  101 aa  HFQ_YEREN RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::81      2e-26  68%  101 aa  HFQ_YERE8 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::102     2e-26  61%  102 aa  HFQ_SERP5 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::88      2e-26  66%  102 aa  HFQ_SALAR RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::70      2e-26  73%   86 aa  HFQ_PSEPW RecName: Full=Protein hfq;
    1::70      2e-26  73%   86 aa  HFQ_PSEPK RecName: Full=Protein hfq;
    1::70      2e-26  73%   86 aa  HFQ_PSEPG RecName: Full=Protein hfq;
    1::70      2e-26  73%   86 aa  HFQ_PSEP1 RecName: Full=Protein hfq;
    1::70      2e-26  73%   86 aa  HFQ_PSEMY RecName: Full=Protein hfq;
    1::70      2e-26  73%   82 aa  HFQ_PSEAE RecName: Full=Protein hfq;
    1::70      2e-26  73%   82 aa  HFQ_PSEAB RecName: Full=Protein hfq;
    1::70      2e-26  73%   82 aa  HFQ_PSEA8 RecName: Full=Protein hfq;
    1::70      2e-26  73%   82 aa  HFQ_PSEA7 RecName: Full=Protein hfq;
    1::85      2e-26  70%   99 aa  HFQ_PECCP RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::70      2e-26  71%   83 aa  HFQ_CHRSD RecName: Full=Protein hfq;
    1::70      2e-26  73%   89 aa  HFQ_SHEDO RecName: Full=Protein hfq;
    1::68      2e-26  74%   87 aa  HFQ_AERS4 RecName: Full=Protein hfq;
    1::68      2e-26  74%   87 aa  HFQ_AERHH RecName: Full=Protein hfq;
    1::68      2e-26  74%   92 aa  HFQ_ACTPJ RecName: Full=Protein hfq;
    1::68      2e-26  74%   92 aa  HFQ_ACTP7 RecName: Full=Protein hfq;
    1::68      2e-26  74%   92 aa  HFQ_ACTP2 RecName: Full=Protein hfq;
    1::68      3e-26  75%   85 aa  HFQ_TOLAT RecName: Full=Protein hfq;
    1::83      3e-26  63%   87 aa  HFQ_PSEHT RecName: Full=Protein hfq;
    1::74      3e-26  69%   86 aa  HFQ_PSEF5 RecName: Full=Protein hfq;
    1::68      3e-26  72%  101 aa  HFQ_HAEDU RecName: Full=Protein hfq;
    1::102     3e-26  62%  102 aa  HFQ_ECOLU RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::83      4e-26  70%  101 aa  HFQ_YERPY RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::83      4e-26  70%  101 aa  HFQ_YERPS RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::83      4e-26  70%  101 aa  HFQ_YERPN RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::83      4e-26  70%  101 aa  HFQ_YERPG RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::83      4e-26  70%  101 aa  HFQ_YERPE RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::83      4e-26  70%  101 aa  HFQ_YERPB RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::83      4e-26  70%  101 aa  HFQ_YERPA RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::83      4e-26  70%  101 aa  HFQ_YERP3 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::94      4e-26  67%   94 aa  HFQ_SHEWM RecName: Full=Protein hfq;
    1::91      4e-26  60%   92 aa  HFQ_SHEPW RecName: Full=Protein hfq;
    1::70      4e-26  71%   86 aa  HFQ_PSEU2 RecName: Full=Protein hfq;
    1::70      4e-26  71%   86 aa  HFQ_PSESM RecName: Full=Protein hfq;
    1::70      4e-26  71%   86 aa  HFQ_PSEPF RecName: Full=Protein hfq;
    1::70      4e-26  71%   86 aa  HFQ_PSEFS RecName: Full=Protein hfq;
    1::70      4e-26  71%   86 aa  HFQ_PSE14 RecName: Full=Protein hfq;
    1::66      5e-26  77%   90 aa  HFQ_SHESW RecName: Full=Protein hfq;
    1::66      5e-26  77%   90 aa  HFQ_SHESR RecName: Full=Protein hfq;
    1::66      5e-26  77%   90 aa  HFQ_SHESM RecName: Full=Protein hfq;
    1::66      5e-26  77%   90 aa  HFQ_SHESA RecName: Full=Protein hfq;
    1::66      5e-26  77%   90 aa  HFQ_SHEPC RecName: Full=Protein hfq;
    1::66      5e-26  77%   90 aa  HFQ_SHEON RecName: Full=Protein hfq;
    1::66      5e-26  77%   85 aa  HFQ_SHEFN RecName: Full=Protein hfq;
    1::66      5e-26  77%   90 aa  HFQ_SHEB9 RecName: Full=Protein hfq;
    1::66      5e-26  77%   90 aa  HFQ_SHEB8 RecName: Full=Protein hfq;
    1::66      5e-26  77%   90 aa  HFQ_SHEB5 RecName: Full=Protein hfq;
    1::66      5e-26  77%   90 aa  HFQ_SHEB2 RecName: Full=Protein hfq;
    1::71      5e-26  69%   77 aa  HFQ_PSYIN RecName: Full=Protein hfq;
    1::78      5e-26  68%   96 aa  HFQ_PROMH RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::82      5e-26  67%   82 aa  HFQ_METCA RecName: Full=Protein hfq;
    1::70      5e-26  70%   81 aa  HFQ_MARMS RecName: Full=Protein hfq;
    1::66      5e-26  74%   96 aa  HFQ_HAES2 RecName: Full=Protein hfq;
    1::66      5e-26  74%   96 aa  HFQ_HAES1 RecName: Full=Protein hfq;
    1::68      6e-26  74%  101 aa  HFQ_SODGM RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_SHISS RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_SHIFL RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_SHIF8 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_SHIDS RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_SHIBS RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_SHIB3 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::91      6e-26  60%   92 aa  HFQ_SHEPA RecName: Full=Protein hfq;
    1::68      6e-26  74%  102 aa  HFQ_SALTY RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_SALTI RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_SALSV RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_SALPK RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_SALPC RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_SALPB RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_SALPA RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_SALNS RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_SALG2 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_SALEP RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_SALDC RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_SALCH RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_SALA4 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_KLEP7 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_KLEP3 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_ESCF3 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_ERWT9 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%   99 aa  HFQ_ERWCT RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_ENTS8 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  103 aa  HFQ_ENT38 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_ECOUT RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_ECOSM RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_ECOSE RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_ECOLI RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_ECOLC RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_ECOL6 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_ECOL5 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_ECOK1 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_ECOHS RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_ECODH RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_ECOBW RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_ECO8A RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_ECO81 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_ECO7I RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_ECO5E RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_ECO57 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_ECO55 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_ECO45 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_ECO27 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_ECO24 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      6e-26  74%  102 aa  HFQ_CITK8 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::83      8e-26  70%  101 aa  HFQ_YERPP RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::70      8e-26  69%   80 aa  HFQ_THISH RecName: Full=Protein hfq;
    1::70      8e-26  69%  106 aa  HFQ_DICNV RecName: Full=Protein hfq;
    1::68      1e-25  72%  102 aa  HFQ_SALHS RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::68      1e-25  74%   99 aa  HFQ_PECCC RecName: Full=Protein hfq;AltName: Full=Bacteriocin
    1::66      2e-25  73%   93 aa  HFQ_HAEPS RecName: Full=Protein hfq;
    1::68      2e-25  71%   83 aa  HFQ_COLP3 RecName: Full=Protein hfq;
    1::66      2e-25  71%   85 aa  HFQ_IDILO RecName: Full=Protein hfq;
    1::69      2e-25  70%   93 aa  HFQ_ALCBS RecName: Full=Protein hfq;
    1::68      3e-25  69%   81 aa  HFQ_BLOPB RecName: Full=Protein hfq;AltName: Full=Host factor-I
    8::83      4e-25  66%   84 aa  HFQ_NITEU RecName: Full=Protein hfq;
    8::75      4e-25  72%   78 aa  HFQ_JANMA RecName: Full=Protein hfq;
    8::75      4e-25  72%   78 aa  HFQ_HERAR RecName: Full=Protein hfq;
    7::69      5e-25  76%   78 aa  HFQ_BORPE RecName: Full=Protein hfq;
    7::69      5e-25  76%   78 aa  HFQ_BORPD RecName: Full=Protein hfq;
    7::69      5e-25  76%   78 aa  HFQ_BORPA RecName: Full=Protein hfq;
    7::69      5e-25  76%   78 aa  HFQ_BORBR RecName: Full=Protein hfq;
    7::69      5e-25  76%   78 aa  HFQ_BORA1 RecName: Full=Protein hfq;
    8::76      7e-25  76%   97 aa  HFQ_NEIMF RecName: Full=Protein hfq;
    8::76      7e-25  76%   97 aa  HFQ_NEIMB RecName: Full=Protein hfq;
    8::76      7e-25  76%   97 aa  HFQ_NEIMA RecName: Full=Protein hfq;
    8::76      7e-25  76%   97 aa  HFQ_NEIG1 RecName: Full=Protein hfq;
    8::82      7e-25  68%   83 aa  HFQ_DIAST RecName: Full=Protein hfq;
    8::82      7e-25  68%   83 aa  HFQ_ACISJ RecName: Full=Protein hfq;
    8::83      9e-25  66%   84 aa  HFQ_VEREI RecName: Full=Protein hfq;
    8::69      9e-25  77%   79 aa  HFQ_RALSO RecName: Full=Protein hfq;
    8::69      9e-25  77%   79 aa  HFQ_RALPJ RecName: Full=Protein hfq;
