[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30738.1

[Show Plain Result]


## Summary of Sequence Search
    1::287
    2::290     9e-69  50%  295 aa  GALU_HAEIN RecName: Full=UTP--glucose-1-phosphate
    2::289     3e-68  49%  295 aa  GALU_HAEDU RecName: Full=UTP--glucose-1-phosphate
    2::264     6e-68  52%  279 aa  GALU_PSEAE RecName: Full=UTP--glucose-1-phosphate
    4::288     1e-66  49%  299 aa  CAP4C_STRPN RecName: Full=UTP--glucose-1-phosphate
    7::295     1e-65  50%  302 aa  GALU_SHIFL RecName: Full=UTP--glucose-1-phosphate
    7::295     1e-65  50%  302 aa  GALU_ECOLI RecName: Full=UTP--glucose-1-phosphate
    7::295     1e-65  50%  302 aa  GALU_ECOL6 RecName: Full=UTP--glucose-1-phosphate
    7::295     1e-65  50%  302 aa  GALU_ECO57 RecName: Full=UTP--glucose-1-phosphate
    2::264     2e-65  50%  279 aa  GALU2_PSEAE RecName: Full=UTP--glucose-1-phosphate
    3::287     4e-65  48%  304 aa  HASC_STRPY RecName: Full=UTP--glucose-1-phosphate
    3::287     4e-65  48%  304 aa  HASC1_STRP8 RecName: Full=UTP--glucose-1-phosphate
    3::287     4e-65  48%  304 aa  HASC1_STRP1 RecName: Full=UTP--glucose-1-phosphate
    3::287     8e-65  48%  304 aa  HASC2_STRP6 RecName: Full=UTP--glucose-1-phosphate
    3::287     8e-65  48%  304 aa  HASC1_STRP3 RecName: Full=UTP--glucose-1-phosphate
    3::287     1e-64  48%  299 aa  HASC2_STRP8 RecName: Full=UTP--glucose-1-phosphate
    3::287     1e-64  48%  299 aa  HASC2_STRP3 RecName: Full=UTP--glucose-1-phosphate
    3::287     1e-64  48%  299 aa  HASC2_STRP1 RecName: Full=UTP--glucose-1-phosphate
    3::287     1e-64  48%  299 aa  HASC1_STRP6 RecName: Full=UTP--glucose-1-phosphate
    3::284     8e-63  46%  289 aa  GTAB2_STAS1 RecName: Full=UTP--glucose-1-phosphate
    3::287     9e-62  46%  306 aa  CAP3C_STRPN RecName: Full=UTP--glucose-1-phosphate
    1::284     2e-61  46%  287 aa  GTAB1_STAS1 RecName: Full=UTP--glucose-1-phosphate
    3::284     4e-61  45%  292 aa  GTAB_BACSU RecName: Full=UTP--glucose-1-phosphate
    3::284     9e-61  46%  288 aa  GTAB_STAHJ RecName: Full=UTP--glucose-1-phosphate
   13::284     1e-59  46%  288 aa  GTAB_STAES RecName: Full=UTP--glucose-1-phosphate
   13::284     1e-59  46%  288 aa  GTAB_STAEQ RecName: Full=UTP--glucose-1-phosphate
    2::282     5e-59  49%  283 aa  Y1334_METJA RecName: Full=Putative UTP--glucose-1-phosphate
    7::280     3e-58  46%  301 aa  EXON_RHIME RecName: Full=UTP--glucose-1-phosphate
    3::274     4e-57  47%  291 aa  GALU_MYCPN RecName: Full=UTP--glucose-1-phosphate
    5::261     3e-55  47%  284 aa  CELA_ACEXY RecName: Full=UTP--glucose-1-phosphate
    4::278     5e-54  45%  292 aa  GALU_MYCGE RecName: Full=UTP--glucose-1-phosphate
   13::284     7e-54  43%  288 aa  GTAB_STAAW RecName: Full=UTP--glucose-1-phosphate
   13::284     7e-54  43%  288 aa  GTAB_STAAS RecName: Full=UTP--glucose-1-phosphate
   13::284     7e-54  43%  288 aa  GTAB_STAAN RecName: Full=UTP--glucose-1-phosphate
   13::284     7e-54  43%  288 aa  GTAB_STAAM RecName: Full=UTP--glucose-1-phosphate
   13::284     7e-54  43%  288 aa  GTAB_STAAC RecName: Full=UTP--glucose-1-phosphate
   13::284     7e-54  43%  288 aa  GTAB_STAA8 RecName: Full=UTP--glucose-1-phosphate
   13::284     7e-54  43%  288 aa  GTAB_STAA3 RecName: Full=UTP--glucose-1-phosphate
   13::284     9e-54  43%  288 aa  GTAB_STAAR RecName: Full=UTP--glucose-1-phosphate
   13::284     2e-53  43%  288 aa  GTAB_STAAB RecName: Full=UTP--glucose-1-phosphate
    5::292     5e-52  45%  297 aa  GALF_SALTY RecName: Full=UTP--glucose-1-phosphate
    5::292     5e-52  45%  297 aa  GALF_SALTI RecName: Full=UTP--glucose-1-phosphate
    7::294     2e-51  44%  298 aa  GALF_KLEPN RecName: Full=UTP--glucose-1-phosphate
    5::292     7e-51  43%  297 aa  GALF_ECOLI RecName: Full=UTP--glucose-1-phosphate
    5::292     7e-51  43%  297 aa  GALF_ECO57 RecName: Full=UTP--glucose-1-phosphate
    5::292     2e-50  43%  297 aa  GALF_SHIFL RecName: Full=UTP--glucose-1-phosphate
    2::264     1e-40  41%  272 aa  YTDA_BACSU RecName: Full=Putative UTP--glucose-1-phosphate
    3::220     4e-23  35%  411 aa  GLMU_METM5 RecName: Full=Bifunctional protein glmU;Includes:
    3::220     2e-20  35%  411 aa  GLMU_METM7 RecName: Full=Bifunctional protein glmU;Includes:
    3::224     2e-20  34%  414 aa  GLMU_METVS RecName: Full=Bifunctional protein glmU;Includes:
    3::223     8e-20  34%  411 aa  GLMU_META3 RecName: Full=Bifunctional protein glmU;Includes:
    1::250     2e-19  30%  293 aa  RMLA1_ECOLI RecName: Full=Glucose-1-phosphate thymidylyltransferase
    1::250     5e-19  29%  292 aa  RMLA_SALAN RecName: Full=Glucose-1-phosphate thymidylyltransferase;
    1::250     7e-19  29%  292 aa  RMLA_SALTY RecName: Full=Glucose-1-phosphate thymidylyltransferase;
    1::250     1e-18  29%  292 aa  RMLA1_SHIFL RecName: Full=Glucose-1-phosphate thymidylyltransferase
    3::220     3e-18  34%  411 aa  GLMU_METMP RecName: Full=Bifunctional protein glmU;Includes:
    1::251     4e-18  30%  293 aa  RMLA3_ECOLX RecName: Full=Glucose-1-phosphate
    2::209     3e-17  31%  289 aa  RMLA_STRMU RecName: Full=Glucose-1-phosphate thymidylyltransferase;
    3::218     6e-17  35%  408 aa  GLMU_METJA RecName: Full=Bifunctional protein glmU;Includes:
    2::199     9e-16  31%  288 aa  RMLA_NEIMB RecName: Full=Glucose-1-phosphate thymidylyltransferase;
    1::209     2e-15  29%  295 aa  RMLA_XANCP RecName: Full=Glucose-1-phosphate thymidylyltransferase;
    1::209     2e-15  29%  295 aa  RMLA_XANCB RecName: Full=Glucose-1-phosphate thymidylyltransferase;
    2::199     3e-15  31%  288 aa  RMLA_NEIMA RecName: Full=Glucose-1-phosphate thymidylyltransferase;
    2::231     6e-15  27%  355 aa  STRD_STRGR RecName: Full=Glucose-1-phosphate thymidylyltransferase;
    2::199     8e-15  31%  288 aa  RMLA_NEIGO RecName: Full=Glucose-1-phosphate thymidylyltransferase;
    2::239     2e-14  28%  246 aa  SPSI_BACSU RecName: Full=Spore coat polysaccharide biosynthesis
   14::237     7e-14  28%  371 aa  GMPPB_DROPS RecName: Full=Mannose-1-phosphate guanyltransferase
    2::226     3e-13  33%  364 aa  MPG1_CRYNE RecName: Full=Mannose-1-phosphate guanyltransferase;    
    2::245     6e-13  31%  361 aa  MPG12_CANGA RecName: Full=Mannose-1-phosphate guanyltransferase 2; 
   12::235     6e-13  29%  369 aa  GMPPB_DROME RecName: Full=Mannose-1-phosphate guanyltransferase
    6::158     7e-13  36%  457 aa  GLMU_GEOUR RecName: Full=Bifunctional protein glmU;Includes:
    2::198     1e-12  29%  293 aa  RMLA2_SHIFL RecName: Full=Glucose-1-phosphate thymidylyltransferase
    2::198     1e-12  29%  293 aa  RMLA2_ECOLI RecName: Full=Glucose-1-phosphate thymidylyltransferase
    6::212     1e-12  32%  457 aa  GLMU_THETN RecName: Full=Bifunctional protein glmU;Includes:
    1::226     2e-12  30%  457 aa  GLMU_LISW6 RecName: Full=Bifunctional protein glmU;Includes:
    2::198     2e-12  29%  289 aa  RMLA_YEREN RecName: Full=Glucose-1-phosphate thymidylyltransferase;
    1::226     6e-12  29%  457 aa  GLMU_LISMO RecName: Full=Bifunctional protein glmU;Includes:
    1::226     6e-12  29%  457 aa  GLMU_LISMH RecName: Full=Bifunctional protein glmU;Includes:
    1::226     6e-12  29%  457 aa  GLMU_LISMF RecName: Full=Bifunctional protein glmU;Includes:
    1::226     6e-12  29%  457 aa  GLMU_LISMC RecName: Full=Bifunctional protein glmU;Includes:
    2::227     8e-12  30%  361 aa  MPG1_YEAST RecName: Full=Mannose-1-phosphate guanyltransferase;    
    1::226     8e-12  29%  457 aa  GLMU_LISIN RecName: Full=Bifunctional protein glmU;Includes:
    2::227     1e-11  32%  364 aa  MPG1_PICAN RecName: Full=Mannose-1-phosphate guanyltransferase;    
    2::227     2e-11  30%  361 aa  MPG1_KLULA RecName: Full=Mannose-1-phosphate guanyltransferase;    
    2::227     2e-11  30%  361 aa  MPG11_CANGA RecName: Full=Mannose-1-phosphate guanyltransferase 1; 
    2::227     2e-11  32%  364 aa  MPG1_GIBZE RecName: Full=Mannose-1-phosphate guanyltransferase;    
    2::198     9e-11  28%  303 aa  ACBA_ACTS5 RecName: Full=Glucose-1-phosphate thymidylyltransferase;
    2::181     2e-10  36%  365 aa  GMPPB_CAEEL RecName: Full=Mannose-1-phosphate guanyltransferase
    2::227     3e-10  29%  361 aa  MPG1_ASHGO RecName: Full=Mannose-1-phosphate guanyltransferase;    
    2::195     3e-10  35%  445 aa  GLMU_THESQ RecName: Full=Bifunctional protein glmU;Includes:
    9::212     3e-10  29%  456 aa  GLMU_PECCP RecName: Full=Bifunctional protein glmU;Includes:
    2::195     4e-10  35%  445 aa  GLMU_THEP1 RecName: Full=Bifunctional protein glmU;Includes:
    9::212     8e-10  30%  456 aa  GLMU_ENTS8 RecName: Full=Bifunctional protein glmU;Includes:
    2::199     1e-09  28%  286 aa  RMLA_RHISN RecName: Full=Probable glucose-1-phosphate
    2::195     1e-09  34%  445 aa  GLMU_THEMA RecName: Full=Bifunctional protein glmU;Includes:
    6::211     1e-09  30%  476 aa  GLMU_GEOSL RecName: Full=Bifunctional protein glmU;Includes:
    1::251     1e-09  30%  456 aa  GLMU_BACA2 RecName: Full=Bifunctional protein glmU;Includes:
    8::273     1e-09  25%  381 aa  GLGC_MYCMO RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::212     2e-09  30%  456 aa  GLMU_SERP5 RecName: Full=Bifunctional protein glmU;Includes:
    4::227     2e-09  28%  359 aa  MPG1_SULAC RecName: Full=Putative mannose-1-phosphate
    1::217     2e-09  28%  458 aa  GLMU_ENTFA RecName: Full=Bifunctional protein glmU;Includes:
    2::180     3e-09  32%  364 aa  GMPPB_CAEBR RecName: Full=Mannose-1-phosphate guanyltransferase
    1::217     3e-09  29%  456 aa  GLMU_BACSU RecName: Full=Bifunctional protein glmU;Includes:
    1::251     4e-09  29%  456 aa  GLMU_BACLD RecName: Full=Bifunctional protein glmU;Includes:
    2::226     5e-09  29%  360 aa  GMPPB_DANRE RecName: Full=Mannose-1-phosphate guanyltransferase
    1::217     5e-09  30%  455 aa  GLMU_BACHD RecName: Full=Bifunctional protein glmU;Includes:
    2::244     8e-09  29%  360 aa  GMPPB_XENTR RecName: Full=Mannose-1-phosphate guanyltransferase
    2::244     8e-09  30%  360 aa  GMPBB_XENLA RecName: Full=Mannose-1-phosphate guanyltransferase
    1::217     8e-09  30%  454 aa  GLMU_BACSK RecName: Full=Bifunctional protein glmU;Includes:
    1::226     1e-08  29%  469 aa  GLMU_LACS1 RecName: Full=Bifunctional protein glmU;Includes:
    5::212     2e-08  29%  449 aa  GLMU_SYNWW RecName: Full=Bifunctional protein glmU;Includes:
    4::242     2e-08  26%  464 aa  GLMU_RHOFD RecName: Full=Bifunctional protein glmU;Includes:
    2::244     2e-08  29%  360 aa  GMPBA_XENLA RecName: Full=Mannose-1-phosphate guanyltransferase
    2::244     4e-08  28%  360 aa  GMPPB_MOUSE RecName: Full=Mannose-1-phosphate guanyltransferase
    6::212     4e-08  29%  457 aa  GLMU_PHOLL RecName: Full=Bifunctional protein glmU;Includes:
    1::217     4e-08  30%  455 aa  GLMU_LACRJ RecName: Full=Bifunctional protein glmU;Includes:
    1::217     4e-08  30%  455 aa  GLMU_LACRD RecName: Full=Bifunctional protein glmU;Includes:
    2::226     7e-08  27%  360 aa  GMPPB_PIG RecName: Full=Mannose-1-phosphate guanyltransferase beta;
    2::226     7e-08  27%  360 aa  GMPPB_HUMAN RecName: Full=Mannose-1-phosphate guanyltransferase
   22::212     7e-08  30%  457 aa  GLMU_THEP3 RecName: Full=Bifunctional protein glmU;Includes:
   58::213     7e-08  34%  458 aa  GLMU_NITEC RecName: Full=Bifunctional protein glmU;Includes:
    2::226     9e-08  28%  360 aa  GMPPB_BOVIN RecName: Full=Mannose-1-phosphate guanyltransferase
    4::211     9e-08  26%  452 aa  GLMU_THEYD RecName: Full=Bifunctional protein glmU;Includes:
    9::212     9e-08  27%  456 aa  GLMU_SALTI RecName: Full=Bifunctional protein glmU;Includes:
    9::212     9e-08  27%  456 aa  GLMU_SALPK RecName: Full=Bifunctional protein glmU;Includes:
    9::212     9e-08  27%  456 aa  GLMU_SALPB RecName: Full=Bifunctional protein glmU;Includes:
    9::212     9e-08  27%  456 aa  GLMU_SALPA RecName: Full=Bifunctional protein glmU;Includes:
    9::212     9e-08  27%  456 aa  GLMU_SALNS RecName: Full=Bifunctional protein glmU;Includes:
    9::212     9e-08  27%  456 aa  GLMU_SALG2 RecName: Full=Bifunctional protein glmU;Includes:
    9::212     9e-08  27%  456 aa  GLMU_SALEP RecName: Full=Bifunctional protein glmU;Includes:
    9::212     9e-08  27%  456 aa  GLMU_SALDC RecName: Full=Bifunctional protein glmU;Includes:
    9::212     9e-08  27%  456 aa  GLMU_SALCH RecName: Full=Bifunctional protein glmU;Includes:
    9::212     9e-08  27%  456 aa  GLMU_SALA4 RecName: Full=Bifunctional protein glmU;Includes:
    1::216     9e-08  31%  455 aa  GLMU_OCEIH RecName: Full=Bifunctional protein glmU;Includes:
    4::217     9e-08  27%  462 aa  GLMU_LACSS RecName: Full=Bifunctional protein glmU;Includes:
    2::214     9e-08  31%  446 aa  GLMU_FUSNN RecName: Full=Bifunctional protein glmU;Includes:
    5::221     9e-08  31%  455 aa  GLMU_CLOTE RecName: Full=Bifunctional protein glmU;Includes:
    1::244     9e-08  27%  405 aa  GLGC_CORJK RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::212     1e-07  29%  456 aa  GLMU_YERPY RecName: Full=Bifunctional protein glmU;Includes:
    9::212     1e-07  29%  456 aa  GLMU_YERPS RecName: Full=Bifunctional protein glmU;Includes:
    9::212     1e-07  29%  456 aa  GLMU_YERPP RecName: Full=Bifunctional protein glmU;Includes:
    9::212     1e-07  29%  456 aa  GLMU_YERPN RecName: Full=Bifunctional protein glmU;Includes:
    9::212     1e-07  29%  456 aa  GLMU_YERPE RecName: Full=Bifunctional protein glmU;Includes:
    9::212     1e-07  29%  456 aa  GLMU_YERPB RecName: Full=Bifunctional protein glmU;Includes:
    9::212     1e-07  29%  456 aa  GLMU_YERPA RecName: Full=Bifunctional protein glmU;Includes:
    9::212     1e-07  29%  456 aa  GLMU_YERP3 RecName: Full=Bifunctional protein glmU;Includes:
    9::212     1e-07  27%  456 aa  GLMU_YERE8 RecName: Full=Bifunctional protein glmU;Includes:
    9::212     1e-07  27%  456 aa  GLMU_SALTY RecName: Full=Bifunctional protein glmU;Includes:
    9::212     1e-07  27%  456 aa  GLMU_SALSV RecName: Full=Bifunctional protein glmU;Includes:
    9::212     1e-07  27%  456 aa  GLMU_SALHS RecName: Full=Bifunctional protein glmU;Includes:
   72::216     1e-07  32%  467 aa  GLMU_PEDPA RecName: Full=Bifunctional protein glmU;Includes:
    6::200     1e-07  32%  452 aa  GLMU_ALCBS RecName: Full=Bifunctional protein glmU;Includes:
  120::257     1e-07  37%  423 aa  GLGC_EUBE2 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   70::216     2e-07  34%  460 aa  GLMU_STRSY RecName: Full=Bifunctional protein glmU;Includes:
   70::216     2e-07  34%  460 aa  GLMU_STRS2 RecName: Full=Bifunctional protein glmU;Includes:
   69::242     2e-07  31%  460 aa  GLMU_STRPZ RecName: Full=Bifunctional protein glmU;Includes:
   58::208     2e-07  31%  458 aa  GLMU_NITEU RecName: Full=Bifunctional protein glmU;Includes:
    4::209     2e-07  28%  452 aa  GLMU_HERAR RecName: Full=Bifunctional protein glmU;Includes:
   73::240     2e-07  29%  452 aa  GLMU_ALTMD RecName: Full=Bifunctional protein glmU;Includes:
    6::200     2e-07  27%  407 aa  GLGC2_VIBCH RecName: Full=Glucose-1-phosphate adenylyltransferase
   69::242     2e-07  28%  458 aa  GLMU_STRU0 RecName: Full=Bifunctional protein glmU;Includes:
   57::246     2e-07  26%  459 aa  GLMU_STRR6 RecName: Full=Bifunctional protein glmU;Includes:
   57::246     2e-07  26%  459 aa  GLMU_STRP2 RecName: Full=Bifunctional protein glmU;Includes:
    6::200     2e-07  31%  454 aa  GLMU_SHEAM RecName: Full=Bifunctional protein glmU;Includes:
    9::212     2e-07  28%  455 aa  GLMU_SALAR RecName: Full=Bifunctional protein glmU;Includes:
    6::246     2e-07  28%  404 aa  GLGC2_VIBPA RecName: Full=Glucose-1-phosphate adenylyltransferase
   69::218     3e-07  29%  459 aa  GLMU_STRSV RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_SHISS RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_SHIFL RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_SHIF8 RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_SHIBS RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_SHIB3 RecName: Full=Bifunctional protein glmU;Includes:
    8::205     3e-07  27%  464 aa  GLMU_PELCD RecName: Full=Bifunctional protein glmU;Includes:
    1::217     3e-07  27%  460 aa  GLMU_LACPL RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_ESCF3 RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_ECOUT RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_ECOSM RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_ECOSE RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_ECOLU RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_ECOLI RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_ECOLC RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_ECOL6 RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_ECOK1 RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_ECOHS RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_ECODH RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_ECOBW RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_ECO8A RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_ECO81 RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_ECO7I RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_ECO5E RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_ECO57 RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_ECO55 RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_ECO45 RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-07  28%  456 aa  GLMU_ECO24 RecName: Full=Bifunctional protein glmU;Includes:
    9::214     4e-07  28%  456 aa  GLMU_SHIDS RecName: Full=Bifunctional protein glmU;Includes:
   59::242     4e-07  31%  456 aa  GLMU_NEIMA RecName: Full=Bifunctional protein glmU;Includes:
    9::212     4e-07  25%  456 aa  GLMU_EDWI9 RecName: Full=Bifunctional protein glmU;Includes:
    9::214     4e-07  28%  456 aa  GLMU_ECOL5 RecName: Full=Bifunctional protein glmU;Includes:
   10::213     4e-07  32%  454 aa  GLMU_ACIBS RecName: Full=Bifunctional protein glmU;Includes:
   69::246     5e-07  27%  459 aa  GLMU_STRZT RecName: Full=Bifunctional protein glmU;Includes:
   69::246     5e-07  27%  459 aa  GLMU_STRZJ RecName: Full=Bifunctional protein glmU;Includes:
   69::246     5e-07  27%  459 aa  GLMU_STRPN RecName: Full=Bifunctional protein glmU;Includes:
   69::246     5e-07  27%  459 aa  GLMU_STRPI RecName: Full=Bifunctional protein glmU;Includes:
   69::242     5e-07  29%  460 aa  GLMU_STRPG RecName: Full=Bifunctional protein glmU;Includes:
   69::242     5e-07  29%  460 aa  GLMU_STRPF RecName: Full=Bifunctional protein glmU;Includes:
   69::242     5e-07  29%  460 aa  GLMU_STRPC RecName: Full=Bifunctional protein glmU;Includes:
   69::242     5e-07  29%  416 aa  GLMU_STRPB RecName: Full=Bifunctional protein glmU;Includes:
   69::246     5e-07  27%  459 aa  GLMU_STRP7 RecName: Full=Bifunctional protein glmU;Includes:
   69::242     5e-07  29%  460 aa  GLMU_STRP6 RecName: Full=Bifunctional protein glmU;Includes:
   69::216     5e-07  33%  459 aa  GLMU_STRMU RecName: Full=Bifunctional protein glmU;Includes:
   70::217     5e-07  30%  459 aa  GLMU_LACBA RecName: Full=Bifunctional protein glmU;Includes:
    9::214     5e-07  28%  456 aa  GLMU_KLEP3 RecName: Full=Bifunctional protein glmU;Includes:
    7::209     5e-07  27%  476 aa  GLMU_DIAST RecName: Full=Bifunctional protein glmU;Includes:
   13::248     5e-07  26%  413 aa  GLGC_GEOLS RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  125::271     5e-07  31%  393 aa  GLGC_CLOPE RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   69::215     6e-07  33%  460 aa  GLMU_STRP1 RecName: Full=Bifunctional protein glmU;Includes:
    9::214     6e-07  28%  456 aa  GLMU_ECO27 RecName: Full=Bifunctional protein glmU;Includes:
  117::256     6e-07  29%  420 aa  GLGC_THELT RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   69::246     8e-07  27%  459 aa  GLMU_STRP4 RecName: Full=Bifunctional protein glmU;Includes:
    6::200     8e-07  29%  455 aa  GLMU_SHESH RecName: Full=Bifunctional protein glmU;Includes:
    6::200     8e-07  28%  454 aa  GLMU_SHELP RecName: Full=Bifunctional protein glmU;Includes:
   57::202     8e-07  35%  458 aa  GLMU_LACLA RecName: Full=Bifunctional protein glmU;Includes:
    4::208     8e-07  29%  456 aa  GLMU_HAEIN RecName: Full=Bifunctional protein glmU;Includes:
    9::212     8e-07  28%  456 aa  GLMU_ERWCT RecName: Full=Bifunctional protein glmU;Includes:
    6::214     8e-07  31%  453 aa  GLMU_DESHD RecName: Full=Bifunctional protein glmU;Includes:
    6::208     8e-07  32%  461 aa  GLMU_COLP3 RecName: Full=Bifunctional protein glmU;Includes:
    9::200     8e-07  35%  453 aa  GLMU_CELJU RecName: Full=Bifunctional protein glmU;Includes:
  120::266     8e-07  30%  388 aa  GLGC_CLOPS RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   57::218     1e-06  30%  460 aa  GLMU_STRT1 RecName: Full=Bifunctional protein glmU;Includes:
   69::242     1e-06  29%  460 aa  GLMU_STRP8 RecName: Full=Bifunctional protein glmU;Includes:
   69::242     1e-06  29%  460 aa  GLMU_STRP3 RecName: Full=Bifunctional protein glmU;Includes:
    6::214     1e-06  31%  453 aa  GLMU_DESHY RecName: Full=Bifunctional protein glmU;Includes:
   21::214     1e-06  27%  420 aa  GLGC_RHOPS RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   48::216     1e-06  28%  436 aa  GLGC_HAES2 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   48::216     1e-06  28%  436 aa  GLGC_HAES1 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    2::167     1e-06  32%  450 aa  GLMU_THEM4 RecName: Full=Bifunctional protein glmU;Includes:
   57::215     1e-06  31%  460 aa  GLMU_STRT2 RecName: Full=Bifunctional protein glmU;Includes:
   69::242     1e-06  29%  460 aa  GLMU_STRPM RecName: Full=Bifunctional protein glmU;Includes:
    3::155     1e-06  32%  446 aa  GLMU_KOSOT RecName: Full=Bifunctional protein glmU;Includes:
    4::208     1e-06  29%  456 aa  GLMU_HAEI8 RecName: Full=Bifunctional protein glmU;Includes:
   10::213     1e-06  32%  454 aa  GLMU_ACIBY RecName: Full=Bifunctional protein glmU;Includes:
   10::213     1e-06  32%  454 aa  GLMU_ACIBC RecName: Full=Bifunctional protein glmU;Includes:
    2::227     2e-06  30%  364 aa  MPG1_NEUCR RecName: Full=Mannose-1-phosphate guanyltransferase;    
   69::218     2e-06  28%  459 aa  GLMU_STRGC RecName: Full=Bifunctional protein glmU;Includes:
   55::210     2e-06  28%  454 aa  GLMU_RALME RecName: Full=Bifunctional protein glmU;Includes:
   10::212     2e-06  26%  453 aa  GLMU_NITOC RecName: Full=Bifunctional protein glmU;Includes:
    4::208     2e-06  28%  456 aa  GLMU_HAEIG RecName: Full=Bifunctional protein glmU;Includes:
   53::195     2e-06  29%  452 aa  GLMU_FERNB RecName: Full=Bifunctional protein glmU;Includes:
   77::206     2e-06  31%  487 aa  GLMU_CORJK RecName: Full=Bifunctional protein glmU;Includes:
    7::206     2e-06  29%  454 aa  GLMU_ACTSZ RecName: Full=Bifunctional protein glmU;Includes:
    2::227     2e-06  27%  362 aa  MPG1_CANAL RecName: Full=Mannose-1-phosphate guanyltransferase;    
    7::242     2e-06  24%  453 aa  GLMU_HAES1 RecName: Full=Bifunctional protein glmU;Includes:
    4::208     2e-06  28%  456 aa  GLMU_HAEIE RecName: Full=Bifunctional protein glmU;Includes:
   74::220     2e-06  32%  339 aa  GLMU_DESPS RecName: Full=Bifunctional protein glmU;Includes:
    6::200     2e-06  32%  453 aa  GLMU_AERHH RecName: Full=Bifunctional protein glmU;Includes:
    5::224     2e-06  30%  460 aa  GLMU_ACHLI RecName: Full=Bifunctional protein glmU;Includes:
  119::272     2e-06  27%  380 aa  GLGC_STRZT RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  119::272     2e-06  27%  380 aa  GLGC_STRZP RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  119::272     2e-06  27%  380 aa  GLGC_STRZJ RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  119::272     2e-06  27%  380 aa  GLGC_STRR6 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  119::272     2e-06  27%  380 aa  GLGC_STRPN RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  119::272     2e-06  27%  380 aa  GLGC_STRPJ RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  119::272     2e-06  27%  380 aa  GLGC_STRPI RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  119::272     2e-06  27%  380 aa  GLGC_STRP7 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  119::272     2e-06  27%  380 aa  GLGC_STRP2 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   28::93      2e-06  30%  712 aa  EI2BE_YEAST RecName: Full=Translation initiation factor eIF-2B
    3::214     3e-06  30%  351 aa  MPG1_EMENI RecName: Full=Mannose-1-phosphate guanyltransferase;    
   57::218     3e-06  30%  460 aa  GLMU_STRTD RecName: Full=Bifunctional protein glmU;Includes:
   70::200     3e-06  31%  455 aa  GLMU_PSEF5 RecName: Full=Bifunctional protein glmU;Includes:
    9::239     3e-06  31%  456 aa  GLMU_NEIM0 RecName: Full=Bifunctional protein glmU;Includes:
    9::214     3e-06  27%  456 aa  GLMU_KLEP7 RecName: Full=Bifunctional protein glmU;Includes:
    9::203     3e-06  29%  456 aa  GLMU_ERWT9 RecName: Full=Bifunctional protein glmU;Includes:
    7::209     3e-06  27%  476 aa  GLMU_ACISJ RecName: Full=Bifunctional protein glmU;Includes:
  119::272     3e-06  27%  379 aa  GLGC_STRU0 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  119::272     3e-06  26%  380 aa  GLGC_STRP4 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::217     3e-06  26%  431 aa  GLGC_SALTI RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   21::214     3e-06  28%  420 aa  GLGC_RHOPT RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   21::188     3e-06  28%  420 aa  GLGC_RHOPB RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   21::214     3e-06  28%  420 aa  GLGC_RHOPA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   21::214     3e-06  27%  420 aa  GLGC_RHOP5 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   21::214     3e-06  27%  420 aa  GLGC_RHOP2 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   70::242     4e-06  28%  460 aa  GLMU_STRSZ RecName: Full=Bifunctional protein glmU;Includes:
   57::202     4e-06  38%  458 aa  GLMU_LACLM RecName: Full=Bifunctional protein glmU;Includes:
   57::216     4e-06  29%  461 aa  GLMU_LACGA RecName: Full=Bifunctional protein glmU;Includes:
    7::242     4e-06  24%  453 aa  GLMU_HAES2 RecName: Full=Bifunctional protein glmU;Includes:
   24::252     4e-06  32%  463 aa  GLMU_CALS8 RecName: Full=Bifunctional protein glmU;Includes:
    5::209     4e-06  31%  452 aa  GLMU_ALISL RecName: Full=Bifunctional protein glmU;Includes:
  119::272     4e-06  27%  380 aa  GLGC_STRPS RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  119::259     4e-06  30%  386 aa  GLGC_CLOD6 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   69::242     5e-06  26%  459 aa  GLMU_STRA3 RecName: Full=Bifunctional protein glmU;Includes:
    6::200     5e-06  30%  454 aa  GLMU_SHESW RecName: Full=Bifunctional protein glmU;Includes:
    6::200     5e-06  30%  454 aa  GLMU_SHEPC RecName: Full=Bifunctional protein glmU;Includes:
    6::200     5e-06  27%  454 aa  GLMU_SHEPA RecName: Full=Bifunctional protein glmU;Includes:
    6::200     5e-06  28%  454 aa  GLMU_SHEHH RecName: Full=Bifunctional protein glmU;Includes:
    9::211     5e-06  31%  456 aa  GLMU_NEIMF RecName: Full=Bifunctional protein glmU;Includes:
    7::206     5e-06  30%  454 aa  GLMU_MARAV RecName: Full=Bifunctional protein glmU;Includes:
   57::202     5e-06  38%  458 aa  GLMU_LACLS RecName: Full=Bifunctional protein glmU;Includes:
    6::209     5e-06  32%  461 aa  GLMU_HYPNA RecName: Full=Bifunctional protein glmU;Includes:
  118::256     5e-06  28%  412 aa  GLGC_THEM4 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   30::220     5e-06  29%  439 aa  GLGC_PASMU RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  130::295     5e-06  33%  422 aa  GLGC2_ALHEH RecName: Full=Glucose-1-phosphate adenylyltransferase
   12::204     7e-06  30%  459 aa  GLMU_THISH RecName: Full=Bifunctional protein glmU;Includes:
   54::201     7e-06  32%  450 aa  GLMU_THELT RecName: Full=Bifunctional protein glmU;Includes:
   69::242     7e-06  26%  459 aa  GLMU_STRA5 RecName: Full=Bifunctional protein glmU;Includes:
   69::242     7e-06  26%  459 aa  GLMU_STRA1 RecName: Full=Bifunctional protein glmU;Includes:
   59::223     7e-06  26%  461 aa  GLMU_LEGPC RecName: Full=Bifunctional protein glmU;Includes:
   59::223     7e-06  26%  461 aa  GLMU_LEGPA RecName: Full=Bifunctional protein glmU;Includes:
    1::205     7e-06  26%  460 aa  GLMU_GEOLS RecName: Full=Bifunctional protein glmU;Includes:
    4::211     7e-06  27%  459 aa  GLMU_CLOD6 RecName: Full=Bifunctional protein glmU;Includes:
  119::257     7e-06  28%  380 aa  GLGC_STRGC RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   46::190     7e-06  30%  420 aa  GLGC_RHISN RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   15::246     7e-06  26%  414 aa  GLGC_BIFLI RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   57::200     9e-06  32%  454 aa  GLMU_PSEA7 RecName: Full=Bifunctional protein glmU;Includes:
    6::216     9e-06  29%  461 aa  GLMU_LACJO RecName: Full=Bifunctional protein glmU;Includes:
   22::205     9e-06  27%  431 aa  GLGC_KLEP7 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::200     1e-05  29%  454 aa  GLMU_SHEWM RecName: Full=Bifunctional protein glmU;Includes:
  119::278     1e-05  27%  380 aa  GLGC_STRSV RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   19::212     1e-05  27%  417 aa  GLGC_GRABC RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     1e-05  26%  431 aa  GLGC_ESCF3 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  119::265     1e-05  25%  383 aa  GLGC_BACHD RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    2::174     1e-05  26%  359 aa  GMPPB_DICDI RecName: Full=Mannose-1-phosphate guanyltransferase
    6::200     1e-05  30%  454 aa  GLMU_SHEFN RecName: Full=Bifunctional protein glmU;Includes:
    9::224     1e-05  29%  456 aa  GLMU_NEIMB RecName: Full=Bifunctional protein glmU;Includes:
   22::205     1e-05  27%  431 aa  GLGC_KLEP3 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::257     1e-05  27%  431 aa  GLGC_ECO7I RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   57::199     2e-05  31%  455 aa  GLMU_PSEPF RecName: Full=Bifunctional protein glmU;Includes:
    6::200     2e-05  30%  452 aa  GLMU_PSEMY RecName: Full=Bifunctional protein glmU;Includes:
   57::200     2e-05  31%  454 aa  GLMU_PSEAE RecName: Full=Bifunctional protein glmU;Includes:
   57::200     2e-05  31%  454 aa  GLMU_PSEAB RecName: Full=Bifunctional protein glmU;Includes:
   57::200     2e-05  31%  454 aa  GLMU_PSEA8 RecName: Full=Bifunctional protein glmU;Includes:
   66::212     2e-05  32%  460 aa  GLMU_NITMU RecName: Full=Bifunctional protein glmU;Includes:
    5::213     2e-05  26%  456 aa  GLMU_CLOAB RecName: Full=Bifunctional protein glmU;Includes:
  118::256     2e-05  26%  412 aa  GLGC_THEAB RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  119::257     2e-05  29%  379 aa  GLGC_STRS7 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   71::200     3e-05  33%  454 aa  GLMU_RALEH RecName: Full=Bifunctional protein glmU;Includes:
    9::202     3e-05  29%  447 aa  GLMU_PROM5 RecName: Full=Bifunctional protein glmU;Includes:
   68::212     3e-05  28%  452 aa  GLMU_AZOSB RecName: Full=Bifunctional protein glmU;Includes:
   22::197     3e-05  27%  431 aa  GLGC_SALAR RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   21::252     3e-05  25%  419 aa  GLGC_NOVAD RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  120::266     3e-05  28%  383 aa  GLGC_CLOK5 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    5::209     3e-05  29%  453 aa  GLMU_VIBVY RecName: Full=Bifunctional protein glmU;Includes:
    5::209     3e-05  29%  453 aa  GLMU_VIBVU RecName: Full=Bifunctional protein glmU;Includes:
   57::199     3e-05  31%  455 aa  GLMU_PSEFS RecName: Full=Bifunctional protein glmU;Includes:
   68::210     3e-05  28%  453 aa  GLMU_BURPS RecName: Full=Bifunctional protein glmU;Includes:
   68::210     3e-05  28%  453 aa  GLMU_BURP6 RecName: Full=Bifunctional protein glmU;Includes:
   68::210     3e-05  28%  453 aa  GLMU_BURP1 RecName: Full=Bifunctional protein glmU;Includes:
   68::210     3e-05  28%  453 aa  GLMU_BURP0 RecName: Full=Bifunctional protein glmU;Includes:
   68::210     3e-05  28%  453 aa  GLMU_BURMS RecName: Full=Bifunctional protein glmU;Includes:
   68::210     3e-05  28%  453 aa  GLMU_BURMA RecName: Full=Bifunctional protein glmU;Includes:
   68::210     3e-05  28%  453 aa  GLMU_BURM7 RecName: Full=Bifunctional protein glmU;Includes:
    9::158     3e-05  31%  461 aa  GLMU_BUCAP RecName: Full=Bifunctional protein glmU;Includes:
  119::257     3e-05  31%  379 aa  GLGC_STRA5 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  119::257     3e-05  31%  379 aa  GLGC_STRA1 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_SHISS RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_SHIFL RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_SHIF8 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_SHIDS RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_SHIBS RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_SHIB3 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   15::227     3e-05  26%  423 aa  GLGC_RHORU RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   15::227     3e-05  26%  423 aa  GLGC_RHORT RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   46::190     3e-05  30%  420 aa  GLGC_RHIME RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  118::257     3e-05  25%  385 aa  GLGC_OCEIH RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_ECOUT RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_ECOSM RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_ECOSE RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_ECOLU RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_ECOLI RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_ECOLC RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_ECOL6 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_ECOL5 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_ECOHS RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_ECODH RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_ECOBW RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_ECO8A RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_ECO81 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_ECO5E RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_ECO57 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_ECO55 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_ECO45 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::204     3e-05  26%  431 aa  GLGC_ECO24 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    5::209     4e-05  30%  452 aa  GLMU_VIBFM RecName: Full=Bifunctional protein glmU;Includes:
    5::209     4e-05  30%  452 aa  GLMU_VIBF1 RecName: Full=Bifunctional protein glmU;Includes:
  119::257     4e-05  29%  379 aa  GLGC_STRA3 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   46::214     4e-05  29%  420 aa  GLGC_RHIE6 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   48::295     4e-05  25%  434 aa  GLGC_MANSM RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  119::265     4e-05  28%  380 aa  GLGC_LACS1 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   13::248     4e-05  27%  412 aa  GLGC_GEOMG RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  119::265     4e-05  28%  379 aa  GLGC_BACLD RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    4::58      4e-05  38%  452 aa  EI2BG_RAT RecName: Full=Translation initiation factor eIF-2B
    4::69      4e-05  35%  452 aa  EI2BG_BOVIN RecName: Full=Translation initiation factor eIF-2B
   27::92      4e-05  26%  732 aa  EI2BE_CANAL RecName: Full=Translation initiation factor eIF-2B
    5::209     6e-05  28%  453 aa  GLMU_VIBHB RecName: Full=Bifunctional protein glmU;Includes:
    6::200     6e-05  28%  454 aa  GLMU_SHEPW RecName: Full=Bifunctional protein glmU;Includes:
    9::242     6e-05  27%  456 aa  GLMU_NEIGO RecName: Full=Bifunctional protein glmU;Includes:
    9::242     6e-05  27%  456 aa  GLMU_NEIG1 RecName: Full=Bifunctional protein glmU;Includes:
   59::223     6e-05  26%  461 aa  GLMU_LEGPH RecName: Full=Bifunctional protein glmU;Includes:
    2::176     6e-05  29%  461 aa  GLMU_HYDS0 RecName: Full=Bifunctional protein glmU;Includes:
   44::254     6e-05  25%  431 aa  GLGC_ACTSZ RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    4::56      6e-05  40%  452 aa  EI2BG_HUMAN RecName: Full=Translation initiation factor eIF-2B
    6::200     7e-05  28%  454 aa  GLMU_SHESA RecName: Full=Bifunctional protein glmU;Includes:
    9::212     7e-05  26%  456 aa  GLMU_CITK8 RecName: Full=Bifunctional protein glmU;Includes:
   65::200     7e-05  30%  455 aa  GLMU_CHRVO RecName: Full=Bifunctional protein glmU;Includes:
   70::208     7e-05  32%  446 aa  GLMU_CARHZ RecName: Full=Bifunctional protein glmU;Includes:
   19::158     1e-04  30%  451 aa  GLMU_SACD2 RecName: Full=Bifunctional protein glmU;Includes:
   70::200     1e-04  30%  455 aa  GLMU_PSESM RecName: Full=Bifunctional protein glmU;Includes:
    4::208     1e-04  25%  458 aa  GLMU_PASMU RecName: Full=Bifunctional protein glmU;Includes:
   59::223     1e-04  26%  461 aa  GLMU_LEGPL RecName: Full=Bifunctional protein glmU;Includes:
   57::212     1e-04  27%  455 aa  GLMU_CLOB8 RecName: Full=Bifunctional protein glmU;Includes:
   68::210     1e-04  28%  453 aa  GLMU_BURP8 RecName: Full=Bifunctional protein glmU;Includes:
   98::272     1e-04  27%  520 aa  GLGS_BRANA RecName: Full=Glucose-1-phosphate adenylyltransferase
   68::210     1e-04  29%  454 aa  GLMU_RALEJ RecName: Full=Bifunctional protein glmU;Includes:
    1::206     1e-04  26%  454 aa  GLMU_MANSM RecName: Full=Bifunctional protein glmU;Includes:
   66::212     1e-04  28%  454 aa  GLMU_CLOPS RecName: Full=Bifunctional protein glmU;Includes:
   68::210     1e-04  29%  453 aa  GLMU_BURCH RecName: Full=Bifunctional protein glmU;Includes:
   68::210     1e-04  29%  453 aa  GLMU_BURCA RecName: Full=Bifunctional protein glmU;Includes:
   68::198     1e-04  30%  453 aa  GLMU_BURA4 RecName: Full=Bifunctional protein glmU;Includes:
   99::273     1e-04  27%  521 aa  GLGS_SOLTU RecName: Full=Glucose-1-phosphate adenylyltransferase
   79::253     1e-04  27%  489 aa  GLGS_BETVU RecName: Full=Glucose-1-phosphate adenylyltransferase
   22::197     1e-04  26%  427 aa  GLGC_ENTS8 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::244     1e-04  23%  435 aa  GLGC_ACIAC RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    2::227     2e-04  26%  364 aa  MPG1_TRIRE RecName: Full=Mannose-1-phosphate guanyltransferase;    
    6::209     2e-04  27%  453 aa  GLMU_PSEA6 RecName: Full=Bifunctional protein glmU;Includes:
   70::200     2e-04  31%  455 aa  GLMU_PSE14 RecName: Full=Bifunctional protein glmU;Includes:
   81::214     2e-04  30%  495 aa  GLMU_NOCFA RecName: Full=Bifunctional protein glmU;Includes:
    5::215     2e-04  30%  449 aa  GLMU_EXIS2 RecName: Full=Bifunctional protein glmU;Includes:
   73::212     2e-04  27%  454 aa  GLMU_CLOPE RecName: Full=Bifunctional protein glmU;Includes:
    5::213     2e-04  30%  456 aa  GLMU_CLOK5 RecName: Full=Bifunctional protein glmU;Includes:
    5::213     2e-04  30%  456 aa  GLMU_CLOK1 RecName: Full=Bifunctional protein glmU;Includes:
    9::113     2e-04  36%  469 aa  GLMU_BAUCH RecName: Full=Bifunctional protein glmU;Includes:
   75::213     2e-04  29%  454 aa  GLMU_ACIAD RecName: Full=Bifunctional protein glmU;Includes:
   99::273     2e-04  27%  521 aa  GLGS_SOLLC RecName: Full=Glucose-1-phosphate adenylyltransferase
  119::265     2e-04  27%  379 aa  GLGC_STRMU RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  119::247     2e-04  27%  250 aa  GLGC_BACCL RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  112::247     2e-04  26%  404 aa  GLGC_AZOSE RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  120::247     2e-04  23%  404 aa  GLGC_AZOSB RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    4::56      2e-04  38%  452 aa  EI2BG_MACFA RecName: Full=Translation initiation factor eIF-2B
    6::209     2e-04  27%  453 aa  GLMU_VIBCM RecName: Full=Bifunctional protein glmU;Includes:
    6::209     2e-04  28%  453 aa  GLMU_VIBC3 RecName: Full=Bifunctional protein glmU;Includes:
    6::200     2e-04  27%  449 aa  GLMU_VESOH RecName: Full=Bifunctional protein glmU;Includes:
   73::212     2e-04  27%  454 aa  GLMU_CLOP1 RecName: Full=Bifunctional protein glmU;Includes:
    3::213     2e-04  26%  456 aa  GLMU_CLONN RecName: Full=Bifunctional protein glmU;Includes:
   68::210     2e-04  27%  453 aa  GLMU_BURPP RecName: Full=Bifunctional protein glmU;Includes:
    8::199     2e-04  28%  458 aa  GLMU_BDEBA RecName: Full=Bifunctional protein glmU;Includes:
  118::260     2e-04  26%  423 aa  GLGC_THESQ RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  118::260     2e-04  26%  423 aa  GLGC_THEMA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   49::196     2e-04  26%  437 aa  GLGC_HAEI8 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  118::256     2e-04  27%  415 aa  GLGC_FERNB RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  120::259     2e-04  29%  382 aa  GLGC_CLONN RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    2::111     3e-04  34%  451 aa  GLMU_THEAB RecName: Full=Bifunctional protein glmU;Includes:
   13::214     3e-04  27%  458 aa  GLMU_SODGM RecName: Full=Bifunctional protein glmU;Includes:
    6::200     3e-04  27%  454 aa  GLMU_SHESR RecName: Full=Bifunctional protein glmU;Includes:
   84::214     3e-04  31%  485 aa  GLMU_CORGL RecName: Full=Bifunctional protein glmU;Includes:
   68::210     3e-04  29%  453 aa  GLMU_BURM1 RecName: Full=Bifunctional protein glmU;Includes:
   22::195     3e-04  22%  425 aa  GLGC_SERP5 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  101::257     3e-04  29%  381 aa  GLGC_LACAC RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::209     4e-04  28%  453 aa  GLMU_VIBCH RecName: Full=Bifunctional protein glmU;Includes:
    9::205     4e-04  34%  449 aa  GLMU_PROMS RecName: Full=Bifunctional protein glmU;Includes:
    9::205     4e-04  32%  449 aa  GLMU_PROM2 RecName: Full=Bifunctional protein glmU;Includes:
   70::200     4e-04  31%  454 aa  GLMU_AZOVD RecName: Full=Bifunctional protein glmU;Includes:
   16::235     4e-04  24%  423 aa  GLGC_FRAP2 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::205     5e-04  31%  449 aa  GLMU_PROM9 RecName: Full=Bifunctional protein glmU;Includes:
   84::214     5e-04  31%  485 aa  GLMU_CORGB RecName: Full=Bifunctional protein glmU;Includes:
   92::266     5e-04  27%  514 aa  GLGS_ORYSJ RecName: Full=Glucose-1-phosphate adenylyltransferase
  118::260     5e-04  25%  423 aa  GLGC_THENN RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   20::227     5e-04  25%  419 aa  GLGC_ROSDO RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  120::257     5e-04  29%  380 aa  GLGC_LACCB RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  120::257     5e-04  29%  380 aa  GLGC_LACC3 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  120::266     5e-04  28%  386 aa  GLGC_CLOB8 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    3::242     6e-04  25%  451 aa  GLMU_STAES RecName: Full=Bifunctional protein glmU;Includes:
    3::242     6e-04  25%  451 aa  GLMU_STAEQ RecName: Full=Bifunctional protein glmU;Includes:
    3::242     6e-04  25%  451 aa  GLMU_STAEP RecName: Full=Bifunctional protein glmU;Includes:
   70::200     6e-04  30%  452 aa  GLMU_PSEU5 RecName: Full=Bifunctional protein glmU;Includes:
   75::206     6e-04  31%  460 aa  GLMU_PELPD RecName: Full=Bifunctional protein glmU;Includes:
   33::203     6e-04  31%  450 aa  GLMU_MICAN RecName: Full=Bifunctional protein glmU;Includes:
    6::78      6e-04  26%  476 aa  GLMU_GEOMG RecName: Full=Bifunctional protein glmU;Includes:
   73::210     6e-04  31%  453 aa  GLMU_BURVG RecName: Full=Bifunctional protein glmU;Includes:
  119::207     6e-04  27%  404 aa  GLGC_MYCSS RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   16::235     6e-04  24%  423 aa  GLGC_FRATW RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   16::235     6e-04  24%  423 aa  GLGC_FRATO RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   16::235     6e-04  24%  423 aa  GLGC_FRATN RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   16::235     6e-04  24%  423 aa  GLGC_FRATH RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   16::235     6e-04  24%  423 aa  GLGC_FRATF RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  120::259     6e-04  25%  386 aa  GLGC_EXIS2 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::202     6e-04  26%  417 aa  GLGC_ACIBL RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   18::71      8e-04  33%  253 aa  ISPD_IDILO RecName: Full=2-C-methyl-D-erythritol 4-phosphate
   76::212     8e-04  28%  466 aa  GLMU_SOLUE RecName: Full=Bifunctional protein glmU;Includes:
   65::200     8e-04  31%  452 aa  GLMU_RUTMC RecName: Full=Bifunctional protein glmU;Includes:
   75::211     8e-04  27%  452 aa  GLMU_PSEHT RecName: Full=Bifunctional protein glmU;Includes:
   73::198     8e-04  30%  453 aa  GLMU_BURCM RecName: Full=Bifunctional protein glmU;Includes:
   73::210     8e-04  29%  453 aa  GLMU_BURCC RecName: Full=Bifunctional protein glmU;Includes:
    5::203     8e-04  28%  457 aa  GLMU_BORPE RecName: Full=Bifunctional protein glmU;Includes:
  118::260     8e-04  26%  423 aa  GLGC_THEP1 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  121::266     8e-04  27%  399 aa  GLGC_DESRM RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    1::287

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKIRKAVFPVAGWGTRFLPATKSCPKEMLTVVDKPLIQYAVEEAIEAGCKEIIFVTSSNKKSLEDHFDRN
GALU_HAEIN      ----KAVIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECVAAGIKEIVLVTHSSKNAIENHFDTS
GALU_HAEDU      ----KVIIPVAGLGTRMLPATKAIPKEMLTIADKPLIQYIVNECVAAGIKEIVFVTHSSKNAIENHFDTS
GALU_PSEAE      --IKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYAVEEALEAGLSEIGIVTGRGKRSLEDHFDIS
CAP4C_STRPN     -KVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSKRSIEDHFDSN
GALU_SHIFL      -KVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTHSSKNSIENHFDTS
GALU_ECOLI      -KVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTHSSKNSIENHFDTS
GALU_ECOL6      -KVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTHSSKNSIENHFDTS
GALU_ECO57      -KVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTHSSKNSIENHFDTS
GALU2_PSEAE     --IKKYLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLNEISIVTGRGKRALEDHFDIS
HASC_STRPY      -KVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVTGKAKRSIEDHFDSN
HASC1_STRP8     -KVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVTGKAKRSIEDHFDSN
HASC1_STRP1     -KVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVTGKAKRSIEDHFDSN
HASC2_STRP6     -KVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVTGKAKRSIEDHFDSN
HASC1_STRP3     -KVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVTGKAKRSIEDHFDSN
HASC2_STRP8     -KVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILIVTGKSKRSIEDHFDSN
HASC2_STRP3     -KVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILIVTGKSKRSIEDHFDSN
HASC2_STRP1     -KVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILIVTGKSKRSIEDHFDSN
HASC1_STRP6     -KVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILIVTGKSKRSIEDHFDSN
GTAB2_STAS1     -KIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGKHKRAIEDHFDNQ
CAP3C_STRPN     -KVKKAVIPAAGLGTRFLPATKALAKEMLPIVDRPTIHFVIEEALRSGIEDILVVTGKSKRSIEDYFDST
GTAB1_STAS1     MKIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAVAAGIEDIIIVTGKHKRAIEDHFDNQ
GTAB_BACSU      -KVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTGKSKRAIEDHFDYS
GTAB_STAHJ      -QIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEASRAGIEDIIIVTGKHKRAIEDHFDNQ
GTAB_STAES      -----------GLGTRFLPATKAMPKEMLPILDKPTIQYIVEEASKAGIEDIIIVTGKHKRAIEDHFDNQ
GTAB_STAEQ      -----------GLGTRFLPATKAMPKEMLPILDKPTIQYIVEEASKAGIEDIIIVTGKHKRAIEDHFDNQ
Y1334_METJA     --IRKAVIPVAGFGTRLLPITKAQPKEMLPVVNKPIVQYVVEDLVEAGVKDILFVTGKGKQAIENHFDVN
EXON_RHIME      --VRKAVIPVAGNGTRFLPATKAVPKEMLTIVDRPVVQYAVDEARQAGIEHIVFVTSRNKQVIEDHFDDA
GALU_MYCPN      -KIRKAVIPAAGLGTRLLPATKAIPKEMLPLVNKPTIQYIVEEAVASGIKEILVIVSSKKEAIIDHFDYD
CELA_ACEXY      --LKKAVLPVAGLGTRFLPATKCVPKEMLTVVDRPLIQYAIDEAREAGIEEFCLVSSRGKDSLIDYFDIS
GALU_MYCGE      -KIRKAVIPAAGLGVRLLPATKAIPKEMLPLVNKPTIQYIVEEAVKSGIEQILVIVSSKKTAILDHFDYD
GTAB_STAAW      -----------GLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRHKRAIEDHFDSQ
GTAB_STAAS      -----------GLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRHKRAIEDHFDSQ
GTAB_STAAN      -----------GLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRHKRAIEDHFDSQ
GTAB_STAAM      -----------GLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRHKRAIEDHFDSQ
GTAB_STAAC      -----------GLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRHKRAIEDHFDSQ
GTAB_STAA8      -----------GLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRHKRAIEDHFDSQ
GTAB_STAA3      -----------GLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRHKRAIEDHFDSQ
GTAB_STAAR      -----------GLGTRFLPATKAMPKEMLPILDKPTIQYIIEEAARAGIEDIIIVTGRHKRAIEDHFDSQ
GTAB_STAAB      -----------GLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRHKRAIEDHFDSQ
GALF_SALTY      ----KAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHASKNAVENHFDTS
GALF_SALTI      ----KAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHASKNAVENHFDTS
GALF_KLEPN      ----KAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHSSKNAVENHFDTS
GALF_ECOLI      ----KAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASKNAVENHFDTS
GALF_ECO57      ----KAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASKNAVENHFDTS
GALF_SHIFL      ----KAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASKNAVENHFDTS
YTDA_BACSU      --IKKAIIPAGGFGTRNLPVTKVIPKEMFPVGSKPVIHYLVEELKESGIEDILMVVSSHKNLIVDYFDSS
GLMU_METM5      -----AIILCAGKGTRLHPITESRPKPMIPIAGKPILEHIIEK-IENHVEKIYLVVGFEKEKIIEYFNEN
GLMU_METM7      -----AIILCAGKGTRLYPITESRPKPMIPIAGKPILEHIIEK-IENYVEKIYLVVGXXXXXXXXXXXXN
GLMU_METVS      -----AVILCAGSGTRLYPITENRPKPMIPIAGKPILEHIIEK-IENHVEKIYLVVGFEKEKIIDYFYGN
GLMU_META3      -----AVILCAGKGTRLMPLTENIPKPMLPVGGAPILERIINK-IDKLVENIYLIVKYEKEIIINHFKNN
RMLA1_ECOLI     MKMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQQQLLGDGSQWG
RMLA_SALAN      MKTRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQQQLLGDGSQWG
RMLA_SALTY      MKTRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQQQLLGDGSQWG
RMLA1_SHIFL     MKTRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQQQLLGDGSQWG
GLMU_METMP      -----AIILCAGKGTRLHPITESRPKPMIPIAGKPXXXXXXXXXXXXXXXXYLIV-GYQKEKIIDYFKDN
RMLA3_ECOLX     MKTRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQQQLLGDGSQWG
RMLA_STRMU      ----KGIILAGGSGTRLYPLTRAASKQLMPVYDKPMIYYPLSTLMLAGIKDILIISTPQKELLQDGSEFG
GLMU_METJA      -----AIILCAGKGERLRPLTENRPKPMIPIAGKPILQHIIEK-------------------VEDLVDNI
RMLA_NEIMB      ----KGIILAGGSGTRLYPITRGVSKQLLPVYDKPMIYYPLSVLMLAGIRDILVITASFKRLLGDGSDFG
RMLA_XANCP      MTQRKGIILAGGSGTRLYPITKGVSKQLLPVYDKPMIYYPLSVLMLAGIRDILIINTPHEQAL-------
RMLA_XANCB      MTQRKGIILAGGSGTRLYPITKGVSKQLLPVYDKPMIYYPLSVLMLAGIRDILIINTPHEQAL-------
RMLA_NEIMA      ----KGIILAGGSGTRLYPITRGVSKQLLPVYDKPMIYYPLSVLMLAGIRDILVITASFKRLLGDGSDFG
STRD_STRGR      ----KALVLAGGTGTRLRPITHTSAKQLVPVANKPVLFYGLEAIRAAGIIDVGIVVG----------DTA
RMLA_NEIGO      ----KGIILAGGSGTRLYPITRGVSKQLLPVYDKPMIYYPLSVLMLAGIRDILVITAPEQRLLGDGSDFG
SPSI_BACSU      ----KGVILAGGNGSRLMPLTKAVNKHLLPVGPYPMIYWSIMKLQEAGIKDILLIS--------------
GMPPB_DROPS     ----RALILVGGYGTRLRPLTLSTPKPLVEFANKPILLHQLEALVDAGCRQVILAVSYRAEQMEK-----
MPG1_CRYNE      ----KALILVGGFGTRLRPLTLSWPKPLVEFCNKAMILHQIEALVKAGVKDIVLVMVSVLKKTEEEFGIN
MPG12_CANGA     ----KGLILVGGYGTRLRPLTLSVPKPLVEFCNRPMILHQIEALAEAGVTDIVLAVNYRPEVMVDTL-KK
GMPPB_DROME     ----RALILVGGYGTRLRPLTLSTPKPLVEFANKPILLHQLEALVDAGCRQVILAVSYRAE---------
GLMU_GEOUR      -----AVILAAGKGTRM---KSNIVKVMHPLGGLPMVSWPVNTAREAGASNIVLVTGHQSEKVQDFFEGQ
RMLA2_SHIFL     ----KGIILAGGSGTRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLAGIREILIITTPEDKGLGDGSEFG
RMLA2_ECOLI     ----KGIILAGGSGTRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLAGIREILIITTPEDKGLGDGSEFG
GLMU_THETN      -----SVILAAGLGKRM---KSKYPKVVHKVCGKPMVKWVVEAAQEAGSKEVIVVVGHGREMVEEVL--G
GLMU_LISW6      MSKRYAVVLAAGQGTRM---KSKLYKVLHPVCGKPMVEHVVDQISTLDVDKVVTIVGHGAEKVQEHLAGK
RMLA_YEREN      ----KGIVLAGGAGTRLHPITRGVSKQLLPVYDKPMIYYPISVLMLAGIQDILIISTSFKRLLGDGSQFG
GLMU_LISMO      MSKRYAVVLAAGQGTRM---KSKLYKVLHPVCGKPMVEHVVDQISTLNVDKVVTIVGHGAEKVQEHLAGK
GLMU_LISMH      MSKRYAVVLAAGQGTRM---KSKLYKVLHPVCGKPMVEHVVDQISTLNVDKVVTIVGHGAEKVQEHLAGK
GLMU_LISMF      MSKRYAVVLAAGQGTRM---KSKLYKVLHPVCGKPMVEHVVDQISTLNVDKVVTIVGHGAEKVQEHLAGK
GLMU_LISMC      MSKRYAVVLAAGQGTRM---KSKLYKVLHPVCGKPMVEHVVDQISTLNVDKVVTIVGHGAEKVQEHLAGK
MPG1_YEAST      ----KGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANAGVTDIVLVMVETLKKYEKEYGVN
GLMU_LISIN      MSKRYAVVLAAGQGTRM---KSKLYKVLHPVCGKPMVEHVVDQISTLDVDKVVTIVGHGAEKVQEHLAGK
MPG1_PICAN      ----KGLILVGGYGTRLRPLTLSLPKPLVEFGNRPMILHQIEALANAGCTDIVLAVNYKPEVMVGAL-KQ
MPG1_KLULA      ----KGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALAAAGVTDIVLVMVETLKKYEDEFGVS
MPG11_CANGA     ----KGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANAGVTDIVLAVNCRPEVMVETLQK-
MPG1_GIBZE      ----KGLILVGGYGTRLRPLTLSVPKPLVEFANKPMIVHQIEALVAAGVTDIVLAVNYRPEVMEEKFGIN
ACBA_ACTS5      ----RGILLAGGTGSRLRPVTWAVSKQLMPVYDKPMIYYPLATLVSCGIREILVITTETQRLLGDGSQWG
GMPPB_CAEEL     ----KALILVGGYGTRLRPLTLTQPKPLVEFANKPMMLHQMEALAEVGVDTVVLAVSYRAEQLEQHADRG
MPG1_ASHGO      ----KGLILVGGYGTRLRPLTLTVPKPLVEFCNRPMILHQIEALAAAGVTDIVLAVNYRPEVMVETL-KK
GLMU_THESQ      ----RALVLAAGKGTRM---KSKIPKVLHPLSGKPMIEWVVETAGKVAQKVGVVL--------------G
GLMU_PECCP      ------VILAAGKGTRMY---SDLPKVLHKLAGKPMVQHVIDAAMTTGAQHVHLVYGHGGDLL-------
GLMU_THEP1      ----RALVLAAGKGTRM---KSKIPKVLHPLSGKPMIEWVVETAGKVAQKVGVVL--------------G
GLMU_ENTS8      ------VILAAGKGTRMY---SDLPKVLHTLAGKPMVQHVIDAAKHVGAQHIHLVYGHGG----------
RMLA_RHISN      ----KGIILAGGSGTRLHPMTLVMSKQILPVYDKPMIFYPLTTLMLAGIREILIISTPHHMPL-------
GLMU_THEMA      ----RALVLAAGKGTRM---KSKIPKVLHPLSGRPMIEWVIETAGKVAQKVGVVL--------------G
GLMU_GEOSL      -----AIILAAGKGTRM---KSGIVKVMHPLAGAPMVAWPVAVARQAGAGRIVAVVGHQAERLREHFSND
GLMU_BACA2      MDKRFAVILAAGKGTRM---KSKLYKVLHPVCGKPMVEHVADEALKLSLAKLVTIVGHGAE---------
GLGC_MYCMO      -----AMILAGGQGTRLKNLTKKIAKPAVPFGAKRIIDFTLSNCINSGIDTVGVLTQYRPLSLLKHIGSG
GLMU_SERP5      ------VILAAGKGTRMY---SDLPKVLHPLAGKPMVQHVIDAAMKLGAKNVHLVYGHGG----------
MPG1_SULAC      -----AIVLAGGYATRLRPLSLTKPKALLPVLGKPLMDYTLYSLASSDVDTIYLSLRVMADKVLDHVKQ-
GLMU_ENTFA      MENRYAIILAAGKGTRM---KSKLYKVLHPVAGKPMVEHILDQVEQTEPTEIVTIVGHGAEMIKSH----
GMPPB_CAEBR     ----KALILVGGYGTRLRPLTLTQPKPLVEFANKPMMLHQMEALAAVGVDTVVLAVSYRAEQLEAHADRG
GLMU_BACSU      MDKRFAVVLAAGQGTRM---KSKLYKVLHPVCGKPMVEHVVDEALKLSLSKLVTIVGHGAE---------
GLMU_BACLD      MDKRFAVVLAAGQGTRM---KSKLYKVLHPVCGKPMVEHVVDEARKLSLEKLVTIVGHGAE---------
GMPPB_DANRE     ----KALILVGGYGTRLRPLTLTVPKPLVEFCNKPILLHQVEALVKAGVRHVILAVSYMSELLEREMEQR
GLMU_BACHD      MSNRFAVILAAGQGTRM---KSKLYKVLHSVCGKPMVQHVVDQVSALGFDEIVTIIGHG-----------
GMPPB_XENTR     ----KALILVGGYGTRLRPLTLSVPKPLVDFCNKPILLHQVEALVKAGVNHVILAVSYMSDMLEKEM---
GMPBB_XENLA     ----KALILVGGYGTRLRPLTLSVPKPLVDFCNKPILLHQVEALVKAGVTHVILAVSYMSDMLEKEM---
GLMU_BACSK      MSGRFAVILAAGQGTRM---KSKLYKVLHPVCGKPMVEHVVDQVSKL------------------EFDKT
GLMU_LACS1      MTSKYAIILAAGQGTRM---KSKLYKVLHPVCGKPMVDHVLTEIEKNNMDEIVTVVGHGAEMVEK-----
GLMU_SYNWW      -----AVILAAGKGLRM---RSDLPKVAHRVAGKPIILHVIQAVKEAGIEDIXXXXXXXXXXXQE-----
GLMU_RHOFD      ------VIMAAGKGTRM---KSKLPKVLHLLAGRALLQHVVDTAAQLSARQVVVITGHGAMEVEAAVSGN
GMPBA_XENLA     ----KALILVGGYGTRLRPLTLSVPKPLVDFCNKPILLHQVEALVKAGVTHVILAVSYMSDMLEKEM---
GMPPB_MOUSE     ----KALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQMLEKEM---
GLMU_PHOLL      ---KSVVILAAGKGTRMY---SDLPKVLHLLAGKPMVQHVIDTAMALGAKNVHLVYGHGG----------
GLMU_LACRJ      MTKRNAIILAAGKGTRM---RSKLYKVLHQVCGKTMVEHVLTQLEKAKIDNIITIVGFGAETVEQQ----
GLMU_LACRD      MTKRNAIILAAGKGTRM---RSKLYKVLHQVCGKTMVEHVLTQLEKAKIDNIITIVGFGAETVEQQ----
GMPPB_PIG       ----KALILVGGYGTRLRPLTLSIPKPLVDFCNKPILLHQVEALASAGVDHVILAVSKEMKAQEQRLGIR
GMPPB_HUMAN     ----KALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQVLEKEM---
GLMU_THEP3      ------------------------PKVVHKVCGKPMIEWVVDAVEEIGSKEVIVVVGHXXXXXXXXXXXX
GLMU_NITEC      ----------------------------------------------------------------------
GMPPB_BOVIN     ----KALILVGGYGTRLRPLTLSIPKPLADFCNKPILLHQVEALAAAGVDHVILAVSYMSQVLEKEM---
GLMU_THEYD      ------VILAAGLGTRM---KSSKPKVLHRILEKPIIDYVIDCAKSLNPFNSFVVINPSLKEVAEHLEK-
GLMU_SALTI      ------VILAAGKGTRMY---SDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTL---
GLMU_SALPK      ------VILAAGKGTRMY---SDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTL---
GLMU_SALPB      ------VILAAGKGTRMY---SDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTL---
GLMU_SALPA      ------VILAAGKGTRMY---SDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTL---
GLMU_SALNS      ------VILAAGKGTRMY---SDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTL---
GLMU_SALG2      ------VILAAGKGTRMY---SDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTL---
GLMU_SALEP      ------VILAAGKGTRMY---SDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTL---
GLMU_SALDC      ------VILAAGKGTRMY---SDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTL---
GLMU_SALCH      ------VILAAGKGTRMY---SDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTL---
GLMU_SALA4      ------VILAAGKGTRMY---SDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTL---
GLMU_OCEIH      MANRFAVILAAGQGTRM----KSKLHKMLPVAGRPMVQHVVDQLQQVNLNKIVTIVGFGAEKVKAQLGSS
GLMU_LACSS      ---KNAIILAAGKGTRM---KSKLYKVLHEVCGRPMVDHVLTEVEKTEPATVVTIVGHGAEKVKDY----
GLMU_FUSNN      ----KSIIMAAGKGTRM---KSDLPKVVHLAHGKPMIVRIIDALNTLDVEENILILG-------------
GLMU_CLOTE      -----AILLAAGEGKRMKSAT---PKVLHKVCGKEMVNHVIDALREANIEDVNVIVGKKAK---------
GLGC_CORJK      MKSRSNVLSIVGEGKRLYPFTADRAKPAVPFGGNRLIDFVLSNLVNAGYYKICVLTQYKSHSLDRHIS--
GLMU_YERPY      ------VILAAGKGTRMY---SDLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLVYGHGG----------
GLMU_YERPS      ------VILAAGKGTRMY---SDLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLVYGHGG----------
GLMU_YERPP      ------VILAAGKGTRMY---SDLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLVYGHGG----------
GLMU_YERPN      ------VILAAGKGTRMY---SDLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLVYGHGG----------
GLMU_YERPE      ------VILAAGKGTRMY---SDLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLVYGHGG----------
GLMU_YERPB      ------VILAAGKGTRMY---SDLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLVYGHGG----------
GLMU_YERPA      ------VILAAGKGTRMY---SDLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLVYGHGG----------
GLMU_YERP3      ------VILAAGKGTRMY---SDLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLVYGHGG----------
GLMU_YERE8      ------VILAAGKGTRMY---SDLPKVLHPLAGKPMVQHVIDAAMKLGAQQVHLVYGHGGELLQKTLT--
GLMU_SALTY      ------VILAAGKGTRMY---SDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTL---
GLMU_SALSV      ------VILAAGKGTRMY---SDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTL---
GLMU_SALHS      ------VILAAGKGTRMY---SDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTL---
GLMU_PEDPA      ----------------------------------------------------------------------
GLMU_ALCBS      ------VILAAGKGTRMKSAL---PKVLHAVAGKPMVQHVVDAAASLEPANTVIVYGHGGEQVK------
GLGC_EUBE2      ----------------------------------------------------------------------
GLMU_STRSY      ----------------------------------------------------------------------
GLMU_STRS2      ----------------------------------------------------------------------
GLMU_STRPZ      ----------------------------------------------------------------------
GLMU_NITEU      ----------------------------------------------------------------------
GLMU_HERAR      ------VILAAGMGKRMQSAL---PKVLHPLAGKPLLSHVIDTARQLSPSTLCII---------------
GLMU_ALTMD      ----------------------------------------------------------------------
GLGC2_VIBCH     -----AVILAGGMGSRLSPLTDDRAKPAVPFGGKRIIDFTLTNCLHSGLRRILVLTQYKSHSLHKHLRNG
GLMU_STRU0      ----------------------------------------------------------------------
GLMU_STRR6      ----------------------------------------------------------------------
GLMU_STRP2      ----------------------------------------------------------------------
GLMU_SHEAM      ------VILAAGKGTRM---RSDLPKVLHSVAHKPMVQHVIDTARELNADNINLVYGYGGELL-------
GLMU_SALAR      ------VILAAGKGTRMY---SDIPKVLHTLAGKAMVQHVIDAANELGASQVHLVYGHGG----------
GLGC2_VIBPA     -----AVILAGGMGSRLSPLTDDRAKPAVPFGGKRIIDFTLTNCLNSGLRKILVLTQYKSHSLQKHLRDG
GLMU_STRSV      ----------------------------------------------------------------------
GLMU_SHISS      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_SHIFL      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_SHIF8      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_SHIBS      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_SHIB3      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_PELCD      -----AVILAAGKGTRM---KSEQPKVLHPIAGKPMVTFPVAGALKHGCQPTVLVVGHGAEAVQ------
GLMU_LACPL      MTTKNAIIMAAGKGTRM---KSKLVKVLHQVCGKSMVDHVLTQVEATHMANIVTIVGHGAK---------
GLMU_ESCF3      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_ECOUT      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_ECOSM      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_ECOSE      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_ECOLU      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_ECOLI      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_ECOLC      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_ECOL6      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_ECOK1      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_ECOHS      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_ECODH      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_ECOBW      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_ECO8A      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_ECO81      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_ECO7I      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_ECO5E      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_ECO57      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_ECO55      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_ECO45      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_ECO24      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_SHIDS      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_NEIMA      ----------------------------------------------------------------------
GLMU_EDWI9      ------VILAAGKGTRMY---SDLPKVLHPLAGKPMVQHVIDSALTLGARQVHLVYGHGGDLLKAHLSGQ
GLMU_ECOL5      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
GLMU_ACIBS      ----------AGKGTRM---RSQLPKVLQPLAGRPLLGHVIKTAKQLLAENIITIYGHGG----DHVKKT
GLMU_STRZT      ----------------------------------------------------------------------
GLMU_STRZJ      ----------------------------------------------------------------------
GLMU_STRPN      ----------------------------------------------------------------------
GLMU_STRPI      ----------------------------------------------------------------------
GLMU_STRPG      ----------------------------------------------------------------------
GLMU_STRPF      ----------------------------------------------------------------------
GLMU_STRPC      ----------------------------------------------------------------------
GLMU_STRPB      ----------------------------------------------------------------------
GLMU_STRP7      ----------------------------------------------------------------------
GLMU_STRP6      ----------------------------------------------------------------------
GLMU_STRMU      ----------------------------------------------------------------------
GLMU_LACBA      ----------------------------------------------------------------------
GLMU_KLEP3      ------VILAAGKGTRMY---SDLPKVLHTLAGKPMVQHVIDAANDLGACAVHLVYGHGG----------
GLMU_DIAST      ------IIMAAGKGTRM---KSRIPKVLQRLAGRPLLHHVLGQAASLQARRVVVVTGHGATEVEXXXXXX
GLGC_GEOLS      -----AMVLAGGKGERLMPLTLRRAKPSVTFGGKKIIDFVLSNLFNSGIRRMYILTQYRAYSLNKHIRES
GLGC_CLOPE      ----------------------------------------------------------------------
GLMU_STRP1      ----------------------------------------------------------------------
GLMU_ECO27      ------VILAAGKGTRMY---SDLPKVLHTLAGKTMVQHVIDAANELGAAHVHLVYGHGG----------
GLGC_THELT      ----------------------------------------------------------------------
GLMU_STRP4      ----------------------------------------------------------------------
GLMU_SHESH      ------VILAAGKGTRM---RSELPKVLHPIAHKSMVQHVIDTAHSVGSDAIQLVYG-------------
GLMU_SHELP      ------VILAAGKGTRM---RSDLPKVLHPIAHKSMVQHVIDTAHQLGSEAIQLVYGYGADKLQARLGEQ
GLMU_LACLA      ----------------------------------------------------------------------
GLMU_HAEIN      -KALSAVILAAGKGTRMY---SDLPKVLHTIAGKPMVKHVIDTAHQLGSENIHLIYGHGGDLMRTHL-AN
GLMU_ERWCT      ------VILAAGKGTRMY---SDLPKVLHKLAGKPMVQHVIDAAMTTGAQHVHLVYGHGGDLL-------
GLMU_DESHD      -----AVIMAAGKGTRM---KSKLPKVMHTLAGKPMLQHVLDCVRSVEIPRSMVVLGHGREQIEATLDDR
GLMU_COLP3      ------VILAAGKGTRM---RSSLPKVLHSVAEKPMVGHVIDSARQLGASNIYVVYGFGG----------
GLMU_CELJU      ----------AGKGTRM---RSDLPKVLHPIGGKPLVQHVVDTARQVGGEQLLLIVGHGAEQVE------
GLGC_CLOPS      ----------------------------------------------------------------------
GLMU_STRT1      ----------------------------------------------------------------------
GLMU_STRP8      ----------------------------------------------------------------------
GLMU_STRP3      ----------------------------------------------------------------------
GLMU_DESHY      -----AVIMAAGKGTRM---KSKLPKVMHTLAGKPMLQHVLDCVRSVEIPRSMVVLGHGREQIEATLDDR
GLGC_RHOPS      -----------GRGSRLMELTDRRAKPAVYFGGKSIIDFALSNALNSGIRRIAVATQYKAHSLIRHLQRG
GLGC_HAES2      --------------------------------NRRIIDFALSNCINSGLNRIGVVTQYAAHSLLRHLQKG
GLGC_HAES1      --------------------------------NRRIIDFALSNCINSGLNRIGVVTQYAAHSLLRHLQKG
GLMU_THEM4      ----KTLILAAGLGKRM---NSKYPKVIHKIFNKPMINWVIETAKNFGKVAVVL----------------
GLMU_STRT2      ----------------------------------------------------------------------
GLMU_STRPM      ----------------------------------------------------------------------
GLMU_KOSOT      -----AIILAAGLGKRM---KSEIPKVVHSILGLPMINWVLRAVKKAGIENIIVVTG-------------
GLMU_HAEI8      -KALSAVILAAGKGTRMY---SDLPKVLHTIAGKPMVKHVIDIAHQLGSENIHLIYGHGGDLMRTHL-AN
GLMU_ACIBY      ----------AGKGTRM---RSQLPKVLQPLAGRPLLGHVIKTAKQLLAENIITIYGHGG----DHVKKT
GLMU_ACIBC      ----------AGKGTRM---RSQLPKVLQPLAGRPLLGHVIKTAKQLLAENIITIYGHGG----DHVKKT
MPG1_NEUCR      ----KALILVGGFGTRLRPLTLTMPKPLVEFGNKRMILHQIEALAAAGVTDIVLAVNYRPEIMEKYFGIN
GLMU_STRGC      ----------------------------------------------------------------------
GLMU_RALME      ----------------------------------------------------------------------
GLMU_NITOC      ----------AGQGTRM---HSTLPKVLHQLAGRPLLSHVIATARQLNPAQIIVVYGHGGETVPEAF---
GLMU_HAEIG      -KALSAVILAAGKGTRMY---SDLPKVLHTIAGKPMVKHVIDTAHQLGAENIHLIYGHGGDLMRSHL-AN
GLMU_FERNB      ----------------------------------------------------------------------
GLMU_CORJK      ----------------------------------------------------------------------