    8::69      9e-25  77%   79 aa  HFQ_RALME RecName: Full=Protein hfq;
    8::69      9e-25  77%   79 aa  HFQ_RALEJ RecName: Full=Protein hfq;
    8::71      9e-25  75%   78 aa  HFQ_DECAR RecName: Full=Protein hfq;
    8::69      9e-25  77%   79 aa  HFQ_CUPTR RecName: Full=Protein hfq;
    8::78      9e-25  72%   78 aa  HFQ_BURP8 RecName: Full=Protein hfq;
    8::83      9e-25  67%   83 aa  HFQ_ACIAC RecName: Full=Protein hfq;
    8::69      1e-24  77%   82 aa  HFQ_RHOFD RecName: Full=Protein hfq;
    8::69      1e-24  77%   83 aa  HFQ_DELAS RecName: Full=Protein hfq;
    3::85      1e-24  64%   86 aa  HFQ_CHRVO RecName: Full=Protein hfq;
    8::78      1e-24  72%   78 aa  HFQ_BURXL RecName: Full=Protein hfq;
    8::78      1e-24  72%   78 aa  HFQ_BURPP RecName: Full=Protein hfq;
    8::69      2e-24  77%   79 aa  HFQ_BURVG RecName: Full=Protein hfq;
    8::69      2e-24  77%   79 aa  HFQ_BURTA RecName: Full=Protein hfq;
    8::69      2e-24  77%   79 aa  HFQ_BURS3 RecName: Full=Protein hfq;
    8::69      2e-24  77%   79 aa  HFQ_BURPS RecName: Full=Protein hfq;
    8::69      2e-24  77%   79 aa  HFQ_BURP6 RecName: Full=Protein hfq;
    8::69      2e-24  77%   79 aa  HFQ_BURP0 RecName: Full=Protein hfq;
    8::69      2e-24  77%   79 aa  HFQ_BURMS RecName: Full=Protein hfq;
    8::69      2e-24  77%   79 aa  HFQ_BURMA RecName: Full=Protein hfq;
    8::69      2e-24  77%   79 aa  HFQ_BURM9 RecName: Full=Protein hfq;
    8::69      2e-24  77%   79 aa  HFQ_BURM7 RecName: Full=Protein hfq;
    8::69      2e-24  77%   79 aa  HFQ_BURM1 RecName: Full=Protein hfq;
    8::69      2e-24  77%   80 aa  HFQ_BURCM RecName: Full=Protein hfq;
    8::69      2e-24  77%   79 aa  HFQ_BURCJ RecName: Full=Protein hfq;
    8::69      2e-24  77%   79 aa  HFQ_BURCH RecName: Full=Protein hfq;
    8::69      2e-24  77%   79 aa  HFQ_BURCC RecName: Full=Protein hfq;
    8::69      2e-24  77%   79 aa  HFQ_BURCA RecName: Full=Protein hfq;
    8::69      2e-24  77%   80 aa  HFQ_BURA4 RecName: Full=Protein hfq;
    8::71      2e-24  73%   85 aa  HFQ_LARHH RecName: Full=Protein hfq;
    8::69      4e-24  76%   81 aa  HFQ_VARPS RecName: Full=Protein hfq;
    9::70      4e-24  76%   83 aa  HFQ_POLSJ RecName: Full=Protein hfq;
    8::69      5e-24  77%   81 aa  HFQ_METFK RecName: Full=Protein hfq;
    8::69      6e-24  76%   79 aa  HFQ_RALEH RecName: Full=Protein hfq;
    8::69      6e-24  74%   80 aa  HFQ_AZOSB RecName: Full=Protein hfq;
   12::71      8e-24  73%   89 aa  HFQ_THICR RecName: Full=Protein hfq;
    8::75      8e-24  65%   81 aa  HFQ_NITMU RecName: Full=Protein hfq;
    8::71      1e-23  70%   81 aa  HFQ_AZOSE RecName: Full=Protein hfq;
    1::68      1e-23  68%   86 aa  HFQ_BAUCH RecName: Full=Protein hfq;
    8::69      2e-23  74%   80 aa  HFQ_LEPCP RecName: Full=Protein hfq;
    8::69      2e-23  73%   80 aa  HFQ_NITEC RecName: Full=Protein hfq;
    1::81      2e-23  65%   93 aa  HFQ_HAMD5 RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::64      3e-23  67%   87 aa  HFQ_WIGBR RecName: Full=Protein hfq;AltName: Full=Host factor-I
    1::61      3e-23  75%   87 aa  HFQ_TERTT RecName: Full=Protein hfq;
    1::61      3e-23  75%   86 aa  HFQ_SACD2 RecName: Full=Protein hfq;
    1::85      3e-23  56%   85 aa  HFQ_LEGPL RecName: Full=Protein hfq;
    1::85      3e-23  56%   85 aa  HFQ_LEGPH RecName: Full=Protein hfq;
    1::85      3e-23  56%   85 aa  HFQ_LEGPC RecName: Full=Protein hfq;
    1::85      3e-23  56%   85 aa  HFQ_LEGPA RecName: Full=Protein hfq;
    1::59      1e-22  76%  102 aa  HFQ_PHOLL RecName: Full=Protein hfq;AltName: Full=Host factor-I
    4::72      8e-18  53%   78 aa  HFQ_OCHA4 RecName: Full=Protein hfq;
    4::72      8e-18  53%   78 aa  HFQ_BRUSU RecName: Full=Protein hfq;
    4::72      8e-18  53%   78 aa  HFQ_BRUSI RecName: Full=Protein hfq;
    4::72      8e-18  53%   78 aa  HFQ_BRUO2 RecName: Full=Protein hfq;
    4::72      8e-18  53%   78 aa  HFQ_BRUME RecName: Full=Protein hfq;
    4::72      8e-18  53%   78 aa  HFQ_BRUMB RecName: Full=Protein hfq;
    4::72      8e-18  53%   78 aa  HFQ_BRUC2 RecName: Full=Protein hfq;
    4::72      8e-18  53%   78 aa  HFQ_BRUAB RecName: Full=Protein hfq;
    4::72      8e-18  53%   78 aa  HFQ_BRUA2 RecName: Full=Protein hfq;
    4::72      8e-18  53%   78 aa  HFQ_BRUA1 RecName: Full=Protein hfq;
    2::72      1e-17  53%   79 aa  HFQ_BARHE RecName: Full=Protein hfq;
    8::71      1e-17  61%   80 aa  HFQ_THIDA RecName: Full=Protein hfq;
    4::72      1e-17  54%   79 aa  HFQ_BART1 RecName: Full=Protein hfq;
    4::72      1e-17  54%   79 aa  HFQ_BARQU RecName: Full=Protein hfq;
    4::75      2e-17  51%   80 aa  HFQ_RHILW RecName: Full=Protein hfq;
    4::75      2e-17  51%   80 aa  HFQ_RHIL3 RecName: Full=Protein hfq;
    4::75      2e-17  51%   80 aa  HFQ_RHIEC RecName: Full=Protein hfq;
    4::75      2e-17  51%   80 aa  HFQ_RHIE6 RecName: Full=Protein hfq;
    5::76      2e-17  55%   83 aa  HFQ_METSB RecName: Full=Protein hfq;
    1::71      2e-17  51%   83 aa  HFQ_LEPBP RecName: Full=Protein hfq;
    1::71      2e-17  51%   83 aa  HFQ_LEPBA RecName: Full=Protein hfq;
    8::73      2e-17  57%   82 aa  HFQ_CAUSK RecName: Full=Protein hfq;
    8::73      2e-17  57%   82 aa  HFQ_CAUCR RecName: Full=Protein hfq;
    8::73      2e-17  57%   82 aa  HFQ_CAUCN RecName: Full=Protein hfq;
    4::75      2e-17  51%   80 aa  HFQ_AGRT5 RecName: Full=Protein hfq;
    4::75      2e-17  51%   80 aa  HFQ_AGRRK RecName: Full=Protein hfq;
    4::72      2e-17  51%   80 aa  HFQ_SINMW RecName: Full=Protein hfq;
    4::72      2e-17  51%   80 aa  HFQ_RHISN RecName: Full=Protein hfq;
    4::72      2e-17  51%   80 aa  HFQ_RHIME RecName: Full=Protein hfq;
    3::73      3e-17  54%   84 aa  HFQ_BEII9 RecName: Full=Protein hfq;
    7::72      4e-17  55%   79 aa  HFQ_SILST RecName: Full=Protein hfq;
    7::72      4e-17  55%   79 aa  HFQ_SILPO RecName: Full=Protein hfq;
    7::72      4e-17  57%   82 aa  HFQ_PARL1 RecName: Full=Protein hfq;
    5::73      5e-17  54%   84 aa  HFQ_METS4 RecName: Full=Protein hfq;
    5::73      5e-17  54%   83 aa  HFQ_METRJ RecName: Full=Protein hfq;
    5::73      5e-17  54%   84 aa  HFQ_METPB RecName: Full=Protein hfq;
    5::73      5e-17  54%   84 aa  HFQ_METNO RecName: Full=Protein hfq;
    5::73      5e-17  54%   84 aa  HFQ_METEP RecName: Full=Protein hfq;
    5::73      5e-17  54%   84 aa  HFQ_METC4 RecName: Full=Protein hfq;
    8::73      5e-17  57%   90 aa  HFQ_MARMM RecName: Full=Protein hfq;
    7::72      5e-17  54%   77 aa  HFQ_JANSC RecName: Full=Protein hfq;
    7::72      9e-17  54%   79 aa  HFQ_ROSDO RecName: Full=Protein hfq;
    7::72      9e-17  54%   77 aa  HFQ_RHOS5 RecName: Full=Protein hfq;
    7::72      9e-17  54%   77 aa  HFQ_RHOS4 RecName: Full=Protein hfq;
    7::72      9e-17  54%   77 aa  HFQ_RHOS1 RecName: Full=Protein hfq;
    4::72      1e-16  53%   81 aa  HFQ_RHILO RecName: Full=Protein hfq;
    5::73      1e-16  54%   85 aa  HFQ_AZOC5 RecName: Full=Protein hfq;AltName: Full=Nif-regulating
    7::72      2e-16  54%   77 aa  HFQ_PARDP RecName: Full=Protein hfq;
    1::81      2e-16  48%   85 aa  HFQ_LEPIN RecName: Full=Protein hfq;
    1::81      2e-16  48%   85 aa  HFQ_LEPIC RecName: Full=Protein hfq;
    8::74      2e-16  58%   82 aa  HFQ_HYPNA RecName: Full=Protein hfq;
    5::76      3e-16  52%   82 aa  HFQ_RHOPT RecName: Full=Protein hfq;
    5::76      3e-16  52%   82 aa  HFQ_RHOPA RecName: Full=Protein hfq;
    3::73      3e-16  51%   82 aa  HFQ_NITWN RecName: Full=Protein hfq;
    3::73      3e-16  51%   82 aa  HFQ_NITHX RecName: Full=Protein hfq;
    5::73      4e-16  53%   82 aa  HFQ_RHOPS RecName: Full=Protein hfq;
    5::73      4e-16  53%   82 aa  HFQ_RHOPB RecName: Full=Protein hfq;
    5::73      4e-16  53%   82 aa  HFQ_RHOP5 RecName: Full=Protein hfq;
    5::73      4e-16  53%   82 aa  HFQ_RHOP2 RecName: Full=Protein hfq;
    4::72      4e-16  51%   82 aa  HFQ_MESSB RecName: Full=Protein hfq;
    1::71      4e-16  50%   82 aa  HFQ_LEPBL RecName: Full=Protein hfq;
    1::71      4e-16  50%   82 aa  HFQ_LEPBJ RecName: Full=Protein hfq;
    7::80      4e-16  53%   83 aa  HFQ_DESAP RecName: Full=Protein hfq;
    5::73      4e-16  53%   82 aa  HFQ_BRASO RecName: Full=Protein hfq;
    5::73      4e-16  53%   82 aa  HFQ_BRASB RecName: Full=Protein hfq;
    5::73      4e-16  53%   82 aa  HFQ_BRAJA RecName: Full=Protein hfq;
    2::72      4e-16  49%   79 aa  HFQ_BARBK RecName: Full=Protein hfq;
    5::73      5e-16  53%   82 aa  HFQ_OLICO RecName: Full=Protein hfq;
    7::83      6e-16  50%   83 aa  HFQ_DESHD RecName: Full=Protein hfq;
    7::75      6e-16  53%   80 aa  HFQ_CLOCE RecName: Full=Protein hfq;
    7::79      1e-15  49%   80 aa  HFQ_DESRM RecName: Full=Protein hfq;
    7::76      1e-15  51%   83 aa  HFQ_DESHY RecName: Full=Protein hfq;
    1::77      1e-15  47%   79 aa  HFQ_BREBN RecName: Full=Protein hfq;
    5::73      2e-15  53%   83 aa  HFQ_RHORT RecName: Full=Protein hfq;
    5::70      2e-15  54%   80 aa  HFQ_CLOPS RecName: Full=Protein hfq;
    5::70      2e-15  54%   80 aa  HFQ_CLOPE RecName: Full=Protein hfq;
    5::70      2e-15  54%   80 aa  HFQ_CLOP1 RecName: Full=Protein hfq;
    5::71      2e-15  53%   80 aa  HFQ_AQUAE RecName: Full=Protein hfq;
    7::71      2e-15  51%   92 aa  HFQ_ANATD RecName: Full=Protein hfq;
    7::75      2e-15  51%   83 aa  HFQ_PELTS RecName: Full=Protein hfq;
    1::71      2e-15  49%   77 aa  HFQ_BACSK RecName: Full=Protein hfq;
    7::70      3e-15  52%   85 aa  HFQ_CARHZ RecName: Full=Protein hfq;
    7::84      4e-15  43%   84 aa  HFQ_NATTJ RecName: Full=Protein hfq;
    6::75      4e-15  49%   80 aa  HFQ_ALKMQ RecName: Full=Protein hfq;
    9::73      5e-15  57%   86 aa  HFQ_THETN RecName: Full=Protein hfq;
    9::73      5e-15  57%   86 aa  HFQ_THEPX RecName: Full=Protein hfq;
    9::73      5e-15  57%   86 aa  HFQ_THEP3 RecName: Full=Protein hfq;
    7::73      5e-15  47%   82 aa  HFQ_SYNWW RecName: Full=Protein hfq;
    5::84      5e-15  49%   85 aa  HFQ_CLOBM RecName: Full=Protein hfq;
    5::84      5e-15  49%   85 aa  HFQ_CLOBL RecName: Full=Protein hfq;
    5::84      5e-15  49%   85 aa  HFQ_CLOBK RecName: Full=Protein hfq;
    5::84      5e-15  49%   85 aa  HFQ_CLOBJ RecName: Full=Protein hfq;
    5::84      5e-15  49%   85 aa  HFQ_CLOBH RecName: Full=Protein hfq;
    5::84      5e-15  49%   85 aa  HFQ_CLOB6 RecName: Full=Protein hfq;
    5::84      5e-15  49%   85 aa  HFQ_CLOB1 RecName: Full=Protein hfq;
    8::71      5e-15  46%  106 aa  HFQ_ACIC5 RecName: Full=Protein hfq;
    7::76      7e-15  51%   84 aa  HFQ_MOOTA RecName: Full=Protein hfq;
    5::70      7e-15  49%   73 aa  HFQ_BACSU RecName: Full=Protein hfq;
    8::84      9e-15  49%   84 aa  HFQ_MAGSA RecName: Full=Protein hfq;
    6::71      9e-15  51%   78 aa  HFQ_BACHD RecName: Full=Protein hfq;
    1::71      1e-14  47%   74 aa  HFQ_ANOFW RecName: Full=Protein hfq;
    1::72      1e-14  49%   91 aa  HFQ_THELT RecName: Full=Protein hfq;
    8::73      1e-14  51%   93 aa  HFQ_GRABC RecName: Full=Protein hfq;
    5::70      1e-14  48%   73 aa  HFQ_BACLD RecName: Full=Protein hfq;
    1::85      2e-14  44%   86 aa  HFQ_THEM4 RecName: Full=Protein hfq;
    8::71      2e-14  54%   98 aa  HFQ_GLUDA RecName: Full=Protein hfq;
    5::73      2e-14  46%   86 aa  HFQ_CLOD6 RecName: Full=Protein hfq;
    1::69      2e-14  49%   74 aa  HFQ_BACWK RecName: Full=Protein hfq;
    1::69      2e-14  49%   74 aa  HFQ_BACHK RecName: Full=Protein hfq;
    1::69      2e-14  49%   74 aa  HFQ_BACCZ RecName: Full=Protein hfq;
    1::69      2e-14  49%   74 aa  HFQ_BACCR RecName: Full=Protein hfq;
    1::69      2e-14  49%   74 aa  HFQ_BACCQ RecName: Full=Protein hfq;
    1::69      2e-14  49%   74 aa  HFQ_BACC7 RecName: Full=Protein hfq;
    1::69      2e-14  49%   74 aa  HFQ_BACC4 RecName: Full=Protein hfq;
    1::69      2e-14  49%   74 aa  HFQ_BACC3 RecName: Full=Protein hfq;
    1::69      2e-14  49%   74 aa  HFQ_BACC2 RecName: Full=Protein hfq;
    1::69      2e-14  49%   74 aa  HFQ_BACC1 RecName: Full=Protein hfq;
    1::69      2e-14  49%   74 aa  HFQ_BACC0 RecName: Full=Protein hfq;
    1::69      2e-14  49%   74 aa  HFQ_BACAN RecName: Full=Protein hfq;
    1::69      2e-14  49%   74 aa  HFQ_BACAH RecName: Full=Protein hfq;
    1::69      2e-14  49%   74 aa  HFQ_BACAC RecName: Full=Protein hfq;
    1::69      2e-14  49%   74 aa  HFQ_BACAA RecName: Full=Protein hfq;
    5::70      3e-14  48%   73 aa  HFQ_BACA2 RecName: Full=Protein hfq;
    7::73      3e-14  48%   88 aa  HFQ_FERNB RecName: Full=Protein hfq;
    5::70      3e-14  48%   73 aa  HFQ_BACP2 RecName: Full=Protein hfq;
    1::87      4e-14  42%   90 aa  HFQ_THESQ RecName: Full=Protein hfq;
    1::69      4e-14  47%   74 aa  HFQ_BACCN RecName: Full=Protein hfq;
    1::71      6e-14  47%   84 aa  HFQ_THEAB RecName: Full=Protein hfq;
    1::70      6e-14  46%   74 aa  HFQ_GEOSW RecName: Full=Protein hfq;
    1::69      7e-14  44%   75 aa  HFQ_GEOKA RecName: Full=Protein hfq;
    6::70      7e-14  48%   77 aa  HFQ_CLONN RecName: Full=Protein hfq;
    6::73      7e-14  49%   77 aa  HFQ_CLOBA RecName: Full=Protein hfq;
    7::71      7e-14  45%   81 aa  HFQ_CLOAB RecName: Full=Protein hfq;
    1::71      1e-13  44%   74 aa  HFQ_OCEIH RecName: Full=Protein hfq;
    1::80      1e-13  42%   83 aa  HFQ_EXIS2 RecName: Full=Protein hfq;
    6::70      1e-13  50%   82 aa  HFQ_CLOK5 RecName: Full=Protein hfq;
    6::70      1e-13  50%   82 aa  HFQ_CLOK1 RecName: Full=Protein hfq;
    7::71      1e-13  50%   81 aa  HFQ_CLOB8 RecName: Full=Protein hfq;
    6::90      1e-13  40%   90 aa  HFQ_SYMTH RecName: Full=Protein hfq;
    6::69      1e-13  51%   80 aa  HFQ_ALKOO RecName: Full=Protein hfq;
    1::72      2e-13  45%   90 aa  HFQ_THEP1 RecName: Full=Protein hfq;
    8::74      2e-13  47%   92 aa  HFQ_THEMA RecName: Full=Protein hfq;
    6::71      4e-13  45%   82 aa  HFQ_EXISA RecName: Full=Protein hfq;
    6::73      5e-13  45%   77 aa  HFQ_CLOBB RecName: Full=Protein hfq;
   17::71      7e-12  49%   99 aa  HFQ_CALS8 RecName: Full=Protein hfq;
    1::109

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSRISSLQDPFLNALRKEKVNVSVYLVNGIKLQGQVEAFDQFCIVLRNTVNQMVYKHAISTIVPAKSVRM
HFQ_FRATM       MSRISSLQDPFLNALRKEKVNVSVYLVNGIKLQGQVEAFDQFCIVLRNTVNQMVYKHAISTIVPAKSVRM
HFQ_FRATW       MSRISSLQDPFLNALRKEKVSVSVYLVNGIKLQGQVEAFDQFCIVLRNTVNQMVYKHAISTIVPAKSVRM
HFQ_FRATO       MSRISSLQDPFLNALRKEKVSVSVYLVNGIKLQGQVEAFDQFCIVLRNTVNQMVYKHAISTIVPAKSVRM
HFQ_FRATN       MSRISSLQDPFLNALRKEKVSVSVYLVNGIKLQGQVEAFDQFCIVLRNTVNQMVYKHAISTIVPAKSVRM
HFQ_FRATH       MSRISSLQDPFLNALRKEKVSVSVYLVNGIKLQGQVEAFDQFCIVLRNTVNQMVYKHAISTIVPAKSVRM
HFQ_FRATF       MSRISSLQDPFLNALRKEKVSVSVYLVNGIKLQGQVEAFDQFCIVLRNTVNQMVYKHAISTIVPAKSVRM
HFQ_FRATT       MSRISSLQDPFLNALRKEKVSVSVYLVNGIKLQGQVEAFDQFCIVLRNTVNQMVYKHAISTIVPAKSVRM
HFQ_FRAT1       MSRISSLQDPFLNALRKEKVSVSVYLVNGIKLQGQVEAFDQFCIVLRNTVNQMVYKHAISTIVPAKSVRM
HFQ_FRAP2       MSRISSLQDPFLNALRKEKVSVSVYLVNGIKLQGQVEAFDQFCIVLRNTVNQMVYKHAISTIVPAKSVRM
HFQ_HAEIN       MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARSV--
HFQ_ALHEH       MAKGQSLQEPFLNALRKEKVPVSIYLVNGIKLQGQIESFDQFVILLRNNVNQMVYKHAISTVVPARNVRT
HFQ_VIBFM       MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARAVSH
HFQ_VIBF1       MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARAVSH
HFQ_XANCP       MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVRV
HFQ_XANCB       MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVRV
HFQ_XANC8       MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVRV
HFQ_XANOR       MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVRV
HFQ_XANOM       MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVRV
HFQ_XANC5       MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVRV
HFQ_XANAC       MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVRV
HFQ_PHOPR       MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARPVNH
HFQ_XYLFA       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVRV
HFQ_NITOC       MSRGQSLQDPFLNALRKERVPVSIYLVNGIKLQGQIESFDQFVVLLKNSVSQMVYKHAISTVVPARNVKL
HFQ_VIBSL       MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARAV--
HFQ_HALHL       MAKGQSLQEPFLNTLRKEKVPVSIYLVNGIKLQGQIESFDQFVVLLRNNVNQMVYKHAISTIVPARRVRL
HFQ_ALTMD       MAKGQSLQDPFLNALRKERIPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPARAITM
HFQ_SHESH       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPARPFNV
HFQ_PSEE4       MSKGHSLQDPYLNTLRKEKVPVSIYLVNGIKLQGQIESFDQFVVLLKNTVSQMVYKHAISTVVPARPVRL
HFQ_ALISL       MAKGQSLQDPFLNALRCERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARAVSH
HFQ_XYLFT       MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVRV
HFQ_XYLFM       MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVRV
HFQ_XYLF2       MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVRV
HFQ_PASMU       MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARSV--
HFQ_MARAV       MSKGHSLQDPYLNALRKERIPVSIFLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPARNVRL
HFQ_MANSM       MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARSV--
HFQ_HAHCH       MSKGQSLQDPYLNALRKERIPVSIFLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPARNVRI
HFQ_HAEIG       MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARSV--
HFQ_HAEIE       MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARSV--
HFQ_HAEI8       MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARSV--
HFQ_ACTSZ       MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARSV--
HFQ_STRMK       MSKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVKV
HFQ_STRM5       MSKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVKV
HFQ_PSEU5       MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPGRPVRL
HFQ_VIBVY       MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARPV--
HFQ_VIBVU       MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARPV--
HFQ_VIBPA       MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARPV--
HFQ_VIBHB       MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARPV--
HFQ_VIBCM       MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARPV--
HFQ_VIBCH       MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARPV--
HFQ_VIBC3       MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARPV--
HFQ_SHELP       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPAR----
HFQ_SHEHH       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPFNV
HFQ_SHEAM       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPFNV
HFQ_PSEA6       MAKGQSLQDPFLNALRKERIPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRALPV
HFQ_CELJU       MSKGHSLQDPYLNVLRKERVPVSIYLVNGIKLQGQVESFDQFVVLLKNTVSQMVYKHAISTVVPSRAVRV
HFQ_AZOVD       MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRL
HFQ_YEREN       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPVS-
HFQ_YERE8       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPVS-
HFQ_SERP5       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVS-
HFQ_SALAR       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVNA
HFQ_PSEPW       MSKGHSLQDPYLNTLRKEKVPVSIYLVNGIKLQGSIESFDQFVVLLKNTVSQMVYKHAISTVVPARPVRL
HFQ_PSEPK       MSKGHSLQDPYLNTLRKEKVPVSIYLVNGIKLQGSIESFDQFVVLLKNTVSQMVYKHAISTVVPARPVRL
HFQ_PSEPG       MSKGHSLQDPYLNTLRKEKVPVSIYLVNGIKLQGSIESFDQFVVLLKNTVSQMVYKHAISTVVPARPVRL