GLMU_ACTSZ      ------VILAAGKGTRMY---SDLPKVLHKVAGKPMVKHVIDTAKQLSAEQIHLIYGHGADLLKERL---
MPG1_CANAL      ----KGLILVGGYGXXXXXXXXXXXXXXVEFGNRPMILHQIEALAAAGVTDIVLAVNSTLKKYEEEYGVS
GLMU_HAES1      ------VILAAGKGTRMY---SDLPKVLHKIAGKPMVKHVIDTAKKLSAAQIHLIYGHGADLLKQHL---
GLMU_HAEIE      -KALSAVILAAGKGTRMY---SDLPKVLHTIAGKPMVKHVIDTAHQLGAENIHLIYGHGGDVMRTHL-AN
GLMU_DESPS      ----------------------------------------------------------------------
GLMU_AERHH      ------VILAAGKGTRM---RSSLPKVLHPVANKPMVSHVIETARKVGAEQLHLVYGHGAELL-------
GLMU_ACHLI      -----ALVLAAGKGTRM---KSDIPKVAFPILRKPMIEYIVENIEKSSVEEIYLVLGYKREVVEG-----
GLGC_STRZT      ----------------------------------------------------------------------
GLGC_STRZP      ----------------------------------------------------------------------
GLGC_STRZJ      ----------------------------------------------------------------------
GLGC_STRR6      ----------------------------------------------------------------------
GLGC_STRPN      ----------------------------------------------------------------------
GLGC_STRPJ      ----------------------------------------------------------------------
GLGC_STRPI      ----------------------------------------------------------------------
GLGC_STRP7      ----------------------------------------------------------------------
GLGC_STRP2      ----------------------------------------------------------------------
EI2BE_YEAST     ----QAVVLTDSYETRFMPLTAVKPRCLLPLANVPLIEYTLEFLAKAGVHEVFLICSSHANQINDYIENS
MPG1_EMENI      ------------------PLTLTLPKPLVEFGNRPMILHQVESLAAAGVTDIVLVMVSALKKYEEQYNVK
GLMU_STRTD      ----------------------------------------------------------------------
GLMU_PSEF5      ----------------------------------------------------------------------
GLMU_NEIM0      ------VILAAGKGTRMY---SKMPKVLHRIGGKPMLGRVIDTAAALNPQNICVVVGHGKE---------
GLMU_KLEP7      ------VILAAGKGTRMY---SDLPKVLHTLAGKPMVQHVIDAANDLGACAVHLVYGHGG----------
GLMU_ERWT9      ------VILAAGKGTRMY---SDLPKVLHLLAGKPMVQHVIDAARELNAQRVNLVYGHGGELLKTALD--
GLMU_ACISJ      ------IIMAAGKGTRM---KSRIPKVLQRLAGRPLLHHVLGQAASLQARRVVVVTGHGATEVEAACAGS
GLGC_STRU0      ----------------------------------------------------------------------
GLGC_STRP4      ----------------------------------------------------------------------
GLGC_SALTI      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRG
GLGC_RHOPT      -----------GRGSRLMELTDWRAKPAVYFGGKSIIDFALSNALNSGIRRIAVATQYKAHSLIRHLQRG
GLGC_RHOPB      -----------GRGSRLMELTDRRAKPAVYFGGKSIIDFALSNALNSGIRRIAVATQYKAHSLIRHLQHG
GLGC_RHOPA      -----------GRGSRLMELTDWRAKPAVYFGGKSIIDFALSNALNSGIRRIAVATQYKAHSLIRHLQRG
GLGC_RHOP5      -----------GRGSRLMELTDRRAKPAVYFGGKSIIDFALSNALNSGIRRIAVATQYKAHSLIRHLQHG
GLGC_RHOP2      -----------GRGSRLMELTDRRAKPAVYFGGKSIIDFALSNALNSGIRRIAVATQYKAHSLIRHLQRG
GLMU_STRSZ      ----------------------------------------------------------------------
GLMU_LACLM      ----------------------------------------------------------------------
GLMU_LACGA      ----------------------------------------------------------------------
GLMU_HAES2      ------VILAAGKGTRMY---SDLPKVLHKIAGKPMVKHVIDTAKKLSAAQIHLIYGHGADLLKQHL---
GLMU_CALS8      -------------------------KVVQKIMGKPMILYIIDEIEKNFEDGRIVVVVGNKKE--------
GLMU_ALISL      -----AVILAAGKGTRMY---SNKPKVLHTLAGKPMAKHVIDTCEGLGAKNIHLVYG--------HGGDQ
GLGC_STRPS      ----------------------------------------------------------------------
GLGC_CLOD6      ----------------------------------------------------------------------
GLMU_STRA3      ----------------------------------------------------------------------
GLMU_SHESW      ------VILAAGKGTRM---RSDLPKVLHPIAHKSMVQHVIDTAHSIGSDAIQLVYGYGAD---------
GLMU_SHEPC      ------VILAAGKGTRM---RSDLPKVLHPIAHKSMVQHVIDTAHSIGSDAIQLVYGYGAD---------
GLMU_SHEPA      ------VILAAGKGTRM---RSDLPKVLHPIAHKSMVQHVIDTAYQVGSDAIQLVYGYGADKLQARLGEQ
GLMU_SHEHH      ------VILAAGKGTRM---RSDLPKVLHPIAHKSMVQHVIDTAHQVGSDAIQLVYGYGAD---------
GLMU_NEIMF      ------VILAAGKGTRMY---SKMPKVLHRIGGKPMLGRVIDTAAALNPQNICVVIGHGK----------
GLMU_MARAV      ------VILAAGQGSRM---KSSLPKVLHPVAGKAMLHHVVDTAKQLGAEKIHTVIGHGAD---------
GLMU_LACLS      ----------------------------------------------------------------------
GLMU_HYPNA      -KQRAAVILAAGKGTRM---KSPLPKVMHAVGGRPMMDWSIALARQVGAERIVAVVHPSQDVLIAHLGKH
GLGC_THEM4      ----------------------------------------------------------------------
GLGC_PASMU      -----------GRGSRLYELTDKRAKPALYFGNRRIIDFALSNCLNSGLNRIGVVTQYAAHSLLRHLQNG
GLGC2_ALHEH     ----------------------------------------------------------------------
GLMU_THISH      ----------AGQGTRM---RSSLPKVLQPLAGRPLLSHVLDTARSLDPHRLVVVYGHGG----------
GLMU_THELT      ----------------------------------------------------------------------
GLMU_STRA5      ----------------------------------------------------------------------
GLMU_STRA1      ----------------------------------------------------------------------
GLMU_LEGPC      ----------------------------------------------------------------------
GLMU_LEGPA      ----------------------------------------------------------------------
GLMU_GEOLS      MAISAALILAAGKGTRMKSALVKVLHEL---AGRPMLGWPLAAAREAGAGQIVIVAGHQADQVQKRFGAD
GLMU_CLOD6      ----KAIILAAGKGTRM---KSKYPKVIHKVCGKEMVNHIIDVSKKSGVKDTVVILGHEA----------
GLGC_STRGC      ----------------------------------------------------------------------
GLGC_RHISN      -----------------------------------IIDFALSNALNSGIRRIGVATQYKAHSLIRHLQRG
GLGC_BIFLI      -----------GEGTRLMPLTRDRAKPAVPFGGVRLIDFPLSNLVNSGYRQVVVLTQYKSHSLDRHISQV
GLMU_PSEA7      ----------------------------------------------------------------------
GLMU_LACJO      ------VILAAGKGTRM---KSKLYKVLHKVCGKTMVEHVVEAAKGTNPDKIITVVGNGAES--------
GLGC_KLEP7      -----ALILAGGRGTRLKDLTIKRAKPAVHFGGKRIIDFALSNCINSGIRRIGVITQYQSHTLVQHIQRG
GLMU_SHEWM      ------VILAAGKGTRM---RSDLPKVLHPIAHKSMVQHVIDTAHNVGSDAIQLVYG-------------
GLGC_STRSV      ----------------------------------------------------------------------
GLGC_GRABC      -----------GRGSRLLELTDTRAKPAVYFGGKSIIDFALSNAVNSGIRRIGVATQYKAHSLIRHMQRG
GLGC_ESCF3      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRIGVITQYQSHTLVQHIQRG
GLGC_BACHD      ----------------------------------------------------------------------
GMPPB_DICDI     ----KALILVGGFGTRLRPLTLSKPKPIVEFANKAMILHQIEALCKIGVNEVVLAVNYRPQLMSQYLE--
GLMU_SHEFN      ------VILAAGKGTRM---RSDLPKVLHPIAHKSMVQHVIDTANSLGSSAIQLVYG-------------
GLMU_NEIMB      ------VILAAGKGTRMY---SKMPKVLHRIGGKPMVGRVIDTAAALNPQNICVVIGHGKE---------
GLGC_KLEP3      -----ALILAGGRGTRLKDLTIKRAKPAVHFGGKRIIDFALSNCINSGIRRIGVITQYQSHTLVQHIQRG
GLGC_ECO7I      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLMU_PSEPF      ----------------------------------------------------------------------
GLMU_PSEMY      ------VILAAGQGTRMRSAL---PKVLHPVANKPMLGHVIDTARSLQPQSIQVVIGHGA----------
GLMU_PSEAE      ----------------------------------------------------------------------
GLMU_PSEAB      ----------------------------------------------------------------------
GLMU_PSEA8      ----------------------------------------------------------------------
GLMU_NITMU      ----------------------------------------------------------------------
GLMU_CLOAB      -----ALILAAGKGKRM---KSDLPKVLHKVCDKEMVNHVIDTMRKSELQDVNVVIGKGAELVREATSKK
GLGC_THEAB      ----------------------------------------------------------------------
GLGC_STRS7      ----------------------------------------------------------------------
GLMU_RALEH      ----------------------------------------------------------------------
GLMU_PROM5      ----------AGKGTRM---ASSLPKVLHKLSGKTLLQRVIDSCNELKPDKIFIIVGHKSKEVKDSVFKN
GLMU_AZOSB      ----------------------------------------------------------------------
GLGC_SALAR      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRG
GLGC_NOVAD      -----------GRGSRLKELTDNRAKPAVYFGGKSIIDFALSNAINSGIRRIGVATQYKAHSLIRHMQRA
GLGC_CLOK5      ----------------------------------------------------------------------
GLMU_VIBVY      -----AVILAAGKGTRMY---SNMPKVLHTLAGKPMVKHVIDTCTGLGAQ-------------------N
GLMU_VIBVU      -----AVILAAGKGTRMY---SNMPKVLHTLAGKPMVKHVIDTCTGLGAQ-------------------N
GLMU_PSEFS      ----------------------------------------------------------------------
GLMU_BURPS      ----------------------------------------------------------------------
GLMU_BURP6      ----------------------------------------------------------------------
GLMU_BURP1      ----------------------------------------------------------------------
GLMU_BURP0      ----------------------------------------------------------------------
GLMU_BURMS      ----------------------------------------------------------------------
GLMU_BURMA      ----------------------------------------------------------------------
GLMU_BURM7      ----------------------------------------------------------------------
GLMU_BUCAP      ------VILAAGKGTRM---QSSYPKVLHKLGGKTILEHVINIAKSVKPKKIILVYNNKEKEIKSKIS--
GLGC_STRA5      ----------------------------------------------------------------------
GLGC_STRA1      ----------------------------------------------------------------------
GLGC_SHISS      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLGC_SHIFL      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLGC_SHIF8      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLGC_SHIDS      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLGC_SHIBS      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLGC_SHIB3      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLGC_RHORU      LKETLALVLAGGRGSRLRDLTNRESKPAVPFGGKRIIDFPLSNCMNSGIRRMCVITQYRAHTLIHHIQRG
GLGC_RHORT      LKETLALVLAGGRGSRLRDLTNRESKPAVPFGGKRIIDFPLSNCMNSGIRRMCVITQYRAHTLIHHIQRG
GLGC_RHIME      -----------------------------------IIDFALSNALNSGIRRIGVATQYKAHSLIRHLQRG
GLGC_OCEIH      ----------------------------------------------------------------------
GLGC_ECOUT      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLGC_ECOSM      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLGC_ECOSE      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLGC_ECOLU      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLGC_ECOLI      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLGC_ECOLC      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLGC_ECOL6      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLGC_ECOL5      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLGC_ECOHS      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLGC_ECODH      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLGC_ECOBW      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLGC_ECO8A      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLGC_ECO81      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLGC_ECO5E      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLGC_ECO57      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLGC_ECO55      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLGC_ECO45      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLGC_ECO24      -----ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRG
GLMU_VIBFM      -----AVILAAGKGTRMY---SNKPKVLHTLAGKPMAKHVIDTCEGLGAQNIHLVYG--------HGGDQ
GLMU_VIBF1      -----AVILAAGKGTRMY---SNKPKVLHTLAGKPMAKHVIDTCEGLGAQNIHLVYG--------HGGDQ
GLGC_STRA3      ----------------------------------------------------------------------
GLGC_RHIE6      -----------------------------------IIDFALSNALNSGIRRIGVATQYKAHSLIRHMQRG
GLGC_MANSM      --------------------------------NRRIIDFALSNCINSGLNRIGVITQYAAHSLLRHLQTG
GLGC_LACS1      ----------------------------------------------------------------------
GLGC_GEOMG      -----AMVLAGGKGERLAPLTLRRPKPGVAFGGKKIIDFVLSNMFNSGIKKVYILTQYRAYSLMKHIRES
GLGC_BACLD      ----------------------------------------------------------------------
EI2BG_RAT       ----QAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTKD-----------
EI2BG_BOVIN     ----QAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVITTKDQKALCADFNK-
EI2BE_CANAL     ----QAIVLTDSFETRFMPLTAVHPRCLLPLANVPLIEYTLEFLANAGVNEVYLMCSAHADQIQEYIENS
GLMU_VIBHB      -----AVILAAGKGTRMY---SNMPKVLHTLAGKPMAKHVIDTCTGLGAQNIHLVYGHGGDQMQ------
GLMU_SHEPW      ------VILAAGKGTRM---RSDLPKVLHPIAHKSMVQHVIDTAHEVGSDAIQLVYGYGAD---------
GLMU_NEIGO      ------VILAAGKGTRMY---SQMPKVLHCIGGKPMVERVIDTAAALNPQNICVVVGHGKE---------
GLMU_NEIG1      ------VILAAGKGTRMY---SQMPKVLHCIGGKPMVERVIDTAAALNPQNICVVVGHGKE---------
GLMU_LEGPH      ----------------------------------------------------------------------
GLMU_HYDS0      ----KAIILAAGLGTRFKSEKHKVLHEML---GKPIIWYVLNYIKQSNIVDIALVVSHKKES--------
GLGC_ACTSZ      --------------------------------NRRIIDFALSNCINSGLNRIGVITQYAAHSLLRHLQTG
EI2BG_HUMAN     ----QAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTT-------------
GLMU_SHESA      ------VILAAGKGTRM---RSDLPKVLHPIAHKSMVQHVIDTAHSIGSNAIQLVYGYGADKLKS-----
GLMU_CITK8      ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGASQVHLV---------------
GLMU_CHRVO      ----------------------------------------------------------------------
GLMU_CARHZ      ----------------------------------------------------------------------
GLMU_SACD2      -------------------------------------------------KPKVLHTLAGKPFLEHVLDRS
GLMU_PSESM      ----------------------------------------------------------------------
GLMU_PASMU      -KALSIVILAAGKGTRMY---SDLPKVLHKIAGKPMVKHVIDTVKSIHAKNIHLVYGHGGEVMQTRL---
GLMU_LEGPL      ----------------------------------------------------------------------
GLMU_CLOB8      ----------------------------------------------------------------------
GLMU_BURP8      ----------------------------------------------------------------------
GLGS_BRANA      -----------GAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRA
GLMU_RALEJ      ----------------------------------------------------------------------
GLMU_MANSM      MKKLSVVILAAGKGTRMY---SDLPKVLHKIAGKPMVKHVIDTAKQLSADQIHLIYGHGADLLKSHL---
GLMU_CLOPS      ----------------------------------------------------------------------
GLMU_BURCH      ----------------------------------------------------------------------
GLMU_BURCA      ----------------------------------------------------------------------
GLMU_BURA4      ----------------------------------------------------------------------
GLGS_SOLTU      -----------GAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRA
GLGS_BETVU      -----------GAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRA
GLGC_ENTS8      -----ALILAGGRGTRLKDLTATRAKPAVHFGGKRIIDFALSNCINSGIRRIGVITQYQSHTLVQHIQRG
GLGC_ACIAC      -----AIVMAGGEGSRLHPLTAERCKPAVPFNGKHIVDFVLSNLVNSEIYSIYLLVQYKSQSLIEHIRQS
MPG1_TRIRE      ----KGLILVGGFGXXXXXXXXXXXXXXVEFCNKPMIVHQIEALVAAGVTDIVLAVNYRPEIMEKFLAEN
GLMU_PSEA6      ------VILAAGKGTRM---KSSMPKVLHPIGAKPMVQRIIDTVHQLGAASINLVYGHQAEQLQQALGHN
GLMU_PSE14      ----------------------------------------------------------------------
GLMU_NOCFA      ----------------------------------------------------------------------
GLMU_EXIS2      -----AVILAAGKGTRM---KSKLYKVLHPVAGKPMVQHVVDQLTTLGVTRQVVIVGHGAESVKEVLGTS
GLMU_CLOPE      ----------------------------------------------------------------------
GLMU_CLOK5      -----AIILAAGEGKRM---KSSKPKVLHKICGKEMINVVIDVVKKAQIKDINVVIGKNSEKVK------
GLMU_CLOK1      -----AIILAAGEGKRM---KSSKPKVLHKICGKEMINVVIDVVKKAQIKDINVVIGKNSEKVK------
GLMU_BAUCH      ------VILAAGKSTRM---NSDIPKVLHLLAGKPILQYVIDTAIKAKCKSTIYIVYGYKGEL-------
GLMU_ACIAD      ----------------------------------------------------------------------
GLGS_SOLLC      -----------GAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRA
GLGC_STRMU      ----------------------------------------------------------------------
GLGC_BACCL      ----------------------------------------------------------------------
GLGC_AZOSE      ----------------------------------------------------------------------
GLGC_AZOSB      ----------------------------------------------------------------------
EI2BG_MACFA     ----QAVVMAVGGGSRMTDLTSSIPKPLLPAGNKPLIWYPLNLLERVGFEEVIVVTT-------------
GLMU_VIBCM      ------VILAAGKGTRM---HSNMPKVLHTLAGKPMVKHVIDTCNNLGAQNIHLVYGHGGDQMQ------
GLMU_VIBC3      ------VILAAGKGTRM---HSNMPKVLHTLAGKPMVKHVIDTCNNLGAQ-------------------N
GLMU_VESOH      -----AIILAAGKGTR-MNSTK--PKVLQILSNNTLLEHVLSQ-VKTLCNKI------------------
GLMU_CLOP1      ----------------------------------------------------------------------
GLMU_CLONN      ---KSAVILAAGKGTRMKSAL---PKVLHKVCGKEMVNQVIDTLRKSDIEDIDLVIGNGAEEVKK-----
GLMU_BURPP      ----------------------------------------------------------------------
GLMU_BDEBA      ----------AGKGTRM---KSPLPKVLHPVAGRPMIEKVIQASKQAGAAEVRVIVGHGQ----------
GLGC_THESQ      ----------------------------------------------------------------------
GLGC_THEMA      ----------------------------------------------------------------------
GLGC_HAEI8      --------------------------------NRRIIDFALSNCINSGLNRIGVVTQYAAHSLLRHLQTG
GLGC_FERNB      ----------------------------------------------------------------------