HFQ_PSEP1       MSKGHSLQDPYLNTLRKEKVPVSIYLVNGIKLQGSIESFDQFVVLLKNTVSQMVYKHAISTVVPARPVRL
HFQ_PSEMY       MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRL
HFQ_PSEAE       MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRL
HFQ_PSEAB       MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRL
HFQ_PSEA8       MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRL
HFQ_PSEA7       MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRL
HFQ_PECCP       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVS-
HFQ_CHRSD       MSKGQSLQDPYLNILRKERIPVSIFLVNGIKLQGQIESFDQFVILLRNTVSQMVYKHAISTVVPSRNVRL
HFQ_SHEDO       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPARALHI
HFQ_AERS4       MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPARAV--
HFQ_AERHH       MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPARAV--
HFQ_ACTPJ       MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPARSV--
HFQ_ACTP7       MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPARSV--
HFQ_ACTP2       MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPARSV--
HFQ_TOLAT       MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPARPV--
HFQ_PSEHT       MAKGQSLQDPFLNALRRERIPVSIFLVNGIKLQGKIQSFDQFVILLENTVNQMVYKHAISTVVPARAV--
HFQ_PSEF5       MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAISTVVPVRPIRL
HFQ_HAEDU       MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFIILLKNTVSQMVYKHAISTVVPARSI--
HFQ_ECOLU       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVNA
HFQ_YERPY       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPVNT
HFQ_YERPS       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPVNT
HFQ_YERPN       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPVNT
HFQ_YERPG       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPVNT
HFQ_YERPE       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPVNT
HFQ_YERPB       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPVNT
HFQ_YERPA       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPVNT
HFQ_YERP3       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPVNT
HFQ_SHEWM       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPARNVSA
HFQ_SHEPW       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPFNV
HFQ_PSEU2       MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAISTVVPVRPIRL
HFQ_PSESM       MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAISTVVPVRPIRL
HFQ_PSEPF       MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAISTVVPVRPIRL
HFQ_PSEFS       MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAISTVVPVRPIRL
HFQ_PSE14       MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAISTVVPVRPIRL
HFQ_SHESW       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPAR----
HFQ_SHESR       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPAR----
HFQ_SHESM       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPAR----
HFQ_SHESA       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPAR----
HFQ_SHEPC       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPAR----
HFQ_SHEON       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPAR----
HFQ_SHEFN       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPAR----
HFQ_SHEB9       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPAR----
HFQ_SHEB8       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPAR----
HFQ_SHEB5       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPAR----
HFQ_SHEB2       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPAR----
HFQ_PSYIN       MAKGQSLQDPFLNALRKEHIPVAIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPARAIAA
HFQ_PROMH       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_METCA       MSKGQNLQDPFLNTLRKEHVPVSIYLVNGIKLQGKVDSFDQYVIMLKNTVSQMVYKHAISTIVPGRPVRV
HFQ_MARMS       MSKGQSLQDPYLNILRKERVPVSIFLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRTIRI
HFQ_HAES2       MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPAR----
HFQ_HAES1       MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPAR----
HFQ_SODGM       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_SHISS       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_SHIFL       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_SHIF8       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_SHIDS       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_SHIBS       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_SHIB3       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_SHEPA       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPFNV
HFQ_SALTY       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_SALTI       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_SALSV       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_SALPK       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_SALPC       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_SALPB       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_SALPA       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_SALNS       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_SALG2       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_SALEP       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_SALDC       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_SALCH       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_SALA4       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_KLEP7       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_KLEP3       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ESCF3       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ERWT9       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ERWCT       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ENTS8       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ENT38       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ECOUT       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ECOSM       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ECOSE       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ECOLI       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ECOLC       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ECOL6       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ECOL5       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ECOK1       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ECOHS       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ECODH       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ECOBW       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ECO8A       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ECO81       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ECO7I       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ECO5E       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ECO57       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ECO55       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ECO45       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ECO27       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_ECO24       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_CITK8       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_YERPP       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSPPVNT
HFQ_THISH       MSKGQTLQEPFLNALRKERIPVSIYLVNGIKLQGQIDSFDQFVVLLKNTVSQMVYKHAISTIVPSRPVKL
HFQ_DICNV       MSKSQSLQDPYLNALRKERVPVSIYLVNGIKLQGQIESFDAFVILLRNNISQMVYKHAVSTIVPSRNIHL
HFQ_SALHS       MAKGQSLQDPFVNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_PECCC       MVKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPV--
HFQ_HAEPS       MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPAR----
HFQ_COLP3       MAKGQSLQDPFLNALRRDRIPVAIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRAV--
HFQ_IDILO       MAKGQTLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVVLLKNTVSQMVYKHAISTVVPAR----
HFQ_ALCBS       MSKGHSLQDPFLNALRKERIPVSIFLVNGIKLQGQIESFDQYVVLLKNAVSQMVYKHAISTVVPARNPR-
HFQ_BLOPB       MHKVQSLQDPFLNVLRRERVPVFIYLINGIKLQGEIESFDKFVILLRNTVNQMIYKHAISTIVPSRVV--
HFQ_NITEU       ------LQDPFLNILRKERIPVSIYLVNGIKLQGQIDSFDQYVVLLKNSVTQMVYKHAISTIVPAKAISI
HFQ_JANMA       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGHIESFDQYVVLLRNTVTQMVYKHAISTVVPARAVNL
HFQ_HERAR       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGHIESFDQYVVLLRNTVTQMVYKHAISTVVPARAVNL
HFQ_BORPE       -----TLQDPFLNTLRKEHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAISTVVPARAV--
HFQ_BORPD       -----TLQDPFLNTLRKEHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAISTVVPARAV--
HFQ_BORPA       -----TLQDPFLNTLRKEHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAISTVVPARAV--
HFQ_BORBR       -----TLQDPFLNTLRKEHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAISTVVPARAV--
HFQ_BORA1       -----TLQDPFLNTLRKEHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAISTVVPARAV--
HFQ_NEIMF       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGQVESFDQYVVLLRNTVTQMVYKHAISTIVPARSVNL
HFQ_NEIMB       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGQVESFDQYVVLLRNTVTQMVYKHAISTIVPARSVNL
HFQ_NEIMA       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGQVESFDQYVVLLRNTVTQMVYKHAISTIVPARSVNL
HFQ_NEIG1       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGQVESFDQYVVLLRNTVTQMVYKHAISTIVPARSVNL
HFQ_DIAST       ------LQDPFLNALRREHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAISTIVPGRAVN-
HFQ_ACISJ       ------LQDPFLNALRREHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAISTIVPGRAVN-
HFQ_VEREI       ------LQEPFLNTLRREHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVFKHAISTIVPGRAVH-
HFQ_RALSO       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARAV--
HFQ_RALPJ       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARAV--
HFQ_RALME       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARAV--
HFQ_RALEJ       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARAV--
HFQ_DECAR       ------LQDPFLNALRREHVPVSIYLVNGIKLQGQVESFDQYVVLLKNTVTQMVYKHAISTVVPARPVNL
HFQ_CUPTR       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARAV--
HFQ_BURP8       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARPV--
HFQ_ACIAC       ------LQDPFLNALRREHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAISTIVPGRAVN-
HFQ_RHOFD       ------LQDPFLNALRREHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAISTIVPGRAV--
HFQ_DELAS       ------LQDPFLNALRREHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAISTIVPGRAV--
HFQ_CHRVO       -SKGQMLQDPFLNILRKEHVPVSIYLVNGIKLQGQVESFDQYVVLLKNTVTQMVYKHAISTVVPARPV--
HFQ_BURXL       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARPV--
HFQ_BURPP       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARPV--
HFQ_BURVG       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARPV--
HFQ_BURTA       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARPV--
HFQ_BURS3       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARPV--
HFQ_BURPS       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARPV--
HFQ_BURP6       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARPV--
HFQ_BURP0       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARPV--
HFQ_BURMS       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARPV--
HFQ_BURMA       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARPV--
HFQ_BURM9       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARPV--
HFQ_BURM7       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARPV--
HFQ_BURM1       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARPV--
HFQ_BURCM       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARPV--
HFQ_BURCJ       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARPV--
HFQ_BURCH       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARPV--
HFQ_BURCC       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARPV--
HFQ_BURCA       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARPV--
HFQ_BURA4       ------LQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARPV--
HFQ_LARHH       ------LQDPFLNILRKEHVPVSIYLVNGIKLQGQIESFDQYVVLLKNTVTQMVYKHAISTVVPARPVQV
HFQ_VARPS       ------LQDPFLNTLRREHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAISTIVPGRAV--
HFQ_POLSJ       ------LQDPFLNTLRREHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAISTIVPGRAV--
HFQ_METFK       ------LQDPFLNTLRKEHVPVSIYLVNGIKLQGQVDSFDQYVILLKNTVTQMVYKHAISTIVPGRAV--
HFQ_RALEH       ------LQGPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAISTVVPARAV--
HFQ_AZOSB       ------LQDPFLNTLRREHVPVSIYLVNGIKLQGQIESFDQYVVLLKNTVTQMVYKHAISTVVPARPV--
HFQ_THICR       ------IQDPYLNALRKEKINVAIYLVNGVKLQGRVDSFDQFVVLLRSNVTQMVYKHAISTIVPAR----
HFQ_NITMU       ------LQDPFLNTLRKEHIPVSIYLVNGIKLQGHIDSFDQYVVLLKNTVTQMVYKHAISTVVPARAVNI
HFQ_AZOSE       ------LQDPFLNTLRREHVPVAIYLVNGIKLQGQIESFDQYVVLLKNTVTQMVYKHAISTVVPARPVNI
HFQ_BAUCH       MAQGQSLQDIFLNVLRRERIQVSIYLFNGIKLQGHIESFDQFVIVLKNTISQMVYKHAVSTIVPSKFV--
HFQ_LEPCP       ------LQDPFLNLLRKEHVPVSIYLVNGIKLQGHIESFDQYVVLLRNTVTQMVYKHAISTVVPGRPV--
HFQ_NITEC       ------LQDPFLNVLRKEHIPVSIYLVNGIKLQGHIDSFDQYVVLLRNSVTQMVYKHAISTIVPGKAV--
HFQ_HAMD5       MAKGQSLQDPFLNALRKERIPVSIYLINGIKLQGQIESFDQFVILLKNTICQVIYKHAVSTVVPSRAV--
HFQ_WIGBR       MAKGQSLQDPFLNTLRRERIPVSIYLVNGIKLQGYIESFDQFVILLKNSISQMIYKHAISTVVP------
HFQ_TERTT       MSKGHSLQDPYLNVLRKERIPVSIYLVNGIKLQGQVESFDQFVVLLKNTVSQMVYKHAIST---------
HFQ_SACD2       MSKGHSLQDPYLNVLRKERIPVSIYLVNGIKLQGQVESFDQFVVLLKNTVSQMVYKHAIST---------
HFQ_LEGPL       MSKNHLLQDPFLNELRKEKVPVSVFLVNGIKLHGIIDSFDQYVVMLKNSITQMVYKHAISTVVPSRMVKI
HFQ_LEGPH       MSKNHLLQDPFLNELRKEKVPVSVFLVNGIKLHGIIDSFDQYVVMLKNSITQMVYKHAISTVVPSRMVKI
HFQ_LEGPC       MSKNHLLQDPFLNELRKEKVPVSVFLVNGIKLHGIIDSFDQYVVMLKNSITQMVYKHAISTVVPSRMVKI
HFQ_LEGPA       MSKNHLLQDPFLNELRKEKVPVSVFLVNGIKLHGIIDSFDQYVVMLKNSITQMVYKHAISTVVPSRMVKI
HFQ_PHOLL       MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAI-----------
HFQ_OCHA4       --RSQNLQDLFLNSVRKQKISLTIFLINGVKLTGIVTSFDNFCVLLRDGHSQLVYKHAISTIMPSQPVQM
HFQ_BRUSU       --RSQNLQDLFLNSVRKQKISLTIFLINGVKLTGIVTSFDNFCVLLRDGHSQLVYKHAISTIMPSQPVQM
HFQ_BRUSI       --RSQNLQDLFLNSVRKQKISLTIFLINGVKLTGIVTSFDNFCVLLRDGHSQLVYKHAISTIMPSQPVQM
HFQ_BRUO2       --RSQNLQDLFLNSVRKQKISLTIFLINGVKLTGIVTSFDNFCVLLRDGHSQLVYKHAISTIMPSQPVQM
HFQ_BRUME       --RSQNLQDLFLNSVRKQKISLTIFLINGVKLTGIVTSFDNFCVLLRDGHSQLVYKHAISTIMPSQPVQM
HFQ_BRUMB       --RSQNLQDLFLNSVRKQKISLTIFLINGVKLTGIVTSFDNFCVLLRDGHSQLVYKHAISTIMPSQPVQM
HFQ_BRUC2       --RSQNLQDLFLNSVRKQKISLTIFLINGVKLTGIVTSFDNFCVLLRDGHSQLVYKHAISTIMPSQPVQM
HFQ_BRUAB       --RSQNLQDLFLNSVRKQKISLTIFLINGVKLTGIVTSFDNFCVLLRDGHSQLVYKHAISTIMPSQPVQM
HFQ_BRUA2       --RSQNLQDLFLNSVRKQKISLTIFLINGVKLTGIVTSFDNFCVLLRDGHSQLVYKHAISTIMPSQPVQM
HFQ_BRUA1       --RSQNLQDLFLNSVRKQKISLTIFLINGVKLTGIVTSFDNFCVLLRDGHSQLVYKHAISTIMPSQPVQM
HFQ_BARHE       VERSQHLQDVFLNTVRKQKISLTIFLVNGVKLTGIVTSFDNFCVLLRRDGHQLVYKHAISTIMPGQPVQM
HFQ_THIDA       ------LQDVFLNTLRKERIPVSVFLVNGIKLMGRIESFDQFVVLLKDQAAQMIFKHAISTISPSREV--
HFQ_BART1       --RSQHLQDVFLNTVRKQKISLTIFLVNGVKLTGIVTSFDSFCVLLRRDGHQLVYKHAISTIMPGQPVQM
HFQ_BARQU       --RSQHLQDVFLNTVRKQKISLTIFLVNGVKLTGIVTSFDNFCVLLRRDGHQLVYKHAISTIMPGQPVQM
HFQ_RHILW       --RSQNLQDLFLNTVRKQKISLTIFLINGVKLTGVVTSFDNFCVLLRDGHSQLVYKHAISTIMPGQPMQM
HFQ_RHIL3       --RSQNLQDLFLNTVRKQKISLTIFLINGVKLTGVVTSFDNFCVLLRDGHSQLVYKHAISTIMPGQPMQM
HFQ_RHIEC       --RSQNLQDLFLNTVRKQKISLTIFLINGVKLTGVVTSFDNFCVLLRDGHSQLVYKHAISTIMPGQPMQM
HFQ_RHIE6       --RSQNLQDLFLNTVRKQKISLTIFLINGVKLTGVVTSFDNFCVLLRDGHSQLVYKHAISTIMPGQPMQM
HFQ_METSB       --RPQNLQDTFLNFVRKNKVPLTIFLVNGVKLQGVVTWFDNFCVLLRDGHSQLVYKHAISTIMPGQPIQM
HFQ_LEPBP       MSAKNNIQDQLLNTARKEKIDLTIYLLNGVPLKGKVVSFDNFTIILENENKQLVYKHAISTIIPAKPIKL
HFQ_LEPBA       MSAKNNIQDQLLNTARKEKIDLTIYLLNGVPLKGKVVSFDNFTIILENENKQLVYKHAISTIIPAKPIKL
HFQ_CAUSK       -----NLQDTFLNSVRKSKTPLTIFLVNGVKLQGVVSWFDNFCVLLRDGQSQLVYKHAISTIMPAQPVQL
HFQ_CAUCR       -----NLQDTFLNSVRKSKTPLTIFLVNGVKLQGVVSWFDNFCVLLRDGQSQLVYKHAISTIMPAQPVQL
HFQ_CAUCN       -----NLQDTFLNSVRKSKTPLTIFLVNGVKLQGVVSWFDNFCVLLRDGQSQLVYKHAISTIMPAQPVQL
HFQ_AGRT5       --RSQNLQDLFLNTVRKQKISLTIFLINGVKLTGVVTSFDNFCVLLRDGHSQLVYKHAISTIMPGQPMQM
HFQ_AGRRK       --RSQNLQDLFLNTVRKQKISLTIFLINGVKLTGVVTSFDNFCVLLRDGHSQLVYKHAISTIMPGQPMQM
HFQ_SINMW       --RSQNLQDLFLNTVRKQKISLTIFLINGVKLTGVVTSFDNFCVLLRDGHSQLVYKHAISTIMPGQPLQM
HFQ_RHISN       --RSQNLQDLFLNTVRKQKISLTIFLINGVKLTGVVTSFDNFCVLLRDGHSQLVYKHAISTIMPGQPLQM
HFQ_RHIME       --RSQNLQDLFLNTVRKQKISLTIFLINGVKLTGVVTSFDNFCVLLRDGHSQLVYKHAISTIMPGQPLQM
HFQ_BEII9       VDRPQNLQDTFLNFVRKNKVPLTIFLVNGVKLQGVVTWFDNFCVLLRDGHSQLVYKHAISTIMPGAPIQM
HFQ_SILST       -----NLQDAFLNHVRKTKVPVTIFLINGVKLQGVITWFDNFCVLLRDGQSQLVYKHAISTIMPAQPISL
HFQ_SILPO       -----NLQDAFLNHVRKTKVPVTIFLINGVKLQGVITWFDNFCVLLRDGQSQLVYKHAISTIMPAQPISL
HFQ_PARL1       -----NLQDTFLNHVRKNKTTLTIFLVNGVKLQGVVTWFDNFCVLLRDGHSQLVYKHAISTIMPAQPVQL
HFQ_METS4       --RAQNLQDTFLNHVRKNKIPLTIFLVNGVKLQGVVTWFDNFCVLLRDGHSQLVYKHAISTIMPGHPVQL
HFQ_METRJ       --RAQNLQDTFLNHVRKNKIPLTIFLVNGVKLQGVVTWFDNFCVLLRDGHSQLVYKHAISTIMPGHPVQL
HFQ_METPB       --RAQNLQDTFLNHVRKNKIPLTIFLVNGVKLQGVVTWFDNFCVLLRDGHSQLVYKHAISTIMPGHPVQL
HFQ_METNO       --RAQNLQDTFLNHVRKNKIPLTIFLVNGVKLQGVVTWFDNFCVLLRDGHSQLVYKHAISTIMPGHPVQL
HFQ_METEP       --RAQNLQDTFLNHVRKNKIPLTIFLVNGVKLQGVVTWFDNFCVLLRDGHSQLVYKHAISTIMPGHPVQL
HFQ_METC4       --RAQNLQDTFLNHVRKNKIPLTIFLVNGVKLQGVVTWFDNFCVLLRDGHSQLVYKHAISTIMPGHPVQL
HFQ_MARMM       -----NLQDVFLNSVRKTKTPLTIFLVNGVKLQGVVTWFDNFCVLLRDGLSQLVYKHAISTIMPAAPVSL
HFQ_JANSC       -----NLQDAFLNHVRKTKVPVTIFLINGVKLQGVITWFDNFCVLLRDGQSQLVYKHAISTVMPAQPISL
HFQ_ROSDO       -----NLQDAFLNHVRKTKVPVTIFLINGVKLQGVITWFDNFCVLLRDGQSQLVYKHAISTIMPSQPISL
HFQ_RHOS5       -----NLQDAFLNHVRKAKVPVTIFLINGVKLQGVITWFDNFCVLLRDGQSQLVYKHAISTIMPGQPINL
HFQ_RHOS4       -----NLQDAFLNHVRKAKVPVTIFLINGVKLQGVITWFDNFCVLLRDGQSQLVYKHAISTIMPGQPINL
HFQ_RHOS1       -----NLQDAFLNHVRKAKVPVTIFLINGVKLQGVITWFDNFCVLLRDGQSQLVYKHAISTIMPGQPINL
HFQ_RHILO       --RSQNLQDLFLNSVRKSKNPLTIFLINGVKLTGVVTSFDNFCVLLRDGHSQLVYKHAISTIMPSQPVQM
HFQ_AZOC5       --RTQNLQDTFLNHVRKSKTPLTIFLVNGVKLQGVVTWFDNFCVLLRDGHSQLVYKHAISTIMPGHPVQL
HFQ_PARDP       -----NLQDAFLNHVRKGKVPVTIFLINGVKLQGVITWFDNFCVLLRDGQSQLVYKHAISTIMPGQPISL
HFQ_LEPIN       MSAKNNIQDQLLNTARKDKLDLTIYLLNGVPLKGKVVSFDNFTIVLEQENKQLVYKHAISTIIPAKIIKL
HFQ_LEPIC       MSAKNNIQDQLLNTARKDKLDLTIYLLNGVPLKGKVVSFDNFTIVLEQENKQLVYKHAISTIIPAKIIKL
HFQ_HYPNA       -----NLQDTFLNAVRKSRTPLTVFLVNGVKLQGVVTWFDNFCILLRGDGRQLVYKHAISTIAPSAPVQL
HFQ_RHOPT       --RAQNLQDTFLNHVRKTKTPLTIFLVNGVKLQGIVTWFDNFCLLLRDGHSQLVYKHAISTIMPGAPIQL
HFQ_RHOPA       --RAQNLQDTFLNHVRKTKTPLTIFLVNGVKLQGIVTWFDNFCLLLRDGHSQLVYKHAISTIMPGAPIQL
HFQ_NITWN       IDRAQNLQDTFLNHVRKTKTPLTIFLVNGVKLQGIVTWFDNFCLLLRDGHSQLVYKHAISTIMPGAPIQL
HFQ_NITHX       IDRAQNLQDTFLNHVRKTKTPLTIFLVNGVKLQGIVTWFDNFCLLLRDGHSQLVYKHAISTIMPGAPIQL
HFQ_RHOPS       --RAQNLQDTFLNHVRKTKTPLTIFLVNGVKLQGIVTWFDNFCLLLRDGHSQLVYKHAISTIMPGAPIQL
HFQ_RHOPB       --RAQNLQDTFLNHVRKTKTPLTIFLVNGVKLQGIVTWFDNFCLLLRDGHSQLVYKHAISTIMPGAPIQL
HFQ_RHOP5       --RAQNLQDTFLNHVRKTKTPLTIFLVNGVKLQGIVTWFDNFCLLLRDGHSQLVYKHAISTIMPGAPIQL
HFQ_RHOP2       --RAQNLQDTFLNHVRKTKTPLTIFLVNGVKLQGIVTWFDNFCLLLRDGHSQLVYKHAISTIMPGAPIQL
HFQ_MESSB       --RSQNLQDLFLNTVRKSKNPLTIFLINGVKLTGVVTSFDNFCVLLRDGHSQLVYKHAISTIMPSQPVQL
HFQ_LEPBL       MSAKNNIQDQLLNTARKDKLDLTIYLLNGVPLKGKVVSFDNFTIVLEQENKQLVYKHAISTIIPAKIIKL
HFQ_LEPBJ       MSAKNNIQDQLLNTARKDKLDLTIYLLNGVPLKGKVVSFDNFTIVLEQENKQLVYKHAISTIIPAKIIKL