GLGC_CLONN      ----------------------------------------------------------------------
GLMU_THEAB      ----KTLILAAGLGKRM---NSKYPKVIHKILGKPMINWVIDTAKSFG----------------------
GLMU_SODGM      ----------AGKGSRMF---STLPKVLHPLAGKAMVQHVIDTAMRLGASRIHLVYGHGGELLRERLARQ
GLMU_SHESR      ------VILAAGKGTRM---RSDLPKVLHPIAHKSMVQHVIDTAIGSDAIQLVYGYGADK----------
GLMU_CORGL      ----------------------------------------------------------------------
GLMU_BURM1      ----------------------------------------------------------------------
GLGC_SERP5      -----ALILAGGRGSRLKDLTSTRAKPAVHFGGKRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRG
GLGC_LACAC      ----------------------------------------------------------------------
GLMU_VIBCH      ------VILAAGKGTRM---HSNMPKVLHTLAGKPMVKHVIDTCNNLGAQ-------------------N
GLMU_PROMS      ----------AGKGTRM---ESSLPKVLHKISGKSLLQRVIDSCAELKPDKIFVITGHKSKE--------
GLMU_PROM2      ----------AGKGTRM---ESSLPKVLHKISGKSLLQRVIDSCVELKPDQIFVITGHKSKEVE------
GLMU_AZOVD      ----------------------------------------------------------------------
GLGC_FRAP2      -----ALVLAGGRGSRLYNLTDTRAKPAVYFGGKRIVDFALSNCLNSGIRRIGVVTQYKSHSLLRHIQRG
GLMU_PROM9      ----------AGKGTRM---ESSIPKVLHKISGKSLLQRVIDSCVELNPDQIFVITGHKSKEVQES----
GLMU_CORGB      ----------------------------------------------------------------------
GLGS_ORYSJ      -----------GAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRA
GLGC_THENN      ----------------------------------------------------------------------
GLGC_ROSDO      -----------GRGSRLYELTDRRAKPAMYFGGKSIIDFPLSNAVNSGIRRIGVATQYKAHSLIRHLQRG
GLGC_LACCB      ----------------------------------------------------------------------
GLGC_LACC3      ----------------------------------------------------------------------
GLGC_CLOB8      ----------------------------------------------------------------------
GLMU_STAES      ---RHAIILAAGKGTRM----KSKKYKVLEVAGKPMVEHVLNNVKQAGVDQIVTIIGHGAESVKDTLGN-
GLMU_STAEQ      ---RHAIILAAGKGTRM----KSKKYKVLEVAGKPMVEHVLNNVKQAGVDQIVTIIGHGAESVKDTLGN-
GLMU_STAEP      ---RHAIILAAGKGTRM----KSKKYKVLEVAGKPMVEHVLNNVKQAGVDQIVTIIGHGAESVKDTLGN-
GLMU_PSEU5      ----------------------------------------------------------------------
GLMU_PELPD      ----------------------------------------------------------------------
GLMU_MICAN      -------------------------------------------------------------------ERV
GLMU_GEOMG      -----AIILAAGKGTRM---KSDLVKVMHPLAGAPMVAWPVEAARQAGTSRMVLVVGHQADTIREHFAGT
GLMU_BURVG      ----------------------------------------------------------------------
GLGC_MYCSS      ----------------------------------------------------------------------
GLGC_FRATW      -----ALVLAGGRGSRLYNLTDTRAKPAVYFGGKRIIDFALSNCLNSGIRRIGVVTQYKSHSLLRHLQRG
GLGC_FRATO      -----ALVLAGGRGSRLYNLTDTRAKPAVYFGGKRIIDFALSNCLNSGIRRIGVVTQYKSHSLLRHLQRG
GLGC_FRATN      -----ALVLAGGRGSRLYNLTDTRAKPAVYFGGKRIIDFALSNCLNSGIRRIGVVTQYKSHSLLRHLQRG
GLGC_FRATH      -----ALVLAGGRGSRLYNLTDTRAKPAVYFGGKRIIDFALSNCLNSGIRRIGVVTQYKSHSLLRHLQRG
GLGC_FRATF      -----ALVLAGGRGSRLYNLTDTRAKPAVYFGGKRIIDFALSNCLNSGIRRIGVVTQYKSHSLLRHLQRG
GLGC_EXIS2      ----------------------------------------------------------------------
GLGC_ACIBL      ------VLLAGGAGERLYPLTRDRAKPAVNFGGYRIIDITLSNCINSGLRRVYILTQYKALSLNRHIREG
ISPD_IDILO      -----AVIPAAGSGSRM---QANIPKQFLMVANRTLLEYSIEAVLKDARVEQVFVAVSDSNA--------
GLMU_SOLUE      ----------------------------------------------------------------------
GLMU_RUTMC      ----------------------------------------------------------------------
GLMU_PSEHT      ----------------------------------------------------------------------
GLMU_BURCM      ----------------------------------------------------------------------
GLMU_BURCC      ----------------------------------------------------------------------
GLMU_BORPE      ------VILAAGLGKRM---QSDLPKVLHTLAGRPMLDHVIGSARQLQPARIIVVVGHGADRVKAAFEGQ
GLGC_THEP1      ----------------------------------------------------------------------
GLGC_DESRM      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FELEYSLEKKQKYELLDLVKNIIPKDVSFFFVRQPEALGLGHAVLCAKPLVGIEDFAVILPDDLIYNHDC
GALU_HAEIN      FELETMLEKRVKRQLLEEVRSICPKNVTIMHVRQGNAKGLGHAVLCGRPLVGNESFAVMLPDVLLFSADQ
GALU_HAEDU      FELETMLEKRVKRQLLDEVRSIVPNDVTLMHVRQGQAKGLGHAVLCGKAVVGKEPFAVVLPDVILFTANP
GALU_PSEAE      YELEHQIRNTDKEKYLVGIRRLI-DECTFAYTRQVEMKGLGHAILTGRPLIGDEPFAVVLADDLCLNLE-
CAP4C_STRPN     FELEYNLKEKGKTDLLKLVDK--TTDMRLHFIRQTHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMITDEK
GALU_SHIFL      FELEAMLEKRVKRQLLDEVQSICPPHVTIMQVRQGLAKGLGHAVLCAHPVVGDEPVAVILPDVILYESDL
GALU_ECOLI      FELEAMLEKRVKRQLLDEVQSICPPHVTIMQVRQGLAKGLGHAVLCAHPVVGDEPVAVILPDVILYESDL
GALU_ECOL6      FELEAMLEKRVKRQLLDEVQSICPPHVTIMQVRQGLAKGLGHAVLCAHPVVGDEPVAVILPDVILYESDL
GALU_ECO57      FELEAMLEKRVKRQLLDEVQSICPPHVTIMQVRQGLAKGLGHAVLCAHPVVGDEPVAVILPDVILYESDL
GALU2_PSEAE     YELENQIKGTDKEKYLVGIRKLL-DECSFSYTRQTQMKGLGHAILTGRPLIGDEPFAVVLADDLCVNLE-
HASC_STRPY      FELEYNLQAKGKNELLKLVDETTA--INLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNA
HASC1_STRP8     FELEYNLQAKGKNELLKLVDETTA--INLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNA
HASC1_STRP1     FELEYNLQAKGKNELLKLVDETTA--INLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNA
HASC2_STRP6     FELEYNLQAKGKNELLKLVDETTA--INLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNA
HASC1_STRP3     FELEYNLQAKGKNELLKLVDETTA--INLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNA
HASC2_STRP8     FELEYNLQAKGKIELLKLVDE--TTSINLHFIRQSHPRGLGDAVLQAKTFVGNEPFVVMLGDDLMDITNP
HASC2_STRP3     FELEYNLQAKGKIELLKLVDE--TTSINLHFIRQSHPRGLGDAVLQAKTFVGNEPFVVMLGDDLMDITNP
HASC2_STRP1     FELEYNLQAKGKIELLKLVDE--TTSINLHFIRQSHPRGLGDAVLQAKTFVGNEPFVVMLGDDLMDITNP
HASC1_STRP6     FELEYNLQAKGKIELLKLVDE--TTSINLHFIRQSHPRGLGDAVLQAKTFVGNEPFVVMLGDDLMDITNP
GTAB2_STAS1     KELEMILQEKGKTDLLEKVK-YSTELANIFYVRQKEQKGLGHAIYSARQFIGDEPFAVLLGDDIV---ES
CAP3C_STRPN     FELEYSLRKQGKMELLKSVNE--STDIKVHFVRQSSPRGLGDAVLQAKSFVGDDPFVVMLGDDLMDITDS
GTAB1_STAS1     KELEMILEEKGKSDLLQSVK-YSSNLANMFYVRQKEQKGLGHAIWTARQFIGNEPFAVLLGDDIV---QA
GTAB_BACSU      PELERN-XXXXXXXXXXXXXXXASNLADIHYIRQKEPKGLGHAVWCARNFIGDEPFAVLLGDDIV---QA
GTAB_STAHJ      KELEMVLEEKGKDDLLEKVQYSTDL-ANIFYVRQKEQKGLGHAIHTARQFIGNEPFAVLLGDDIV---ES
GTAB_STAES      KELEMVLENKGKADLLEKVQYSTDL-ANIFYVRQKEQKGLGHAIHTAKQFIGNEPFAVLLGDDIV---ES
GTAB_STAEQ      KELEMVLENKGKADLLEKVQYSTDL-ANIFYVRQKEQKGLGHAIHTAKQFIGNEPFAVLLGDDIV---ES
Y1334_METJA     YELECKLEKSGKYELLKIIKE-IDRLGNIFYVRQKEQKGLGDAILYGEEFVG-EEYFIAMVGDTIYSKN-
EXON_RHIME      PELISSLSRSGKSAQISELEAMLPAAGSVSFTRQQAPLGLGHAVWCARDLIGDEPFALLLPDMVSFGARG
GALU_MYCPN      FILENALLQKHKDQEHQEIKD-IANLAHIYFVRQKHQHGLGDAILHAKSFVGNEDFAVLLGDDVVFGEQ-
CELA_ACEXY      YELEDTLKARKKTSALKALERVIPG--TMLSVPPAGTAGPWHAIWCAREFIGNDPFAILLPDDVVQSKKS
GALU_MYCGE      LILENALIQKNKLQEHKEIED-IANLAHIFFVRQKNQDGLGDAILFAESFVGNEDFAVLLGDDVVFSKE-
GTAB_STAAW      KELEMVXXXXXXXXXXXXVQ-YSTELANIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIV---ES
GTAB_STAAS      KELEMVXXXXXXXXXXXXVQ-YSTELANIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIV---ES
GTAB_STAAN      KELEMVXXXXXXXXXXXXVQ-YSTELANIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIV---ES
GTAB_STAAM      KELEMVXXXXXXXXXXXXVQ-YSTELANIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIV---ES
GTAB_STAAC      KELEMVXXXXXXXXXXXXVQ-YSTELANIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIV---ES
GTAB_STAA8      KELEMVXXXXXXXXXXXXVQ-YSTELANIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIV---ES
GTAB_STAA3      KELEMVXXXXXXXXXXXXVQ-YSTELANIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIV---ES
GTAB_STAAR      KELEMVXXXXXXXXXXXXVQ-YSTELANIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIV---ES
GTAB_STAAB      KELEMVXXXXXXXXXXXXVQ-YSTELANIFYVRQKEQKGLGHAISSARQFIGNEPFVVLLGDDIV---ES
GALF_SALTY      YELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILCARPVVGDNPFIVVLPDPLRYN---
GALF_SALTI      YELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILCARPVVGDNPFIVVLPDPLRYN---
GALF_KLEPN      YELEALLEQRVKRQLLAEVQAICPPGVTIMNVRQAQPLGLGHSILCARPVVGDNPFVVVLPDIIL---DG
GALF_ECOLI      YELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPAIGDNPFVVVLPDVVIASADP
GALF_ECO57      YELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPAIGDNPFVVVLPDVVIASADP
GALF_SHIFL      YELESLLEQRVKRQLLAEVQSICPPGVIIMNVRQGEPLGLGHSILCARPAIGDNPFVVVLPDVVIASADP
YTDA_BACSU      LALEAFLASKNKLHLLR--EHPIP-DIRIHYVRQPYAKGLGDAISFGKQFAGGEPFAVVLPDDLIFS--A
GLMU_METM5      PKIEYILQEKQ--------------------------LGTGHAVLTAKNF--IKDDFLVLNGDVIFEDSI
GLMU_METM7      PKIEYILQEKQ--------------------------LGTGHAVLTAKNF--IKDDFLVLNGDIIFEDSI
GLMU_METVS      EKIEFIVQEKQ--------------------------LGTGHAVLMAKNYIK-GDF-LVLNGDVIFESD-
GLMU_META3      DKIK--------------------------FIEQTDIDGTGYAVLMAKNHIS-GDFLVI-NGDIIFDDD-
RMLA1_ECOLI     LNLQYKV--------------------------QPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHD-
RMLA_SALAN      LNLQYKV--------------------------QPSPDGLAQAFIIGEEFIGNDDCALVLGDNIFYGHD-
RMLA_SALTY      LNLQYKV--------------------------QPSPDGLAQAFIIGEEFIGHDDCALVLGDNIFYGHD-
RMLA1_SHIFL     LNLQYKV--------------------------QPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHD-
GLMU_METMP      PKIEYILQEKQ--------------------------LGTGHAVLTAKNFIK-GDF-LVLNGDVIFEDSI
RMLA3_ECOLX     LNLQYKV--------------------------QPSPDGLAQAFIIGEDFIGGDDCALVLGDNIFYGHD-
RMLA_STRMU      IKLSYA--------------------------EQPSPDGLAQAFIIGEEFIGDDHVALILGDNIYY----
GLMU_METJA      ----YLIVKYKKEKIVDYFKNH-PK---IKFLEQGEIDGTGQAVLTAKDYV--DDEFLVINGDIIFEDD-
RMLA_NEIMB      ISISYAV--------------------------QPSPDGLAQAFIIGEEFIGNDNVCLVLGDNIFYGQSF
RMLA_XANCP      --------------FQSLLGDGAQWGVNIQYAVQPSPDGLAQAYLIGRDFVGGKPSCLVLGDNIFHGHGL
RMLA_XANCB      --------------FQSLLGDGAQWGVNIQYAVQPSPDGLAQAYLIGRDFVGGKPSCLVLGDNIFHGHGL
RMLA_NEIMA      ISISYAV--------------------------QPSPDGLAQAFIIGEEFIGNDNVCLVLGDNIFYGQSF
STRD_STRGR      DEIVAAVGDGSRFGL------------KVSYIPQSKPLGLAHCVLISRDFLGEDDFIMYLGDNFV-----
RMLA_NEIGO      IRLQYAV--------------------------QPSPDGLAQAFIIGEEFIGNGNVCLILGDNIFYGQSF
SPSI_BACSU      -------QKEHMPQFYKLLGNGEELGVTITYQVQPAASGISDGLSYAKRFTKKESFILLLGDNIFED---
GMPPB_DROPS     -ELKVEADK---------------LGVELIFSHETEPLGTAGPLALAKSILSAEPF-FVLNSDVICDF--
MPG1_CRYNE      IHFSVETEPLGTAGPLALAREILGKDDSPFFV-------LNSDVTCVYPFEAFRDFHIA--------HKC
MPG12_CANGA     YEKEYGVNITFSVETLKLAEKILKKDNSPFFV-------LNSDVICEYPFKELAEF---------HKSHG
GMPPB_DROME     -----QMEKELKVEAKKL-------GVELIFSHETEPLGTAGPLALAKTILAAEPF-FVLNSDVICDF--
GLMU_GEOUR      SDVRFAVQEEQ--------------------------LGTGHAVACALPLLGFSGMVLILCGDVPL---I
RMLA2_SHIFL     IQLEYA--------------------------EQPSPDGLAQAFIIGETFLNGEPSCLVLGDNIFFGQGF
RMLA2_ECOLI     IQLEYA--------------------------EQPSPDGLAQAFIIGETFLNGEPSCLVLGDNIFFGQGF
GLMU_THETN      DEVKYAYQKVQ--------------------------LGTGHAVMMAEEFLPLEGMVLILTGDTPL---I
GLMU_LISW6      SE----------------------------FVKQEEQLGTAHAVLQAKPLAGKDGVTLVVCGDTPL---I
RMLA_YEREN      IRLQYA--------------------------KQPSPDGLAQAFIIGEEFIAGERCALVLGDNIYFGQSF
GLMU_LISMO      SE----------------------------FVKQDEQLGTAHAVLQAKELAGKDGVTLVVCGDTPL---I
GLMU_LISMH      SE----------------------------FVKQEEQLGTAHAVLQAKELAGKDGVTLVVCGDTPL---I
GLMU_LISMF      SE----------------------------FVKQEEQLGTAHAVLQAKELAGKDGVTLVVCGDTPL---I
GLMU_LISMC      SE----------------------------FVKQEEQLGTAHAVLQAKELAGKDGVTLVVCGDTPL---I
MPG1_YEAST      ITFSVETEPLGTAGPLKLAEDVLKKDNSPFFV-------LNSDVICEYPFKELADF---------HKAHG
GLMU_LISIN      SE----------------------------FVKQDEQLGTAHAVLQAKELAGKDGVTLVVCGDTPL---I
MPG1_PICAN      YEKEYGVSITFSVEPLKLAEKILKKDNTPIFV-------LNSDVICEYPL-----------RDLLEFHTA
MPG1_KLULA      ITFSVETEPLGTAGPLKLAESVLKKDNSPFFV-------LNSDVICDYPFKELADF---------HQAHG
MPG11_CANGA     YEKEYGVSITFSVETLKLAEKVLKKDNSPFFV-------LNSDVICEYPFKELADF---------HKAHG
MPG1_GIBZE      IEFSVETEPLDTAGPLKLAERILAKDDSPFFV-------LNSDVICDFPF-----------EDLLAFHKS
ACBA_ACTS5      LRLEFAVQQR-------------PGGIA-------EAFLIGEEFLAGGPV------ALMLGDNLL--HGV
GMPPB_CAEEL     VKLIFSLEE--------------------------EPLGAGPLALARKHLEGDAPF-FVLNSDVICDF--
MPG1_ASHGO      YEKQYGVSITFSVETLKLAEKVLKKDNSPFFV-------LNSDVICEYPFKELAAF---------HRAHG
GLMU_THESQ      FEAE-------------LVRKTLPEWVDVFV--QEEQLGTAHAVMCAKDFIEPGDDVLILYGDVPL---I
GLMU_PECCP      -----------KHELTDPALN---------WVLQAEQLGTGHAMQQAAPYFADDEDILMLYGDVPLISSQ
GLMU_THEP1      FEAE-------------LVRKTLPEWVDVFV--QEEQLGTAHAVMCAKDFIEPGDDVLILYGDVPL---I
GLMU_ENTS8      ----------------DLLQSTL-KDASLNWVLQAEQLGTGHAMQQAAPFFSDDEDVLMLYGDVPL---I
RMLA_RHISN      --------------FQALLGDGSQWGISLRYAVQPSPNGLAQAYVIGADFVAGSPSCLILGDNIYFGHXX
GLMU_THEMA      FEAE-------------LVRKALPEWVDVFV--QGEQLGTAHAVMCAKDFIEPGDDVLILYGDVPL---I
GLMU_GEOSL      ADITLAVQEEQ--------------------------LGTGHAVACAADLSGFSGKVLILCGDVPL---I
GLMU_BACA2      -DVKKQLGQKSDYAL------------------QAEQLGTAHAVKQAKPLHGEKGVTIVICGDTPL---L
GLGC_MYCMO      IPFDLNRLNGGVVLLSPYVK----ESEGYWYA------GTAHAIFENIDFMNEYDYALILSGDHIYKMD-
GLMU_SERP5      ----------------DLLKNTLT-DGALNWVLQAEQLGTGHAMQQAAPHFADDEDVLMLYGDVPL---I
MPG1_SULAC      ---------------LNLQKNIVS-------VIEESRLGDAGPLKFINSKYNLSDDVIVVYGDIYAEIDF
GLMU_ENTFA      ------LGERSQYAL------------------QAEQLGTGHAVMQAQELLGGKQTLVITGDTPLLTAE-
GMPPB_CAEBR     VKLIFSLEE--------------------------EPLGTAGPLALARKHLEDDDPFFVLNSDVICDF--
GLMU_BACSU      -EVKKQLGDKSEYRV------------------QAKQLGTAHAVKQAQPFLADEKTIVICGDTPLLTAE-
GLMU_BACLD      -DVKKQLGEKSEYAL------------------QAEQLGTAHAVKQAKSILGSETTIVICGDTPLLTAET
GMPPB_DANRE     LGIKISLSHEKEAGPLALARELLTDNQEPFFV-------LNSDVICDFPF-----------DDMLKFH--
GLMU_BACHD      ---------------ADAVKSQLGERVS--YALQEEQLGTGHAVLQAEALGGRRGVTIVLCGDTPL---L
GMPPB_XENTR     --------KEQEKRL----------GIRISMSHEKEPLGAGPLALARELLTENSDPFFVLNSDVICDF--
GMPBB_XENLA     --------KEQEKRL----------GIRISMSHEKEPLGTAGPLALARELLNSEPF-FVLNSDVICDF--
GLMU_BACSK      AVIVGHGAEEVKKTLTEKIE----------FVMQPEQLGTGHAVKCAEHLLASQGTTVVLCGDTPL---I
GLMU_LACS1      -----TLGDRTKYAL------------------QAEQLGTGHAVLQAEKLLGDKDGMT-----LIACGDT
GLMU_SYNWW      ----------------------ICSGEKIRFVLQEQQLGTGHALMQAEAVVAPEDTILVLAGDIPLIQAT
GLMU_RHOFD      TGASAGFD--------------------INFVRQEPQLGTGHAVQQAVPLLRDDGMVVVLSGDVPL---I
GMPBA_XENLA     --------KEQEKRL----------GIRISMSHEKEPLGTAGPLALARELLNSEPF-FVLNSDVICDF--
GMPPB_MOUSE     --------KAQEQRL----------GIRISMSHEEEPLGTAGPLALARDLLSTADPFFVLNSDVICDF--
GLMU_PHOLL      ----------------DLIEQTL-SDQTLNWVLQAEQLGTGHAMQQAAPFAGDEDILILYGDVPL----I
GLMU_LACRJ      ------LGHRTKYAL------------------QEQQLGTGHAVMQTKDLLANED-----GETIIVSGDT
GLMU_LACRD      ------LGHRTKYAL------------------QEQQLGTGHAVMQTKDLLANED-----GETIIVSGDT
GMPPB_PIG       ISMSHEEEPLGTAGPLALARDLLSETAEPFFV-------LNSDVICDFPFQAMVQF---------HRHHG
GMPPB_HUMAN     --------KAQEQRL----------GIRISMSHEEEPLGTAGPLALARDLLSTADPFFVLNSDVICDF--
GLMU_THEP3      XXYAY----------------------------QEVQLGTGHAVMMAEDLLPEEGNVLILTGDTPL---I
GLMU_NITEC      ----------------ELVRQTVGNDPNLIWVKQTQQLGTGHAVKQALPCLGKNGITLVLFGDVPL---V
GMPPB_BOVIN     --------KAQEQKL----------GIRISMSHEEEPLGTAGPLALARDLLETADPFFVLNSDVICDF--
GLMU_THEYD      ----YNIK----------------------IVFQDEPKGTAHALLSALPYLSSDKILILNGDTPLLRKE-
GLMU_SALTI      ------------------------KDDKLNWVLQAEQLGTGHAMQQAAPFFSDDEDILMLYGDVPL---I
GLMU_SALPK      ------------------------KDDKLNWVLQAEQLGTGHAMQQAAPFFSDDEDILMLYGDVPL---I
GLMU_SALPB      ------------------------KDDKLNWVLQAEQLGTGHAMQQAAPFFSDDEDILMLYGDVPL---I
GLMU_SALPA      ------------------------KDDKLNWVLQAEQLGTGHAMQQAAPFFSDDEDILMLYGDVPL---I
GLMU_SALNS      ------------------------KDDKLNWVLQAEQLGTGHAMQQAAPFFSDDEDILMLYGDVPL---I
GLMU_SALG2      ------------------------KDDKLNWVLQAEQLGTGHAMQKAAPFFSDDEDILMLYGDVPL---I
GLMU_SALEP      ------------------------KDDKLNWVLQAEQLGTGHAMQQAAPFFSDDEDILMLYGDVPL---I
GLMU_SALDC      ------------------------KDDKLNWVLQAEQLGTGHAMQQAAPFFSDDEDILMLYGDVPL---I
GLMU_SALCH      ------------------------KDDKLNWVLQAEQLGTGHAMQQAAPFFSDDEDILMLYGDVPL---I
GLMU_SALA4      ------------------------KDDKLNWVLQAEQLGTGHAMQQAAPFFSDDEDILMLYGDVPL---I
GLMU_OCEIH      SE----------------------------FAFQKEQLGTGHAVLQAEDLLKDEKGVTVVA--------C
GLMU_LACSS      ------LGDRSQYAL------------------QAEQLGTGHAVLQAEDLLKDQDITIVVSGDTPL---L
GLMU_FUSNN      -------HKREK------VLEVLGNDVSY--VVQEEQLGTGHAVKQAIPKIKDYD-----GDVLIINGDI
GLMU_CLOTE      -EVQLKTESRS---------------VSFSF--QEQQLGTGHAVKCAKELLGKEGNVAIFTGDAPL---I
GLGC_CORJK      ----------QSWQLSGLTGQYITPVPAQQRLGKRWFTGSADAILQSLNLVYDEDYIIVFGADHVYRMD-
GLMU_YERPY      ----------------ELLKKTLA-DPSLNWVLQAEQLGTGHAMQQAAPFADDEDILMLYGDVPLISVD-
GLMU_YERPS      ----------------ELLKKTLA-DPSLNWVLQAEQLGTGHAMQQAAPFADDEDILMLYGDVPLISVD-
GLMU_YERPP      ----------------ELLKKTLA-DPSLNWVLQAEQLGTGHAMQQAAPFADDEDILMLYGDVPLISVD-
GLMU_YERPN      ----------------ELLKKTLA-DPSLNWVLQAEQLGTGHAMQQAAPFADDEDILMLYGDVPLISVD-
GLMU_YERPE      ----------------ELLKKTLA-DPSLNWVLQAEQLGTGHAMQQAAPFADDEDILMLYGDVPLISVD-
GLMU_YERPB      ----------------ELLKKTLA-DPSLNWVLQAEQLGTGHAMQQAAPFADDEDILMLYGDVPLISVD-
GLMU_YERPA      ----------------ELLKKTLA-DPSLNWVLQAEQLGTGHAMQQAAPFADDEDILMLYGDVPLISVD-