HFQ_DESAP       -----NLQDAFLNQLRKENIPVTIFLVNGFQLKGAVRGFDNFTVILESDGKQMVYKHAISTVSPS---RP
HFQ_BRASO       --RAQNLQDTFLNHVRKTKTPLTIFLVNGVKLQGIVTWFDNFCLLLRDGHSQLVYKHAISTIMPGAPIQL
HFQ_BRASB       --RAQNLQDTFLNHVRKTKTPLTIFLVNGVKLQGIVTWFDNFCLLLRDGHSQLVYKHAISTIMPGAPIQL
HFQ_BRAJA       --RAQNLQDTFLNHVRKTKTPLTIFLVNGVKLQGIVTWFDNFCLLLRDGHSQLVYKHAISTIMPGAPIQL
HFQ_BARBK       VERSQHLQDVFLKTVRKQEISLTIFLVNGVKLTGIVTSFDNFCILLRRDGHQLVYKHAISTIMPGQPIKI
HFQ_OLICO       --RAQNLQDTFLNHVRKSKTPLTIFLVNGVKLQGIVTWFDNFCLLLRDGHSQLVYKHAISTIMPGAPISL
HFQ_DESHD       -----NLQDTFLNQVRKENMPVTIYLVNGFQLKGLVRGFDNFTVVIEEGKQQMVYKHAISTVMPLRPINL
HFQ_CLOCE       -----NLQDIFLNQVRKEHIAVTIYLTNGFQLKGLVKGFDNFTVVLTDGKQQLVYKHAISTISPMKSVNL
HFQ_DESRM       -----NLQDAFLNQVRKENIPVTIFLINGFQLKGMVKGFDNFTVILESDGKQMVYKHAISTISPLRPVNT
HFQ_DESHY       -----NLQDTFLNQVRKENMPVTIYLVNGFQLKGLVRGFDNFTVVIEEGKQQMVYKHAISTVMPLRPINL
HFQ_BREBN       MKQTINIQDTFLNHLRKENIAVTIYLVNGFQLRGYIKAFDNFTIVIDSEKQQLVYKHAISTFTPQRPVSL
HFQ_RHORT       --KTQNVQDVFLNYIRKNKAPVTIFLVNGVKLQGIVTWFDNFSLLLRRDGHQLVYKHAISTIMPASPVQL
HFQ_CLOPS       ---INNLQDIFLNNARKERIPVTIFLVNGVQLKGIVKGFDSFTVVLSDGKQQLVYKHAISTVSPAKPI--
HFQ_CLOPE       ---INNLQDIFLNNARKERIPVTIFLVNGVQLKGIVKGFDSFTVVLSDGKQQLVYKHAISTVSPAKPI--
HFQ_CLOP1       ---INNLQDIFLNNARKERIPVTIFLVNGVQLKGIVKGFDSFTVVLSDGKQQLVYKHAISTVSPAKPI--
HFQ_AQUAE       ------LQESFLNTARKKRVKVSVYLVNGVRLQGRIRSFDLFTILLEDGKQQLVYKHAITTIVPHERLEI
HFQ_ANATD       -----NLQDLFLNQLRKEKVNVTIFLLSGFQLKGVIKGFDNFTLIVENNKQQLIYKHAISSIMPSKPI--
HFQ_PELTS       -----NLQDAFLNQVRKENIPVTIFLVNGFQLKGMVRGFDNFTVILESEGKQMVYKHAISTVSPLKPVST
HFQ_BACSK       MKATVNIQDQFLNQLRKESIPVTVFLLNGFQLRGQVKGFDNFTVIVETERQQLVYKHAISTFAPQKNVQL
HFQ_CARHZ       -----NLQDAFLNQVRKENVGVTIFLINGFQLKGFVKGFDNFTVILESEGKQMIYKHAISTIIPQRPV--
HFQ_NATTJ       -----NLQDNVLNQVRKNKITVTIFLVNGYKIRGLIKSFDNFTLLMENGEQQMIYKHAVSTIIPGKTLNL
HFQ_ALKMQ       -----NLQDVFLNQVRKENIQITIYLVNGFQLKGFVKGFDNYTIVLSDGKQQLIYKHAISTILPITPINF
HFQ_THETN       -----NLQDIFLNQVRKEHVPVTVYLINGFQLKGTVKGFDNFTVVLESESKQLIYKHAISTISPQKPV--
HFQ_THEPX       -----NLQDIFLNQVRKEHVPVTVYLINGFQLKGLVKGFDNFTVVLESENKQLIYKHAISTITPQKPV--
HFQ_THEP3       -----NLQDIFLNQVRKEHVPVTVYLINGFQLKGLVKGFDNFTVVLESENKQLIYKHAISTITPQKPV--
HFQ_SYNWW       -----NLQDAFLNQVRKDKIPVTVFLVNGFQIKGMVRGFDNFTVIIEDQKQQLVYKHAISTVAPLRPISM
HFQ_CLOBM       ---VNNLQDIFLNGARKNRIPVTIYLTNGFQLKGFVKGFDNFTVILDSDGKQMIYKHAISTINPAKPLLF
HFQ_CLOBL       ---VNNLQDIFLNGARKNRIPVTIYLTNGFQLKGFVKGFDNFTVILDSDGKQMIYKHAISTINPAKPLLF
HFQ_CLOBK       ---VNNLQDIFLNGARKNRIPVTIYLTNGFQLKGFVKGFDNFTVILDSDGKQMIYKHAISTINPAKPLLF
HFQ_CLOBJ       ---VNNLQDIFLNGARKNRIPVTIYLTNGFQLKGFVKGFDNFTVILDSDGKQMIYKHAISTINPAKPLLF
HFQ_CLOBH       ---VNNLQDIFLNGARKNRIPVTIYLTNGFQLKGFVKGFDNFTVILDSDGKQMIYKHAISTINPAKPLLF
HFQ_CLOB6       ---VNNLQDIFLNGARKNRIPVTIYLTNGFQLKGFVKGFDNFTVILDSDGKQMIYKHAISTINPAKPLLF
HFQ_CLOB1       ---VNNLQDIFLNGARKNRIPVTIYLTNGFQLKGFVKGFDNFTVILDSDGKQMIYKHAISTINPAKPLLF
HFQ_ACIC5       -----NIQDTFLNTVRKDKTPITIYLVSGVKLTGKIRSFDKYSVLLNNSQEQLIFKHAISTVVSSRSV--
HFQ_MOOTA       -----NLQDLFLNVLRRDNTPVTIYLVNGFQLKGVVRGFDNFTVVLADGKQQMIYKHAISTIMPFRPVNL
HFQ_BACSU       -----NIQDQFLNQIRKENTYVTVFLLNGFQLRGQVKGFDNFTVLLESEKQQLIYKHAISTFAPQKNVQL
HFQ_MAGSA       -----NVQDVFLNFIRKNKTPVTIFLVNGVKLQGIVTWFDNFSVLLRRDGHQLVYKHAISTVMPSTPI--
HFQ_BACHD       -----NIQDHFLNQLRKENIPVTVFLLNGFQLRGLVKGFDNFTVILETEKQQLVYKHAISTFAPQRNVQM
HFQ_ANOFW       MKNTINIQDQFLNQLRKEETTVTVFLLNGFQLRGLVKGFDNFTVLLEDGRQQLIYKHAISTFAPQKNVKI
HFQ_THELT       MTEKFNLQDRFLNMLRTGKIEVKVYLVNGFQTKGIIRSFDSYTILLESENQQLIYKHAISTIMPSSFVRL
HFQ_GRABC       -----NVQDVFLNHVRKSKTPVTVFLVNGVKLQGIITWFDNFSVLLRRDGHQLVYKHAISTVMPGAPIQL
HFQ_BACLD       -----NIQDQFLNQIRKENTFVTVFLLNGFQLRGQVKGFDNFTVLIESEKQQLIYKHAISTFAPQKNVQL
HFQ_THEM4       MAEKFNLQDRFLNILRTSKIPVKVYLVNGFQTKGIIRSFDNFTMLLENGNQQLIYKHAVSTIMPESFVRL
HFQ_GLUDA       -----NVQDVFLNHVRRSKTPVTVFLVNGVKLQGIITWFDNFSVLLRRDGHQLVYKHAISTVMPATPV--
HFQ_CLOD6       ---VLNLQDLFLNNARKERIPVTIYLVNGVQVKGLVKGFDSYIILIENRQQNMIYKHAVSTIQPGKYINL
HFQ_BACWK       MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEKQQLIYKHAISTFVPQKNV--
HFQ_BACHK       MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEKQQLIYKHAISTFVPQKNV--
HFQ_BACCZ       MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEKQQLIYKHAISTFVPQKNV--
HFQ_BACCR       MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEKQQLIYKHAISTFVPQKNV--
HFQ_BACCQ       MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEKQQLIYKHAISTFVPQKNV--
HFQ_BACC7       MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEKQQLIYKHAISTFVPQKNV--
HFQ_BACC4       MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEKQQLIYKHAISTFVPQKNV--
HFQ_BACC3       MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEKQQLIYKHAISTFVPQKNV--
HFQ_BACC2       MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEKQQLIYKHAISTFVPQKNV--
HFQ_BACC1       MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEKQQLIYKHAISTFVPQKNV--
HFQ_BACC0       MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEKQQLIYKHAISTFVPQKNV--
HFQ_BACAN       MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEKQQLIYKHAISTFVPQKNV--
HFQ_BACAH       MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEKQQLIYKHAISTFVPQKNV--
HFQ_BACAC       MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEKQQLIYKHAISTFVPQKNV--
HFQ_BACAA       MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEKQQLIYKHAISTFVPQKNV--
HFQ_BACA2       -----NIQDQFLNQIRKDNTFVTVFLLNGFQLRGQVKGFDNFTVLLETEKQQLIYKHAISTFAPQKNVQL
HFQ_FERNB       -----NLQDRFLNILRTKKIEVKVYLVNGFQTKGIVRSFDNFTVLIESGKQQLIYKHAISTILPAEYIML
HFQ_BACP2       -----NIQDQFLNQIRKDNTFVTVFLLNGFQLRGQVKGFDNFTVLLETEKQQLIYKHAISTFAPQKNVNL
HFQ_THESQ       MAEKFNLQDRFLNHLRVNKIEVKVYLVNGFQTKGFIRSFDSYTVLLESGNQQLIYKHAISTIIPSSYVML
HFQ_BACCN       MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEKQQLIYKHAISTFMPQKNV--
HFQ_THEAB       MAEKFNLQDRFLNILRTNKIPVKVYLVNGFQTKGIIRSFDNFTMLLENGSQQLIYKHAVSTIMPESFVKL
HFQ_GEOSW       MKNSINIQDQFLNQLRKDGTQVTVFLLNGYQLKGYIKGFDNFTVLLEQGKQQLIYKHAISTFAPEKNVR-
HFQ_GEOKA       MKNTINIQDQFLNQLRKEGIQVTVFLLNGFQLRGYIKGFDNFTVLLEQGKQQLIYKHAISTFAPERNI--
HFQ_CLONN       ----NNLQDLFLNNARINRISVTIFLTNGYKLEGLVKGFDNFTIILDNNGKQMIYKHAVSTIIPKSPI--
HFQ_CLOBA       ----NNLQDIFLNSARKNKIPVTVYLSTGFKLNGIVKGFDSFTVILDSEGKQMIYKHAITTVTPEKPILF
HFQ_CLOAB       ----NNLQDIFLNSARKNKIPVAIHLTNGFQMRGSVKGFDSFTVILESDGKQMIYKHAVSTITPLRPI--
HFQ_OCEIH       MAQSVNIQDQYLNQLRKNHISVTVFLTNGFQLRGLVKAFDNFTVLLEDGKQQLIFKHAISTFSPVKNVSL
HFQ_EXIS2       MKATYNIQDYFLNQLRKDSVPTTVFLISGYQLRGLIKSFDNFTVILESEKQQLIYKHAISTFAPARNVTL
HFQ_CLOK5       ----NNLQDIFLNGARKNRIPVIVYLTNGFQIRGIVKGFDNFTVILECDGKQMVYKHALSTITPSKAI--
HFQ_CLOK1       ----NNLQDIFLNGARKNRIPVIVYLTNGFQIRGIVKGFDNFTVILECDGKQMVYKHALSTITPSKAI--
HFQ_CLOB8       ----NNLQDIFLNNARKNKIQIIIHLVNGFQLKGTVKGFDNFTVILDCDNKQMIYKHAISTITPTKPI--
HFQ_SYMTH       ----ASLQDGFLNLLRRENIPATIYLVNGYQLKGYIRGFDNFTVAVEDGRVQLVYKHALSTITPARPLPV
HFQ_ALKOO       -----NLQDVFLNQVRKENIGITIFLVNGFQLKGFVRGFDNYTIVLSDGKQQMIYKHAVSTISPNSPV--
HFQ_THEP1       MAEKFNLQDRFLNHLRVNKIEVKVYLVNGFQTKGFIRSFDSYTVLLESGNQQLIYKHAISTIIPSSYVML
HFQ_THEMA       -----NLQDRFLNHLRVNKIEVKVYLVNGFQTKGFIRSFDSYTVLLESGNQQLIYKHAISTIIPSSYVML
HFQ_EXISA       -----NIQDHFLNQLRKEMVPTTVFLVSGFQIRGVIKSFDNFTVIVESERQQLIYKHAISTFSPARNVTL
HFQ_CLOBB       ----NNLQDIFLNSARKNKMPVTIYLSTGFQINGTVKGFDSFTVILDSEGKQMIYKHAITTVTPEKPILF
HFQ_CALS8       ---------------RKEKVNVTIFLLSGFQLKGVIKGFDNFTLVVENNKQQLIYKHAISSILPSKPI--


                         .         .         *         .         .         .         .:140
query           VYSSFNPYHQNSNDEQDENVDDIHSDDLEIQENEGNIHE
HFQ_FRATM       VYSSFNPYHQNSNDEQDENVDDIHSDDLEIQENEGNIHE
HFQ_FRATW       VYSSFNPYHQNSNDEQDENVDDIHSDDLEIQENEGNIHE
HFQ_FRATO       VYSSFNPYHQNSNDEQDENVDDIHSDDLEIQENEGNIHE
HFQ_FRATN       VYSSFNPYHQNSNDEQDENVDDIHSDDLEIQENEGNIHE
HFQ_FRATH       VYSSFNPYHQNSNDEQDENVDDIHSDDLEIQENEGNIHE
HFQ_FRATF       VYSSFNPYHQNSNDEQDENVDDIHSDDLEIQENEGNIHE
HFQ_FRATT       IYNSFNPYHQNSNDEQDENVDDIHSDDLEIQENEGNIHE
HFQ_FRAT1       IYNSFNPYHQNSNDEQDENVDDIHSDDLEIQENEGNIHE
HFQ_FRAP2       VYSSFNPYHQNANDDQDENVDDIHSDELEVQENQENINE
HFQ_HAEIN       --SHHNNNHHTAPTEAVENVE------------------
HFQ_ALHEH       APPVPTETHAQSSEE------------------------
HFQ_VIBFM       HSASDRPQGERPQEKTEE---------------------
HFQ_VIBF1       HSASDRPQGERPQEKTEE---------------------
HFQ_XANCP       GPGGGYVQSNENNQAEDDDVE------------------
HFQ_XANCB       GPGGGYVQSNENNQAEDDDVE------------------
HFQ_XANC8       GPGGGYVQSNENNQAEDDDVE------------------
HFQ_XANOR       GPGGGYVQSNEGNQAEDDDVE------------------
HFQ_XANOM       GPGGGYVQSNEGNQAEDDDVE------------------
HFQ_XANC5       GPGGGYVQSNEGNQAEDDDVE------------------
HFQ_XANAC       GPGGGYVQSNEGNQAEDDDVE------------------
HFQ_PHOPR       HHASDRPATLEKTEE------------------------
HFQ_XYLFA       --GPGGGYVQSGSDTLQINDDEV----------------
HFQ_NITOC       ---------------------------------------
HFQ_VIBSL       --SHHSGEQQRAPSDRPEKTED-----------------
HFQ_HALHL       PQQGEEASAESIVGEEESN--------------------
HFQ_ALTMD       ---------------------------------------
HFQ_SHESH       NSHTAAPSPAGGNGQQDDNND------------------
HFQ_PSEE4       ---------------------------------------
HFQ_ALISL       HTASDRPQGERPQETTEE---------------------
HFQ_XYLFT       --GPGGGYVHSGSDTLQINDDEV----------------
HFQ_XYLFM       --GPGGGYVHSGSDTLQINDDEV----------------
HFQ_XYLF2       --GPGGGYVHSGSDTLQINDDEV----------------
HFQ_PASMU       ---------------------------------------
HFQ_MARAV       ---------------------------------------
HFQ_MANSM       ---------------------------------------
HFQ_HAHCH       ---------------------------------------
HFQ_HAEIG       ---------------------------------------
HFQ_HAEIE       ---------------------------------------
HFQ_HAEI8       ---------------------------------------
HFQ_ACTSZ       ---------------------------------------
HFQ_STRMK       ---------------------------------------
HFQ_STRM5       ---------------------------------------
HFQ_PSEU5       PTAGDAEQSESGND-------------------------
HFQ_VIBVY       ---------------------------------------
HFQ_VIBVU       ---------------------------------------
HFQ_VIBPA       ---------------------------------------
HFQ_VIBHB       ---------------------------------------
HFQ_VIBCM       ---------------------------------------
HFQ_VIBCH       ---------------------------------------
HFQ_VIBC3       ---------------------------------------
HFQ_SHELP       ---PFNVSSHHNTPNQAAGYNASHDDSAE----------
HFQ_SHEHH       AQAGFNAQHDDGDDK------------------------
HFQ_SHEAM       --GSHQGGSSNYNAQQDDSAGE-----------------
HFQ_PSEA6       --AATNP-HADADENQ-----------------------
HFQ_CELJU       ---------------------------------------
HFQ_AZOVD       PTAS-----------------------------------
HFQ_YEREN       -HHSNNPSGSTNN--------------------------
HFQ_YERE8       -HHSNNPSGSTNN--------------------------
HFQ_SERP5       -HHSNTPYHHGNNPSAPQQPQQ-ESDDAE----------
HFQ_SALAR       GGGTSNNYHHGSN--------------------------
HFQ_PSEPW       ---------------------------------------
HFQ_PSEPK       ---------------------------------------
HFQ_PSEPG       ---------------------------------------
HFQ_PSEP1       ---------------------------------------
HFQ_PSEMY       ---------------------------------------
HFQ_PSEAE       ---------------------------------------
HFQ_PSEAB       ---------------------------------------
HFQ_PSEA8       ---------------------------------------
HFQ_PSEA7       ---------------------------------------
HFQ_PECCP       -HHSNNPYHGNN---------------------------
HFQ_CHRSD       ---------------------------------------
HFQ_SHEDO       ---------------------------------------
HFQ_AERS4       ---------------------------------------
HFQ_AERHH       ---------------------------------------
HFQ_ACTPJ       ---------------------------------------
HFQ_ACTP7       ---------------------------------------
HFQ_ACTP2       ---------------------------------------
HFQ_TOLAT       ---------------------------------------
HFQ_PSEHT       ---NFQGVQENDDTEEPE---------------------
HFQ_PSEF5       PSAS-----------------------------------
HFQ_HAEDU       ---------------------------------------
HFQ_ECOLU       GGSTSSNYHQNTSAQQDSEENE-----------------
HFQ_YERPY       PSGSTNNYH------------------------------
HFQ_YERPS       PSGSTNNYH------------------------------
HFQ_YERPN       PSGSTNNYH------------------------------
HFQ_YERPG       PSGSTNNYH------------------------------
HFQ_YERPE       PSGSTNNYH------------------------------
HFQ_YERPB       PSGSTNNYH------------------------------
HFQ_YERPA       PSGSTNNYH------------------------------
HFQ_YERP3       PSGSTNNYH------------------------------
HFQ_SHEWM       HHSSPAPTFNGQNDETSE---------------------
HFQ_SHEPW       ------SNHQATNAQAGYNAQHDETDE------------
HFQ_PSEU2       ---------------------------------------
HFQ_PSESM       ---------------------------------------
HFQ_PSEPF       ---------------------------------------
HFQ_PSEFS       ---------------------------------------
HFQ_PSE14       ---------------------------------------
HFQ_SHESW       ---------------------------------------
HFQ_SHESR       ---------------------------------------
HFQ_SHESM       ---------------------------------------
HFQ_SHESA       ---------------------------------------
HFQ_SHEPC       ---------------------------------------
HFQ_SHEON       ---------------------------------------
HFQ_SHEFN       ---------------------------------------
HFQ_SHEB9       ---------------------------------------
HFQ_SHEB8       ---------------------------------------
HFQ_SHEB5       ---------------------------------------
HFQ_SHEB2       ---------------------------------------
HFQ_PSYIN       I--------------------------------------
HFQ_PROMH       ------SHHSNTGTNQ-----------------------
HFQ_METCA       ------PHAGESGDEEAE---------------------
HFQ_MARMS       ---------------------------------------
HFQ_HAES2       ---------------------------------------
HFQ_HAES1       ---------------------------------------
HFQ_SODGM       ---------------------------------------
HFQ_SHISS       ---------------------------------------
HFQ_SHIFL       ---------------------------------------
HFQ_SHIF8       ---------------------------------------
HFQ_SHIDS       ---------------------------------------
HFQ_SHIBS       ---------------------------------------
HFQ_SHIB3       ---------------------------------------
HFQ_SHEPA       ------SNHQATNAQAGYNAQHDDGDE------------
HFQ_SALTY       ---------------------------------------
HFQ_SALTI       ---------------------------------------
HFQ_SALSV       ---------------------------------------
HFQ_SALPK       ---------------------------------------
HFQ_SALPC       ---------------------------------------
HFQ_SALPB       ---------------------------------------
HFQ_SALPA       ---------------------------------------
HFQ_SALNS       ---------------------------------------
HFQ_SALG2       ---------------------------------------
HFQ_SALEP       ---------------------------------------
HFQ_SALDC       ---------------------------------------
HFQ_SALCH       ---------------------------------------
HFQ_SALA4       ---------------------------------------
HFQ_KLEP7       ---------------------------------------
HFQ_KLEP3       ---------------------------------------
HFQ_ESCF3       ---------------------------------------
HFQ_ERWT9       ---------------------------------------
HFQ_ERWCT       ---------------------------------------
HFQ_ENTS8       ---------------------------------------
HFQ_ENT38       ---------------------------------------
HFQ_ECOUT       ---------------------------------------
HFQ_ECOSM       ---------------------------------------
HFQ_ECOSE       ---------------------------------------
HFQ_ECOLI       ---------------------------------------
HFQ_ECOLC       ---------------------------------------
HFQ_ECOL6       ---------------------------------------
HFQ_ECOL5       ---------------------------------------
HFQ_ECOK1       ---------------------------------------
HFQ_ECOHS       ---------------------------------------
HFQ_ECODH       ---------------------------------------
HFQ_ECOBW       ---------------------------------------
HFQ_ECO8A       ---------------------------------------
HFQ_ECO81       ---------------------------------------
HFQ_ECO7I       ---------------------------------------
HFQ_ECO5E       ---------------------------------------
HFQ_ECO57       ---------------------------------------
HFQ_ECO55       ---------------------------------------
HFQ_ECO45       ---------------------------------------
HFQ_ECO27       ---------------------------------------
HFQ_ECO24       ---------------------------------------
HFQ_CITK8       ---------------------------------------
HFQ_YERPP       PSGSTNNYH------------------------------
HFQ_THISH       ---------------------------------------
HFQ_DICNV       ---------------------------------------
HFQ_SALHS       ---------------------------------------
HFQ_PECCC       ---------------------------------------
HFQ_HAEPS       ---------------------------------------
HFQ_COLP3       ---------------------------------------
HFQ_IDILO       ---------------------------------------
HFQ_ALCBS       ---------------------------------------
HFQ_BLOPB       ---------------------------------------
HFQ_NITEU       ------PIPADTQTEQDE---------------------
HFQ_JANMA       SLES-----------------------------------
HFQ_HERAR       SLES-----------------------------------
HFQ_BORPE       ---------------------------------------
HFQ_BORPD       ---------------------------------------
HFQ_BORPA       ---------------------------------------
HFQ_BORBR       ---------------------------------------
HFQ_BORA1       ---------------------------------------
HFQ_NEIMF       QHEN-----------------------------------
HFQ_NEIMB       QHEN-----------------------------------
HFQ_NEIMA       QHEN-----------------------------------
HFQ_NEIG1       QHEN-----------------------------------
HFQ_DIAST       -FSTAEPAADGDN--------------------------
HFQ_ACISJ       -FSTAEPAADGDN--------------------------
HFQ_VEREI       -FSTAEPADANSNN-------------------------
HFQ_RALSO       ---------------------------------------
HFQ_RALPJ       ---------------------------------------
HFQ_RALME       ---------------------------------------
HFQ_RALEJ       ---------------------------------------
HFQ_DECAR       ---------------------------------------
HFQ_CUPTR       ---------------------------------------
HFQ_BURP8       ---NFHPDSESS---------------------------
HFQ_ACIAC       -FSTAEPADAESGN-------------------------
HFQ_RHOFD       ---------------------------------------
HFQ_DELAS       ---------------------------------------
HFQ_CHRVO       -----NIPHEHPAQKQEQAQD------------------
HFQ_BURXL       ---NFHPDSEQS---------------------------
HFQ_BURPP       ---NFHPDSEQS---------------------------
HFQ_BURVG       ---------------------------------------
HFQ_BURTA       ---------------------------------------
HFQ_BURS3       ---------------------------------------
HFQ_BURPS       ---------------------------------------
HFQ_BURP6       ---------------------------------------
HFQ_BURP0       ---------------------------------------
HFQ_BURMS       ---------------------------------------
HFQ_BURMA       ---------------------------------------
HFQ_BURM9       ---------------------------------------
HFQ_BURM7       ---------------------------------------
HFQ_BURM1       ---------------------------------------