GLMU_YERP3      ----------------ELLKKTLA-DPSLNWVLQAEQLGTGHAMQQAAPFADDEDILMLYGDVPLISVD-
GLMU_YERE8      -------------------------DPALNWVLQAEQLGTGHAMQQAAPHFADDEDVLMLYGDVPL---I
GLMU_SALTY      ------------------------KDDKLNWVLQAEQLGTGHAMQQAAPFFSDDEDILMLYGDVPL---I
GLMU_SALSV      ------------------------KDDKLNWVLQAEQLGTGHAMQQAAPFFSDDEDILMLYGDVPL---I
GLMU_SALHS      ------------------------KDDKLNWVLQAEQLGTGHAMQQAAPFFSDDEDILMLYGDVPL---I
GLMU_PEDPA      ---------------------------------QEQQLGTGHAVLQAEKILGDKDGMT-----MIVSGDT
GLMU_ALCBS      -------------------ASVTGEQVAW--AEQAEQLGTGHAVAQAMPYVK-EDMVLVLYGDVPL---I
GLGC_EUBE2      ------------------------------------------------------EYVLILSGDHIYKMD-
GLMU_STRSY      ------------------------------FALQSEQLGTGHAVMMAEPLAGLEGQTLVIAGDLITGE--
GLMU_STRS2      ------------------------------FALQSEQLGTGHAVMMAEPLAGLEGQTLVIAGDLITGE--
GLMU_STRPZ      ------------------------------FVHQTEQLGTGHAVMMAEQLEGLEGHTLVIAGDLITGE--
GLMU_NITEU      ----------------ELVRQVIGDHSDLIWVKQAQQLGTGHAVKQALPYLGNKGVTLVLFGDVPL---V
GLMU_HERAR      ----YGHGGEQVPQLLQ------SKDLSF--AKQEPQLGTGHAVMQAVPQLNDDSPTLILYGDV----PL
GLMU_ALTMD      ---------------------------------QAEQLGTGHAVQQAAPHINDEDVLILVGDAPLIRED-
GLGC2_VIBCH     ----WSIFNPELGEFITVVPPQMRKGGKWYE-------GTADALFHNMWLLARSDYVVVLSGDHIYRMDY
GLMU_STRU0      ------------------------------FVLQTEQLGTGHAVMMAE-----EKLADLEGNTLVIAGDT
GLMU_STRR6      ----------------ELVEEVLAEQTEF--VTQSEQLGTGHAVMMTEPILGLSGHTLVIAGDT----PL
GLMU_STRP2      ----------------ELVEEVLAEQTEF--VTQSEQLGTGHAVMMTEPILGLSGHTLVIAGDT----PL
GLMU_SHEAM      -----------KAKLGEQPLN---------FVLQAEQLGTGHAVAQAIDHINDEDTVLVLYGDVPL----
GLMU_SALAR      ----------------DLLKQTLKND-NLNWVLQAEQLGTGHAMQQAAPFFGDDENILMLYGDVPL---I
GLGC2_VIBPA     ----WSIFNPELGEYITAVPPQMRKGGAWYE-------GTADAIYHNLWLLSRNDYVVVLSGDHIYRMDY
GLMU_STRSV      ------------------------------FVRQTEQLGTGHAVMMAEPVL-----ENLTGQTLVIAGDT
GLMU_SHISS      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_SHIFL      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_SHIF8      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_SHIBS      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_SHIB3      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_PELCD      ---------------AELAEDPVS------FALQSEQLGTGHALLCARQ--ALQEFSLLLCGDVPLLRD-
GLMU_LACPL      -DVEAALGDRTEYAV------------------QTEQLGTGHAVLQAESLLKDADTLIVSGDTPLFKAE-
GLMU_ESCF3      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_ECOUT      ----------------DLLKQAL-KDDNLNWVLQTEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_ECOSM      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_ECOSE      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_ECOLU      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_ECOLI      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_ECOLC      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_ECOL6      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_ECOK1      ----------------DLLKQAL-KDDNLNWVLQTEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_ECOHS      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_ECODH      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_ECOBW      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_ECO8A      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_ECO81      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_ECO7I      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_ECO5E      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_ECO57      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_ECO55      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_ECO45      ----------------DLLKQAL-KDDNLNWVLQTEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_ECO24      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_SHIDS      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_NEIMA      -----------KEQVLDTVK----RDV--VWVEQTEQLGTGHAVKTALPHLAAEGRTLVLYGDVPL---I
GLMU_EDWI9      ---------------------------PLNWVLQAQQLGTGHAMQQAAPDFSDDEDILMLYGDVPL---I
GLMU_ECOL5      ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLMU_ACIBS      FAQE-----------------------NIQWVEQAEQLGTGHAVQMTLPVLPKDGISLILYGDVPLARQT
GLMU_STRZT      ------------------------------FVTQSEQLGTGHAVMMTEPILGLSGHTLVIAGDT----PL
GLMU_STRZJ      ------------------------------FVTQSEQLGTGHAVMMTEPILGLSGHTLVIAGDT----PL
GLMU_STRPN      ------------------------------FVTQSEQLGTGHAVMMTEPILGLSGHTLVIAGDT----PL
GLMU_STRPI      ------------------------------FVTQSEQLGTGHAVMMTEPILGLSGHTLVIAGDT----PL
GLMU_STRPG      ------------------------------FVHQTEQLGTGHAVMMAEQLEGLEGHTLVIAGDLITGE--
GLMU_STRPF      ------------------------------FVHQTEQLGTGHAVMMAEQLEGLEGHTLVIAGDLITGE--
GLMU_STRPC      ------------------------------FVHQTEQLGTGHAVMMAEQLEGLEGHTLVIAGDLITGE--
GLMU_STRPB      ------------------------------FVHQTEQLGTGHAVMMAEQLEGLEGHTLVIAGDLITGE--
GLMU_STRP7      ------------------------------FVTQSEQLGTGHAVMMTEPILGLSGHTLVIAGDT----PL
GLMU_STRP6      ------------------------------FVHQTEQLGTGHAVMMAEQLEGLEGHTLVIAGDLITGE--
GLMU_STRMU      ------------------------------FVLQSEQLGTGHAVMMAESLAELEGQTLVIAGDLIRGE--
GLMU_LACBA      ------------------------------YALQAEQLGTGHAVLQTEPMLKDETTLIVSGDTPLFRAE-
GLMU_KLEP3      ----------------DLLRQTLHED-NLNWVLQAEQLGTGHAMQQAAPFFNDDEDILMLYGDVPL---I
GLMU_DIAST      XXXXXTFDLK--------------------FVRQEPQLGTGHAVQQATPALAGDGTVVVLSGDVPLTQ--
GLGC_GEOLS      WGKWTGLG-----EFCVAISPETSSDSEQWFK------GTADAILQYLRFVETADYVAVFGGDHIYKMD-
GLGC_CLOPE      ------------------------------------------------------EYVLILSGDHIYKMD-
GLMU_STRP1      ------------------------------FVHQTEQLGTGHAVMMAEQLEGLEGHTLVIAGDLITGE--
GLMU_ECO27      ----------------DLLKQALKND-NLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
GLGC_THELT      ------------------------------------------------------DFVLILSGDHVYAMDY
GLMU_STRP4      ------------------------------FVTQSEQLGTGHAVMMTEPILGLSGHTLVIAGDT----PL
GLMU_SHESH      ----YGAEKLQS----------VLGEQQLNWVLQAEQLGTGHAVAQANDNIGDDDTVLILYGDVPL---I
GLMU_SHELP      ---------------------------ALNWVLQAEQLGTGHAVAQANDNIGDDDTVLILYGDVPL---I
GLMU_LACLA      ----------------DRVIATLPKGTQF--VKQVEQLGTGHAVRIAADLLANEDGATLV---IAGDTPL
GLMU_HAEIN      EQVNW--------------------------VLQTEQLGTAHAVQQAAPFFKDNENIVVL------YGDA
GLMU_ERWCT      -----------KHELTDPALN---------WVLQAEQLGTGHAMQQAAPHFADDEDILMLYGDVPL---I
GLMU_DESHD      TEV----------------------------VVQEEQCGTGHAIMQAIPHCHEVDHIIVLSGDLIRPE--
GLMU_COLP3      ----------------DVLKATLTKDNTLTFVEQVEQLGTGHAVDQASPFLTDDEDVLVLYGDVPLTK--
GLMU_CELJU      -------------------QRMAAPDVK--FVVQAQQLGTGHAVQQALPHLRPEATVLILYGDVPLTR--
GLGC_CLOPS      ------------------------------------------------------EYVLILSGDHIYKMD-
GLMU_STRT1      ----------------ELVREVL--DGQSAFTMQTEQLGTGHAVMMAEELAGLEGQTLVIAGDLITGE--
GLMU_STRP8      ------------------------------FVHQTEQLGTGHAVMMAETLEGLEGHTLVIAGDT----PL
GLMU_STRP3      ------------------------------FVHQTEQLGTGHAVMMAETLEGLEGHTLVIAGDT----PL
GLMU_DESHY      TEV----------------------------VVQEEQCGTGHAIMQAIPHCHEVDHIIVLSGDLIRPE--
GLGC_RHOPS      WNF-FRPERNESFDILPASQRV--SDDMWY-------RGTADAVYQNIDIIESYDFIVLLAGDHVYKMDY
GLGC_HAES2      ----WSFLPQERGEFIDMLPARQQIDDSTWYRGTADAVYQNMAIIRDRP-----KYILILAGDHIYKQDY
GLGC_HAES1      ----WSFLPQERGEFIDMLPARQQIDDSTWYRGTADAVYQNMAIIRDRP-----KYILILAGDHIYKQDY
GLMU_THEM4      ---------GHKYEL---VKKVIPEDVEIYL--QNQQLGTAHAVMSAIEFVSPNDNLLILYGDVPFSHE-
GLMU_STRT2      ----------------ELVREVL--DGQSAFTMQTEQLGTGHAVMMAEELAGLEGQTLVIAGDLITGE--
GLMU_STRPM      ------------------------------FVHQTEQLGTGHAVMMAEQLEGLEGHTLVIAGDLITGE--
GLMU_KOSOT      ----YKAE---------IVEALLPEDVKT--VRQVKQLGTGHAVMVAQDAVMDDEVIVLTGDAPLISPE-
GLMU_HAEI8      EQVNW--------------------------VLQTEQLGTAHAVQQAAPFFKDNENIVVL------YGDA
GLMU_ACIBY      FAQE-----------------------NIQWVEQAEQLGTGHAVQMTLPVLPKDGISLILYGDVPLVRQT
GLMU_ACIBC      FAQE-----------------------NIQWVEQAEQLGTGHAVQMTLPVLPKDGISLILYGDVPLVRQT
MPG1_NEUCR      ITISIESEPLGTAGPLKLAEDVLRKDDTPFFV-------LNSDVTCEYPFKELAAFHKAHGD--------
GLMU_STRGC      ------------------------------FVRQTEQLGTGHAVMMAEPVL-----ENLTGQTLVIAGDT
GLMU_RALME      ----------------ELVRKAVGAD-DVAFAEQAQQLGTGHAVMQALPLLDDSQPTLVLYGDVPLT---
GLMU_NITOC      ------------------------RAADITWVRQELQLGTGHAALQTLPYIKPDTMLLILSGDVPL---V
GLMU_HAEIG      EQVNW--------------------------VLQTEQLGTAHAVQQSAPFFKDNENIVVL------YGDA
GLMU_FERNB      ----------------DIVKSYLPEDVKTYL--QEPQLGTGHAVMCARDFISNEDLLVLYGDVPLLSKE-
GLMU_CORJK      ---------------------------------QEQQNGTGHAVQCAEQLEGFEGTVVVTNADVPL---L
GLMU_ACTSZ      ------------------------ADEPVNWVFQAEQLGTGHAMQQAAPFFKDDENIVMLYGDLITKE--
MPG1_CANAL      ITFSVEEEPLGTAGPLKLAEEVLKKDDSPFFV-------LNSDVICDYPFKELADF---------HKAHG
GLMU_HAES1      ------------------------ADEPVNWVFQSEQLGTGHAMQQAAPFFQDDENIVMLYGDVPL----
GLMU_HAEIE      EQVNW--------------------------VLQTEQLGTAHAVQQAAPFFKDNENIVVL------YGDA
GLMU_DESPS      ------------------------------FVVQEEQLGTAHAVLTAKEAIACEDVMILCGDTPLISGQ-
GLMU_AERHH      ---------KERIQASDL-----------NWVLQAQQLGTGHAVAQAIPFWQDEDDVLVLYGDLIQPE--
GLMU_ACHLI      -----IVKDRAKY------------------VYQEEQLGTGHAAMMAAPVLSLDGNTFIMPGDLIWYK--
GLGC_STRZT      ------------------------------------------------------EYVLILSGDHIYKMD-
GLGC_STRZP      ------------------------------------------------------EYVLILSGDHIYKMD-
GLGC_STRZJ      ------------------------------------------------------EYVLILSGDHIYKMD-
GLGC_STRR6      ------------------------------------------------------EYVLILSGDHIYKMD-
GLGC_STRPN      ------------------------------------------------------EYVLILSGDHIYKMD-
GLGC_STRPJ      ------------------------------------------------------EYVLILSGDHIYKMD-
GLGC_STRPI      ------------------------------------------------------EYVLILSGDHIYKMD-
GLGC_STRP7      ------------------------------------------------------EYVLILSGDHIYKMD-
GLGC_STRP2      ------------------------------------------------------EYVLILSGDHIYKMD-
EI2BE_YEAST     ----------------------------------------------------------------------
MPG1_EMENI      IEFSVETEPLGTAGPLKLAESILAKDDSPFFV-------LNSDVICDYPFQQLAEFHKRHGD--------
GLMU_STRTD      ----------------ELVREVL--DGQSAFTMQTEQLGTGHAVMMAEELAGLEGQTLVIAGDLITGE--
GLMU_PSEF5      ------------------------------FVLQDKQLGTGHAVAQAVPFITADTVLILYGDVPLIEVE-
GLMU_NEIM0      -------------QVLDTVK----RDV--VWVEQTEQLGTGHAVKTALPHLAAEGRTLVLYGDVPL---I
GLMU_KLEP7      ----------------DLLRQTLHED-NLNWVLQAEQLGTGHAMQQAAPFFNDDEDILMLYGDVPL---I
GLMU_ERWT9      -------------------------DRSLNWVLQAEQLGTGHAMQQAAPYFADDEDILMLYGDV----PL
GLMU_ACISJ      AGVGGTFDLK--------------------FVRQEPQLGTGHAVQQATPALAGDGTVVVLSGDVPLTQ--
GLGC_STRU0      ------------------------------------------------------EYVLILSGDHIYKMD-
GLGC_STRP4      ------------------------------------------------------EYVLILSGDHIYKMD-
GLGC_SALTI      WSL-FSEEMNEFVDLLPAQQRM--KGENWYRGTADAVTQNLDIIRCYKA-----EYVVILAGDHIYKQDY
GLGC_RHOPT      WNF-FRPERNESFDILPASQRVSEE----MWYR-----GTADAVFQNIDIIESYDFIVLLAGDHVYKMDY
GLGC_RHOPB      WNF-FRPERNESFDILPASQRVS---------EELWYLGTADAVYQNIDIIESYDFIVLLAGDHIYKMDY
GLGC_RHOPA      WNF-FRPERNESFDILPASQRVSEE----MWYR-----GTADAVFQNIDIIESYDFIVLLAGDHVYKMDY
GLGC_RHOP5      WNF-FRPERNESFDILPASQRVS---------EELWYLGTADAVYQNLDIIESYDFIVLLAGDHIYKMDY
GLGC_RHOP2      WNF-FRPERNESFDILPASQRV--SDDMWY-------RGTADAVYQNIDIIESYDFIVLLAGDHVYKMDY
GLMU_STRSZ      -------------------------------VVQEEQLGTGHAVMMAEELSGLEGQTLVIAGD-------
GLMU_LACLM      ----------------DRVIATLPKGTQF--VKQVEQLGTGHAVRIAADLLANEEGAVIAGDTPLITGET
GLMU_LACGA      ----------------DSVKDVLAGQSDFAF--QEQQLGTGDAVLAASDLLENLDGSTLVADTPLFTAE-
GLMU_HAES2      ------------------------ADEPVNWVFQSEQLGTGHAMQQAVPFFQDDENIVMLYGDVPL----
GLMU_CALS8      ----------------DVYKVLEGRNVRFAY--QEKQLGTAHAVMCAMSEISSEDVFVLYGDVPFIKAD-
GLMU_ALISL      MQAELGQERVT-------------------WVLQAEQLGTGHAVNQASPEFSDDEKVLILYGDVPL---I
GLGC_STRPS      ------------------------------------------------------EYVLILSGDHIYKMD-
GLGC_CLOD6      ------------------------------------------------------EYVLILSGDHIYKMD-
GLMU_STRA3      ------------------------------FVMQTEQLGTGHAVMMAE-----EELATSKGHTLVIAGDT
GLMU_SHESW      -KLQASLGEQQ-----------------LNWVLQAEQLGTGHAVAQASPYIADNDTVLILYGDVPL---I
GLMU_SHEPC      -KLQASLGEQQ-----------------LNWVLQAEQLGTGHAVAQASPYIADNDTVLILYGDVPL---I
GLMU_SHEPA      ---------------------------QLNWVLQAEQLGTGHAVAQASANIADDDTVLILYGDVPL---I
GLMU_SHEHH      -KLQAKLGEQQ-----------------LNWVLQAEQLGTGHAVAQANDNISDDDTVLILYGDVPL---I
GLMU_NEIMF      ----------------DQVLNAVKRDV--VWVEQTEQLGTGHAVKTALPHLSAEGRTLVLYGDVPL---I
GLMU_MARAV      -QVRASLE-----------------DDSVNWVLQTEQLGTGHAVAQALPALPDDARVLVLYGDVPLTR--
GLMU_LACLS      ----------------DRVIATLPKGTQF--VKQVEQLGTGHAVRIAADLLANEEGAVIAGDTPLITGET
GLMU_HYPNA      H-----------------------PDVAIAYQDPPQ--GTGHAVRCAEALRGFEDLAVLYGDSPL----V
GLGC_THEM4      ------------------------------------------------------DYVVILSGDHIYSMDY
GLGC_PASMU      ----WSFLPAERGEFIDMLPARQQIDDSTWYRGTADAVYQNMAIICPK-------YILILAGDHIYKQDY
GLGC2_ALHEH     ------------------------------------------------------DYVLILAGDHVYKMDY
GLMU_THISH      ----------------DRVREAFPED-DIRWVHQAEQRGTGHAVQVALPETDADDRVLILYGDVPLVR--
GLMU_THELT      ----------------DSVKKLLPENVEV--VHQSQQLGTGHAVMSARNFIDPADNLLILYGDMPLITE-
GLMU_STRA5      ------------------------------FVMQTEQLGTGHAVMMAE-----EELATSKGHTLVIAGDT
GLMU_STRA1      ------------------------------FVMQTEQLGTGHAVMMAE-----EELATSKGHTLVIAGDT
GLMU_LEGPC      ------------------IKSSLP-NLPVHWVHQAEQLGTGHAVLQAMPHIPDDAYVLVLSADVPL---I
GLMU_LEGPA      ------------------IKSSLP-NLPVHWVHQAEQLGTGHAVLQAMPHIPDDAYVLVLSADVPL---I
GLMU_GEOLS      AGIRIALQEEQ--------------------------LGTGHAVSCSDQLDGLSGAVLILCGD-----XX
GLMU_CLOD6      ----------------DVVKEKLAEEI--IIAMQTEQLGTGHAVKMAKEYINDEDTIVVLCGDTPLIKE-
GLGC_STRGC      ------------------------------------------------------EYVLILSGDHIYKMD-
GLGC_RHISN      WNF-FRPERNESFDILPASQRV--SETQWYE-------GTADAVFQNIDIIGVE-YMVILAGDHIYKMDY
GLGC_BIFLI      WRFS---------PLLGSYVSPVPAQQ-----RLGKHWYLGSADAIYQTINIIEDIVVIVGADHVYRMD-
GLMU_PSEA7      ----------------DLVRERMAAD-DLNFVLQAEQLGTGHAVAQALPFLSAEQVLILYGDVPLIQLD-
GLMU_LACJO      ------------------VKDVLAGQSEFAF--QEKQLGTGDAVLAANDLLNLEGSTLVATGDTLFTAE-
GLGC_KLEP7      WSF-FSEEMNEFVDLLPAQQRVHGEN----WYR-----GTADAVTQNLDIISRAEYVVILAGDHIYKQDY
GLMU_SHEWM      ----YGGEKLQS----------VLGEQQLNWVLQAEQLGTGHAVAQANSNIADDDTVLILYGDVPL---I
GLGC_STRSV      ------------------------------------------------------EYVLILSGDHIYKMD-
GLGC_GRABC      WNF-FRPERNEGFDILPASQRV--SETQWYE-------GTADAVYQNLDIIGYEEYMIILAGDHIYKMDY
GLGC_ESCF3      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_BACHD      ------------------------------------------------------EYVLILSGDHIYKMD-
GMPPB_DICDI     -----PYEKK--------------LGIKISYSHETVPLGTAGPLALARDLLNDGEPFFVLNSDIICDFPF
GLMU_SHEFN      ----YGADKLQA----------ALGEQALNWVLQAEQLGTGHAVAQANPNINDDDTVLILYGDVPLIQQ-
GLMU_NEIMB      -------------QVLDTVK----RDV--VWVEQTEQLGTGHAVKTALPHLSAEGRTLVLYGDVPL---I
GLGC_KLEP3      WSF-FSEEMNEFVDLLPAQQRVHGEN----WYR-----GTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_ECO7I      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLMU_PSEPF      ----------------DVVRERLAAD-DLNFVLQDKQLGTGHATAQAVPFITADTVLILYGDVPLIEVE-
GLMU_PSEMY      ----------------DTVRERLAAD-DLNFVIQAEQLGTGHAVAQALPQLSAERVLILYGDVPLIE---
GLMU_PSEAE      ----------------DLVRERMAAD-DLNFVLQAEQLGTGHAVAQALPFLSADQVLILYGDVPLIQLD-
GLMU_PSEAB      ----------------DLVRERMAAD-DLNFVLQAEQLGTGHAVAQALPFLSADQVLILYGDVPLIQLD-
GLMU_PSEA8      ----------------DLVRERMAAD-DLNFVLQAEQLGTGHAVAQALPFLSADQVLILYGDVPLIQLD-
GLMU_NITMU      -------------------------DESLIWVPQIPQLGTGHAVMQALPHIEKEGITLILYGDVPLT---
GLMU_CLOAB      -NISYSLQSEQ--------------------------LGTGHAVKCAEDFLRGKDVAIFTGDAPLITED-
GLGC_THEAB      ------------------------------------------------------EYVVILSGDHIYSMD-
GLGC_STRS7      ------------------------------------------------------EYVLILSGDHIYKMD-
GLMU_RALEH      ---------------------------------QPQQLGTGHAVMQALPLLDDSQPTLVLYGDVPLT---
GLMU_PROM5      NNIHFIVQKPQK--------------------------GTGHAVQVLSQKVKKHDGKLI-----VLNGDV
GLMU_AZOSB      ------------------------------WARQEPQLGTGHAVQQALPHLTDGDLALVLYGDVPL---I
GLGC_SALAR      WSL-FSEEMNEFVDLLPAQQRM-----------QGENWYRGTADAVTQNLDIIREYVVILAGDHIYKQDY
GLGC_NOVAD      WNFMRP-ERNESFDILPASQRVSEHQ---WYEGTADAVYQNLDIIASYA----PKYMVILAGDHIYKMDY
GLGC_CLOK5      ------------------------------------------------------EYVIILSGDHIYKMNY
GLMU_VIBVY      IHLVYGHGGDQMQAAL--------AEEPVNWVLQAEQLGTGHAVDQASPQFEDDEKILVLYGDVPL---I
GLMU_VIBVU      IHLVYGHGGDQMQAAL--------AEEPVNWVLQAEQLGTGHAVDQASPQFEDDEKILVLYGDVPL---I
GLMU_PSEFS      ----------------DVVRERLAAD-DLNFVLQDKQLGTGHATAQAVPFITADTVLILYGDVPLIEVE-
GLMU_BURPS      ------------------------------FAVQEQQLGTGHAVRQALPLLDPSQPTLVLYGDVPLTR--