HFQ_BURCM       ---------------------------------------
HFQ_BURCJ       ---------------------------------------
HFQ_BURCH       ---------------------------------------
HFQ_BURCC       ---------------------------------------
HFQ_BURCA       ---------------------------------------
HFQ_BURA4       ---------------------------------------
HFQ_LARHH       ---------------------------------------
HFQ_VARPS       ---------------------------------------
HFQ_POLSJ       ---------------------------------------
HFQ_METFK       ---------------------------------------
HFQ_RALEH       ---------------------------------------
HFQ_AZOSB       ---------------------------------------
HFQ_THICR       ---------------------------------------
HFQ_NITMU       PFEA-----------------------------------
HFQ_AZOSE       ---------------------------------------
HFQ_BAUCH       ---------------------------------------
HFQ_LEPCP       ---------------------------------------
HFQ_NITEC       ---------------------------------------
HFQ_HAMD5       ---SSSPHH------------------------------
HFQ_WIGBR       ---------------------------------------
HFQ_TERTT       ---------------------------------------
HFQ_SACD2       ---------------------------------------
HFQ_LEGPL       ------PAEESSGEEEGTVAD------------------
HFQ_LEGPH       ------PAEESSGEEEGTVAD------------------
HFQ_LEGPC       ------PAEESSGEEEGTVAD------------------
HFQ_LEGPA       ------PAEESSGEEEGTVAD------------------
HFQ_PHOLL       ---------------------------------------
HFQ_OCHA4       ---------------------------------------
HFQ_BRUSU       ---------------------------------------
HFQ_BRUSI       ---------------------------------------
HFQ_BRUO2       ---------------------------------------
HFQ_BRUME       ---------------------------------------
HFQ_BRUMB       ---------------------------------------
HFQ_BRUC2       ---------------------------------------
HFQ_BRUAB       ---------------------------------------
HFQ_BRUA2       ---------------------------------------
HFQ_BRUA1       ---------------------------------------
HFQ_BARHE       ---------------------------------------
HFQ_THIDA       ---------------------------------------
HFQ_BART1       ---------------------------------------
HFQ_BARQU       ---------------------------------------
HFQ_RHILW       FES------------------------------------
HFQ_RHIL3       FES------------------------------------
HFQ_RHIEC       FES------------------------------------
HFQ_RHIE6       FES------------------------------------
HFQ_METSB       FES------------------------------------
HFQ_LEPBP       ---------------------------------------
HFQ_LEPBA       ---------------------------------------
HFQ_CAUSK       ---------------------------------------
HFQ_CAUCR       ---------------------------------------
HFQ_CAUCN       ---------------------------------------
HFQ_AGRT5       FES------------------------------------
HFQ_AGRRK       FES------------------------------------
HFQ_SINMW       ---------------------------------------
HFQ_RHISN       ---------------------------------------
HFQ_RHIME       ---------------------------------------
HFQ_BEII9       ---------------------------------------
HFQ_SILST       ---------------------------------------
HFQ_SILPO       ---------------------------------------
HFQ_PARL1       ---------------------------------------
HFQ_METS4       ---------------------------------------
HFQ_METRJ       ---------------------------------------
HFQ_METPB       ---------------------------------------
HFQ_METNO       ---------------------------------------
HFQ_METEP       ---------------------------------------
HFQ_METC4       ---------------------------------------
HFQ_MARMM       ---------------------------------------
HFQ_JANSC       ---------------------------------------
HFQ_ROSDO       ---------------------------------------
HFQ_RHOS5       ---------------------------------------
HFQ_RHOS4       ---------------------------------------
HFQ_RHOS1       ---------------------------------------
HFQ_RHILO       ---------------------------------------
HFQ_AZOC5       ---------------------------------------
HFQ_PARDP       ---------------------------------------
HFQ_LEPIN       -------YTEEAKDNKD----------------------
HFQ_LEPIC       -------YTEEAKDNKD----------------------
HFQ_HYPNA       ---------------------------------------
HFQ_RHOPT       FES------------------------------------
HFQ_RHOPA       FES------------------------------------
HFQ_NITWN       ---------------------------------------
HFQ_NITHX       ---------------------------------------
HFQ_RHOPS       ---------------------------------------
HFQ_RHOPB       ---------------------------------------
HFQ_RHOP5       ---------------------------------------
HFQ_RHOP2       ---------------------------------------
HFQ_MESSB       ---------------------------------------
HFQ_LEPBL       ---------------------------------------
HFQ_LEPBJ       ---------------------------------------
HFQ_DESAP       VNTSATPEHRN----------------------------
HFQ_BRASO       ---------------------------------------
HFQ_BRASB       ---------------------------------------
HFQ_BRAJA       ---------------------------------------
HFQ_BARBK       ---------------------------------------
HFQ_OLICO       ---------------------------------------
HFQ_DESHD       VAAS-----QSSTEER-----------------------
HFQ_CLOCE       IFN------------------------------------
HFQ_DESRM       SFSENKP--------------------------------
HFQ_DESHY       VAAS-----------------------------------
HFQ_BREBN       MSQENN---------------------------------
HFQ_RHORT       ---------------------------------------
HFQ_CLOPS       ---------------------------------------
HFQ_CLOPE       ---------------------------------------
HFQ_CLOP1       ---------------------------------------
HFQ_AQUAE       EF-------------------------------------
HFQ_ANATD       ---------------------------------------
HFQ_PELTS       SFS------------------------------------
HFQ_BACSK       ---------------------------------------
HFQ_CARHZ       ---------------------------------------
HFQ_NATTJ       ----FSDQSDKNDQEQ-----------------------
HFQ_ALKMQ       MQSS-----------------------------------
HFQ_THETN       ---------------------------------------
HFQ_THEPX       ---------------------------------------
HFQ_THEP3       ---------------------------------------
HFQ_SYNWW       L--------------------------------------
HFQ_CLOBM       VQ---NP---NGDDYKDK---------------------
HFQ_CLOBL       VQ---NP---NGDDYKDK---------------------
HFQ_CLOBK       VQ---NP---NGDDYKDK---------------------
HFQ_CLOBJ       VQ---NP---NGDDYKDK---------------------
HFQ_CLOBH       VQ---NP---NGDDYKDK---------------------
HFQ_CLOB6       VQ---NP---NGDDYKDK---------------------
HFQ_CLOB1       VQ---NP---NGDDYKDK---------------------
HFQ_ACIC5       ---------------------------------------
HFQ_MOOTA       MAES-----------------------------------
HFQ_BACSU       ---------------------------------------
HFQ_MAGSA       --SLFEPPIKENGEE------------------------
HFQ_BACHD       ---------------------------------------
HFQ_ANOFW       ---------------------------------------
HFQ_THELT       V--------------------------------------
HFQ_GRABC       ---------------------------------------
HFQ_BACLD       ---------------------------------------
HFQ_THEM4       T----SKQQQEGKDSDEE---------------------
HFQ_GLUDA       ---------------------------------------
HFQ_CLOD6       ---------------------------------------
HFQ_BACWK       ---------------------------------------
HFQ_BACHK       ---------------------------------------
HFQ_BACCZ       ---------------------------------------
HFQ_BACCR       ---------------------------------------
HFQ_BACCQ       ---------------------------------------
HFQ_BACC7       ---------------------------------------
HFQ_BACC4       ---------------------------------------
HFQ_BACC3       ---------------------------------------
HFQ_BACC2       ---------------------------------------
HFQ_BACC1       ---------------------------------------
HFQ_BACC0       ---------------------------------------
HFQ_BACAN       ---------------------------------------
HFQ_BACAH       ---------------------------------------
HFQ_BACAC       ---------------------------------------
HFQ_BACAA       ---------------------------------------
HFQ_BACA2       ---------------------------------------
HFQ_FERNB       M--------------------------------------
HFQ_BACP2       ---------------------------------------
HFQ_THESQ       MPRKQEP------EKEDETPED-----------------
HFQ_BACCN       ---------------------------------------
HFQ_THEAB       ---------------------------------------
HFQ_GEOSW       ---------------------------------------
HFQ_GEOKA       ---------------------------------------
HFQ_CLONN       ---------------------------------------
HFQ_CLOBA       V--------------------------------------
HFQ_CLOAB       ---------------------------------------
HFQ_OCEIH       ---------------------------------------
HFQ_EXIS2       -------YEQETETEE-----------------------
HFQ_CLOK5       ---------------------------------------
HFQ_CLOK1       ---------------------------------------
HFQ_CLOB8       ---------------------------------------
HFQ_SYMTH       SVSQIMRAGEGQEVEGEE---------------------
HFQ_ALKOO       ---------------------------------------
HFQ_THEP1       M--------------------------------------
HFQ_THEMA       M--------------------------------------
HFQ_EXISA       ---------------------------------------
HFQ_CLOBB       V--------------------------------------
HFQ_CALS8       ---------------------------------------