GLMU_BURP6      ------------------------------FAVQEQQLGTGHAVRQALPLLDPSQPTLVLYGDVPLTR--
GLMU_BURP1      ------------------------------FAVQEQQLGTGHAVRQALPLLDPSQPTLVLYGDVPLTR--
GLMU_BURP0      ------------------------------FAVQEQQLGTGHAVRQALPLLDPSQPTLVLYGDVPLTR--
GLMU_BURMS      ------------------------------FAVQEQQLGTGHAVRQALPLLDPSQPTLVLYGDVPLTR--
GLMU_BURMA      ------------------------------FAVQEQQLGTGHAVRQALPLLDPSQPTLVLYGDVPLTR--
GLMU_BURM7      ------------------------------FAVQEQQLGTGHAVRQALPLLDPSQPTLVLYGDVPLTR--
GLMU_BUCAP      -------------------------DTSIDWVIQKEQKGTGDAILKASKKFSDKDDIVVLYGDMPY---I
GLGC_STRA5      ------------------------------------------------------EYVLILSGDHIYNYDD
GLGC_STRA1      ------------------------------------------------------EYVLILSGDHIYNYDD
GLGC_SHISS      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_SHIFL      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_SHIF8      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_SHIDS      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_SHIBS      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_SHIB3      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_RHORU      ----WGFLRAEIGEFVELWPAQQQTDKESWY------LGTADAVHQNLDLIRMHDFVLILAGDHIYKQDY
GLGC_RHORT      ----WGFLRAEIGEFVELWPAQQQTDKESWY------LGTADAVHQNLDLIRMHDFVLILAGDHIYKQDY
GLGC_RHIME      WNF-FRPERNESFDILPASQRV--SETQWYE-------GTADAVYQNIDIIGVE-YMVILAGDHVYKMDY
GLGC_OCEIH      ------------------------------------------------------EYVLIISGDHIYQMD-
GLGC_ECOUT      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_ECOSM      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_ECOSE      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_ECOLU      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_ECOLI      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_ECOLC      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_ECOL6      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_ECOL5      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_ECOHS      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_ECODH      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_ECOBW      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_ECO8A      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_ECO81      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_ECO5E      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_ECO57      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_ECO55      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_ECO45      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLGC_ECO24      WSF-FNEEMNEFVDLLPAQQRM--KGENWY-------RGTADAVTQNLDIIRRAEYVVILAGDHIYKQDY
GLMU_VIBFM      MKAELGEERVQ-------------------WVLQAEQLGTGHAVNQAAPEFADDEKVLVLYGDVPL---I
GLMU_VIBF1      MKAELGEERVQ-------------------WVLQAEQLGTGHAVNQAAPEFADDEKVLVLYGDVPL---I
GLGC_STRA3      ------------------------------------------------------EYVLILSGDHIYKMD-
GLGC_RHIE6      WNF-FRPERNESFDILPASQRV--SETQWYE-------GTADAVYQNIDIIGVE-YMVILAGDHVYKMDY
GLGC_MANSM      ----WSFLPQERGEFVDMLPARQQIDDNTWYRGTADSVYQNLAIIRGKP-----KYVLILAGDHIYKMDY
GLGC_LACS1      ------------------------------------------------------EYILILSGDHIYKMD-
GLGC_GEOMG      WGKWAGLG--------EFFVAISPETSS-----ESEEWFKGTADAINHYLRFIEDYVAIFGGDHIYRMD-
GLGC_BACLD      ------------------------------------------------------EHVLILSGDHIYKMDY
EI2BG_RAT       ----------------------------------------------------------------------
EI2BG_BOVIN     ----------------------------------------------------------------------
EI2BE_CANAL     ----------------------------------------------------------------------
GLMU_VIBHB      -------------------QTLAEEPVNW--VLQAEQLGTGHAVDQASPKFEDDEKVLVLYGDVPL---I
GLMU_SHEPW      -KLQAKLGEQQ-----------------LNWVLQAEQLGTGHAVAQANDNISDDDTVLILYGDVPL---I
GLMU_NEIGO      -------------QVLDTVKR------DAVWVEQTEQLGTGHAVKTALPHLASEGRTLVLYGDVPL---I
GLMU_NEIG1      -------------QVLDTVKR------DAVWVEQTEQLGTGHAVKTALPHLASEGRTLVLYGDVPL---I
GLMU_LEGPH      ------------------IKSSLP-NLPVHWVHQAEQLGTGHAVLQAMPHIPDDAYVLVLSADVPL---I
GLMU_HYDS0      -----------------IIEALKHENVSFFEQANPKG-GTADALLSAKAFFGMDDYILVTNGDALVKPDT
GLGC_ACTSZ      ----WSFLPQERGEFVDMLPARQQIDDNTWYRGTADSVYQNMAIIKNKP-----KYILILAGDHIYKMDY
EI2BG_HUMAN     ----------------------------------------------------------------------
GLMU_SHESA      -----ALGEQQLNWML-----------------QAEQLGTGHAVAQAIPNIDDNDTVLILYGDVPL---I
GLMU_CITK8      ------------YGHGGXXXXXXXXXXXXXWVLQAEQLGTGHAMQQAAPFFSDDEDILMLYGDVPL---I
GLMU_CHRVO      ------------------------QDADIVWAEQAEQLGTGHALKMALPHLPQDGKTLVLYGDVPLTK--
GLMU_CARHZ      ---------------------------------QEEQLGTGHAALVAMPYVEDENVIIVPGDTPLLK---
GLMU_SACD2      AELNADKVHVIIGHGADMVREALARDVNF--VEQTEQLGTGHAVLQVLPHLNPESDTLILYGDVPLTK--
GLMU_PSESM      ------------------------------FVMQDKQLGTGHAVAQALPALTAETVLILYGDVPLIEVE-
GLMU_PASMU      ------------------------QDEPVNWVLQAEQLGTGHAMQQAAPFFADDENILMLYGD-------
GLMU_LEGPL      ------------------IKSSLP-NLPVHWVHQAEQLGTGHAVLQAMPHIPDDAYVLVLSADVPL---I
GLMU_CLOB8      ----------------ELVKETLDRNVSYSM--QAEQLGTGHAVKCAEEFLKDKKVAIFTGDTPLIKQST
GLMU_BURP8      ------------------------------FALQEQQLGTGHAVQQALPLLDPSAPTLVLYGDVPLTK--
GLGS_BRANA      YASNMGGYKNEGFVEV-LAAQQSPENPNWFAVRQYLWLFEEHNVL---------EFLVLAGDHL-YRMD-
GLMU_RALEJ      ------------------------------FAEQDQQLGTGHAVMQALPQLDDNQPTLVLYGDVPLT---
GLMU_MANSM      ------------------------ADEPVNWVFQAEQLGTGHAMQQAAPFFADDENILMLYGD---SPLI
GLMU_CLOPS      ------------------------KNVSYSL--QAEQLGTGHAVKCAKDLEGKTGVVAIFTGDAPL---I
GLMU_BURCH      ------------------------------FAVQAEQLGTGHAVRQALPLLDPAQPTLVLYGDVPLTR--
GLMU_BURCA      ------------------------------FAVQAEQLGTGHAVRQALPLLDPAQPTLVLYGDVPLTR--
GLMU_BURA4      ------------------------------FAVQAEQLGTGHAVRQALPLLDPAQPTLVLYGDVPLTR--
GLGS_SOLTU      YASNMGGYKNEGFVEV-LAAQQSPENPDWFAVRQYLWLFEEHTVL----------EYLILAGDHLYRMD-
GLGS_BETVU      YASNMGGYKNEGFVEV-LAAQQSPENPNWFAVRQYLWLFEEHNVL----------EYLILAGDHLYRMD-
GLGC_ENTS8      WSF-FSEEMNEFVDLLPAQQRV-----------HGETWYRGTADAVTQNLDIIREYVVILAGDHIYKQDY
GLGC_ACIAC      WTMTRFIPQ----HFVTVVPPQMRNGPEWFQGTADSVYQNIHLIESFKP-----DIVAVFGADHIYRMD-
MPG1_TRIRE      INIEFSVESEPLDTALKLAERILGKDDSPFFV-------LNSDVICDYPFKELLEFHKAHGD--------
GLMU_PSEA6      -ALNWCL--------------------------QAEQLGTGHAVQQAVPHISDDEDVLILVGDAPL---I
GLMU_PSE14      ------------------------------FVMQDKQLGTGHAVAQALPALTAETVLILYGDVPLIEVE-
GLMU_NOCFA      ---------------------------------QEQQLGTGHAVQCALPADFAGDLLVTSADPLLDGH--
GLMU_EXIS2      --VEYALQSEQ--------------------------LGTGHAVQMAEPVLGQEKGSTLVXXXXXXXHHA
GLMU_CLOPE      ---------------------------------QAEQLGTGHAVKCAKDLEGKTGVVAIFTGDAPL---I
GLMU_CLOK5      -------------------KATEVKNTSYSF--QDKQLGTGHAVLCASDFLGI--VAVFTGDSPLIKEN-
GLMU_CLOK1      -------------------KATEVKNTSYSF--QDKQLGTGHAVLCASDFLGI--VAVFTGDSPLIKEN-
GLMU_BAUCH      --LQQKLAHKQKTFL--------------HWIKQVEQSGTGHAVQQVLPFLGKDEEVLILYGDV------
GLMU_ACIAD      -----------------------------------EQLGTGHAVQMTLPVLPHDGLSLILYGDVPLVRQ-
GLGS_SOLLC      YASNMGEYKNEGFVEV-LAAQQSPENPDWFAVRQYLWLFEEHNVL----------EYLILAGDHLYRMD-
GLGC_STRMU      ------------------------------------------------------EYVLILSGDHIYKMD-
GLGC_BACCL      ------------------------------------------------------DYVLVLSGDHIYKMDY
GLGC_AZOSE      -----------------------------------------HLVELVKP-----DLVVVFGADHVYRMD-
GLGC_AZOSB      ------------------------------------------------------DLVVVFGADHVYRMD-
EI2BG_MACFA     ----------------------------------------------------------------------
GLMU_VIBCM      -------------------QALVNENVNW--VLQAQQLGTGHAVDQASPHFQDDEKILVLYGDVLISED-
GLMU_VIBC3      IHLVYGHGGDQMQQAL--------VNESVNWVLQAQQLGTGHAVDQASPHFQDDEKILVLYGDVLISED-
GLMU_VESOH      -HIAYGFEGKQVQQKIN--------NPSINWVKQVKQLGTGHAVAQVMPYIEGNSISLILYGDVPL---I
GLMU_CLOP1      ---------------------------------QAEQLGTGHAVKCAKDLEGKTGVVAIFTGDAPL---I
GLMU_CLONN      ----------------------ATKDTHVLYSIQEEQLGTGHALMCAREFLEGKDVAVFTGDAPLITSE-
GLMU_BURPP      ------------------------------FAVQEQQLGTGHAVQQALPLLDPSAPTLVLYGDVPLTR--
GLMU_BDEBA      ----------------NLVRQVVPMGVACYV--QDEQLGTAHAVRCAKPET-IEGVVVIMNGDLIEASD-
GLGC_THESQ      ------------------------------------------------------ELVLILSGDHVYAMNY
GLGC_THEMA      ------------------------------------------------------ELVLILSGDHVYAMNY
GLGC_HAEI8      ----WSFLPQERGEFVDMLPARQQIDDSTWYRGTADAVYQNMAIIKNRP-----KYILILAGDHIYKQDY
GLGC_FERNB      ------------------------------------------------------EYIVVLSGDHIYSMDY
GLGC_CLONN      ------------------------------------------------------EYILVLSGDHIYKMD-
GLMU_THEAB      ---EVGVVLGHKHEM---VEKVIPQDVKIFL--QNEQLGTAHAVMCGFDFIPEKDNLLILYGDVPF---I
GLMU_SODGM      Y-------------------------APLNWVLQAEQRGTGHAVQQTLTCLRDEEDVLILYGDVPL---I
GLMU_SHESR      --LKLALGEQQLNWML-----------------QAEQLGTGHAVAQAIPNIDDNDTVLILYGDVPL---I
GLMU_CORGL      ---------------------------------QEEQNGTGHAVQCADQLEGFEGTIIVTNGDLLTDH--
GLMU_BURM1      ------------------------------FAVQAEQLGTGHAVRQALPLLDPAQPTLVLYGDVPLTR--
GLGC_SERP5      ----WSFLNEEMNEFVDLLPAQQRLSTEHWYKGTADAVYQNLDIIRRYDA----EYVVILAGDHIYKMDY
GLGC_LACAC      --------------------------------------GTAHAIYQNIDYIDSKDYVLILSGDHIYKMDY
GLMU_VIBCH      IHLVYGHGGDQMQQAL--------ANENVNWVLQAQQLGTGHAVDQASPHFQDDEKILVLYGDVLISED-
GLMU_PROMS      ------------------VQKSIPKDKKIHVVVQEPQSGTGHAVLCSKLLVLNGDVPLIRPTTLLYLHDS
GLMU_PROM2      --------------------KAIPNDKKFHVVVQEPQSGTGHAVLCGKLLVLNGDVPLIRP---------
GLMU_AZOVD      ------------------------------FVLQAEQLGTGHAVAQALPALSAERVLILYGDVPLIEAD-
GLGC_FRAP2      ----WGFLRGELNEFIDLLPAQQRVDEESWYRGTADAVYQNIDILRSYG----PEYVIVLAGDHIYKMDY
GLMU_PROM9      ----------------------IPDNKKIHFVIQEPQSGTGHAILCGKLLVLNGDVPLITPE--------
GLMU_CORGB      ---------------------------------QEEQNGTGHAVQCADQLDGFEGTIIVTNGDLLTDH--
GLGS_ORYSJ      YGNNIGGYKNEGFVEV-LAAQQSPDNPNWFAVRQYLWLFEEHNVM---------EF-LILAGDHLYRMD-
GLGC_THENN      ------------------------------------------------------ELVLVLSGDHVYAMNY
GLGC_ROSDO      WSF-FRAERNESLDILPASQQM--NDENWY-------KGTADAVAQNKDIIEGPKYIIILAGDHIYKQDY
GLGC_LACCB      -------------------------------------------------------YLLILSGDHIYKMD-
GLGC_LACC3      -------------------------------------------------------YLLILSGDHIYKMD-
GLGC_CLOB8      ------------------------------------------------------EYILILSGDHIYKMDY
GLMU_STAES      -QSLYSFQDKQ--------------------------LGTAHAVKMAHEHLADKETLVVCGDTPLITYQ-
GLMU_STAEQ      -QSLYSFQDKQ--------------------------LGTAHAVKMAHEHLADKETLVVCGDTPLITYQ-
GLMU_STAEP      -QSLYSFQDKQ--------------------------LGTAHAVKMAHEHLADKETLVVCGDTPLITYQ-
GLMU_PSEU5      ------------------------------FVVQAEQLGTGHAVAQALPHLSAERVLILYGDVPLIEAE-
GLMU_PELPD      ---------------------------------QAEQLGTGHAVACAAPLAGFSGTVLILCGDTPLLRG-
GLMU_MICAN      LNVSESLHPQRKLVIIGYVRNTLQHLDDIEFVEQKEQLGTGHAIQQLIP--HLEDFQ---GDLLVLNGDL
GLMU_GEOMG      EQVAFALQEEQ-----------------------------------------------------------
GLMU_BURVG      -----------------------------------EQLGTGHAVRQALPLLDPAQPTLVLYGDVPLTR--
GLGC_MYCSS      ------------------------------------------------------DYIVVFGADHVYRMDP
GLGC_FRATW      ----WGFLRGELNEFIDLLPAQQRVDEEHWYRGTADAVYQNIDILRSYG----PEYVIVLAGDHIYKMDY
GLGC_FRATO      ----WGFLRGELNEFIDLLPAQQRVDEEHWYRGTADAVYQNIDILRSYG----PEYVIVLAGDHIYKMDY
GLGC_FRATN      ----WGFLRGELNEFIDLLPAQQRVDEEHWYRGTADAVYQNIDILRSYG----PEYVIVLAGDHIYKMDY
GLGC_FRATH      ----WGFLRGELNEFIDLLPAQQRVDEEHWYRGTADAVYQNIDILRSYG----PEYVIVLAGDHIYKMDY
GLGC_FRATF      ----WGFLRGELNEFIDLLPAQQRVDEEHWYRGTADAVYQNIDILRSYG----PEYVIVLAGDHIYKMDY
GLGC_EXIS2      ------------------------------------------------------DYVLVLSGDHIYKMD-
GLGC_ACIBL      WSGIVGNELGEFIEILPPMKR----------VSENWYMGTADAVYQNIYSIGSEQYVLILSGDHIYNYD-
ISPD_IDILO      ----------------------------------------------------------------------
GLMU_SOLUE      ------------------------------FIEQTEQKGTGHAVLIGRALAGLDGHLMVLYGDCPL---L
GLMU_RUTMC      -------------------------DSNINWVEQTEQLGTGHAVAQAMPHIEDNSISLILYGDVPL---I
GLMU_PSEHT      -----------------------------------EQLGTGHAVAQANSHVNDDDTVLILYGDVPLTKQ-
GLMU_BURCM      -----------------------------------EQLGTGHAVRQALPLLDPAQPTLVLYGDVPLTR--
GLMU_BURCC      -----------------------------------EQLGTGHAVRQALPLLDPAQPTLVLYGDVPLTR--
GLMU_BORPE      PGLQFALQQPQH--------------------------GTGHAVQQAVPQLGEDDVTLVLYGDVPL---V
GLGC_THEP1      ------------------------------------------------------ELVLILSGDHVYAMNY
GLGC_DESRM      -------------------------------------------------------YILILSGDHIYKMDY


                         +         .         .         .         .         *         .:210
query           GTGTLKQMVKAVEGTDIRGCIATQQVKREKTNSYGIVAKDNDNLIKAIVEKPAPEKAPSTNAVVGRYLLP
GALU_HAEIN      KKENLAAMIQRFNETGASQIMVT-PVPQENVSSYGVADCGGIELINSIVEKPSIEDAPSNLAVVGRYVFS
GALU_HAEDU      KTENLAAMIKRFSETQC-SQIMVAPVPQEDVSNYGIVDCATDNIIAKMVEKPSIENAPSNLAIVGRYVFS
GALU_PSEAE      GDSVLKQMVKLYNQFRC-SIVAIQEVPPEETNKYGVIARDDIFRVNTMVEKPKPEEAPSNLAIIGRYILT
CAP4C_STRPN     AVPLTKQLMDDYERTH-ASTIAVMPVPHDEVSAYGVIAKDGLYSVETFVEKPAPEDAPSDLAIIGRYLLT
GALU_SHIFL      SQDNLAEMIRRFDETG-HSQIMVEPV--ADVTAYGVVAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLS
GALU_ECOLI      SQDNLAEMIRRFDETG-HSQIMVEPV--ADVTAYGVVAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLS
GALU_ECOL6      SQDNLAEMIRRFDETG-HSQIMVEPV--ADVTAYGVVAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLS
GALU_ECO57      SQDNLAEMIRRFDETG-HSQIMVEPV--ADVTAYGVVAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLS
GALU2_PSEAE     GDGVLTQMVKLYQKYRCT-IVAVMEVNPTETNKYGVIAGDDDGLIRVMVEKPAPEDAPSNLAIIGRYILT
HASC_STRPY      SAKPLKQLMEDYDKTH-ASTIAVMKVPHEDVSSYGVIAPQGKAVVDTFVEKPQPEDAPSDLAIIGRYLLT
HASC1_STRP8     SAKPLKQLMEDYDKTH-ASTIAVMKVPHEDVSSYGVIAPQGKAVVDTFVEKPQPEDAPSDLAIIGRYLLT
HASC1_STRP1     SAKPLKQLMEDYDKTH-ASTIAVMKVPHEDVSSYGVIAPQGKAVVDTFVEKPQPEDAPSDLAIIGRYLLT
HASC2_STRP6     SAKPLKQLMEDYDKTH-ASTIAVMKVPHEDVSSYGVIAPQGKAVVDTFVEKPQPEDAPSDLAIIGRYLLT
HASC1_STRP3     SAKPLKQLMEDYDKTH-ASTIAVMKVPHEDVSSYGVIAPQGKAVVDTFVEKPQPEDAPSDLAIIGRYLLT
HASC2_STRP8     NVKPLKQLIDDYEETH-AATIAVMRVPHEDVSNYGIIAPQAKAVVDTFVEKPQPQDAPSDLAIIGRYLLT
HASC2_STRP3     NVKPLKQLIDDYEETH-AATIAVMRVPHEDVSNYGIIAPQAKAVVDTFVEKPQPQDAPSDLAIIGRYLLT
HASC2_STRP1     NVKPLKQLIDDYEETH-AATIAVMRVPHEDVSNYGIIAPQAKAVVDTFVEKPQPQDAPSDLAIIGRYLLT
HASC1_STRP6     NVKPLKQLIDDYEETH-AATIAVMRVPHEDVSNYGIIAPQAKAVVDTFVEKPQPQDAPSDLAIIGRYLLT
GTAB2_STAS1     DNPAIKQLIEAYEETG-KSVIGVQEVDEAQTHRYGIIDPGRKYEVNEFVEKPKQGTAPSNLAIMGRYVLT
CAP3C_STRPN     TAVPLTRQLMDDYNATQASTIAVMPVRYEDVSSYGVISESSNGLVDAFVEKPKPEEAPSNLAIIGRYLLT
GTAB1_STAS1     DTPAIKQLMNQYETTG-KSIIGVQQVNEIETHRYGIVDPEESYSVNKFVEKPEIGTAPSNLAIMGRYVLK
GTAB_BACSU      ETPGLRQLMDEYEKT-LSSIIGVQQVPEEETHRYGIISEGRRYQVKNFVEKPPKGTAPSNLAILGRYVFT
GTAB_STAHJ      ETPAIKQLMNVYEETG-HSVIGVQEVPESVTHRYGIIKEGRRYEVKQFVEKPKQGTAPSNLAIMGRYILT
GTAB_STAES      DTPAIKQLMDVYEETG-HSVIGVQEVPESDTHRYGVIAKEGSRYVRQFVEKPKQGTAPSNLAIMGRYVLT
GTAB_STAEQ      DTPAIKQLMDVYEETG-HSVIGVQEVPESDTHRYGVIAKEGSRYVRQFVEKPKQGTAPSNLAIMGRYVLT
Y1334_METJA     ---IVKDLIKAHEK---YGCIALERVPKEDVYKYGVI--DGEEIIKNMVEKPKVEEAPSNLIITGAYLLS
EXON_RHIME      CVAGLMDLYHEVGG----NVVGVEQCAPEEASKYGIVGKGHGFSVTEMVEKPAAGKAPSNYYLNGRYILQ
GALU_MYCPN      --PALAQCIQAYEQTDCQ-VIGVQEVPHDQVNKYGIVTPEKQALVKGMVEKPAVNEAKSNLAILSRYILK
CELA_ACEXY      CIGQLVEVYNKTGG----NVLAVTEVPREQTGSYGIVGKDDGKTVKGLVEKPDPKDAPSTLSVIGRYVLT
GALU_MYCGE      --PALKQCLEAYYETNCQ-TIGVQEVDPCHVDKYGIITPEGDDLIKAMTEKPKPKDAKSNLAILGRYVLK
GTAB_STAAW      EVPAVKQLIDVYEETG-HSVIGVQEVPEADTHRYGIIDPLTKNEVKKFVEKPAQGTAPSNLAIMGRYVLT
GTAB_STAAS      EVPAVKQLIDVYEETG-HSVIGVQEVPEADTHRYGIIDPLTKNEVKKFVEKPAQGTAPSNLAIMGRYVLT
GTAB_STAAN      EVPAVKQLIDVYEETG-HSVIGVQEVPEADTHRYGIIDPLTKNEVKKFVEKPAQGTAPSNLAIMGRYVLT
GTAB_STAAM      EVPAVKQLIDVYEETG-HSVIGVQEVPEADTHRYGIIDPLTKNEVKKFVEKPAQGTAPSNLAIMGRYVLT
GTAB_STAAC      EVPAVKQLIDVYEETG-HSVIGVQEVPEADTHRYGIIDPLTKNEVKKFVEKPAQGTAPSNLAIMGRYVLT
GTAB_STAA8      EVPAVKQLIDVYEETG-HSVIGVQEVPEADTHRYGIIDPLTKNEVKKFVEKPAQGTAPSNLAIMGRYVLT
GTAB_STAA3      EVPAVKQLIDVYEETG-HSVIGVQEVPEADTHRYGIIDPLTKNEVKKFVEKPAQGTAPSNLAIMGRYVLT
GTAB_STAAR      EVPAVKQLIDVYEETG-HSVIGVQEVPEADTHRYGIIDPLTKNEVKKFVEKPAQGTAPSNLAIMGRYVLT
GTAB_STAAB      EVPAVKQLIDVYEETG-HSVIGVQEVPEADTHRYGIIDPLTKNEVKKFVEKPAQGTAPSNLAIMGRYVLT
GALF_SALTY      ----LAAMVARFNETG-RSQVLAKRMKGDLSEYSVIQTKDNEGKVSRIVEKPQPQTLDSDLMAVGRYVLS
GALF_SALTI      ----LAAMVARFNETG-RSQVLAKRMKGDLSEYSVIQTKDNEGKVSRIVEKPQPQTLDSDLMAVGRYVLS
GALF_KLEPN      GTANLAAMIARFNETGMPGDLSEYSVIQTKE---PMVAEGQVARIVEFIEKPEPQTLDSDLMAVGRYVLS
GALF_ECOLI      LRYNLAAMIARFNETG-RSQVLAKRMPGDLSEYSVIQTKDREGKVSRIVEKPQPQTLDSDIMAVGRYVLS
GALF_ECO57      LRYNLAAMIARFNETG-RSQVLAKRMPGDLSEYSVIQTKDREGKVSRIVEKPQPQTLDSDIMAVGRYVLS
GALF_SHIFL      LRYNLAAMIARFNETG-RSQVLAKRMPGDLSEYSVIQTKDREGKVSRIVEKPQPQTLDSDIMAVGRYVLS
YTDA_BACSU      NQPALGQLIEAYTKYQ-SSVIGLKETKTEDLHHYGVIVEKGLYRIQDIVEKP-KQNPPSHFAAAGRYIFT
GLMU_METM5      D-----------EILDYENAVALSKV--DNPENFGVIELGYDNKVINLLEKPKKEELTSNFINAGIYKLQ
GLMU_METM7      DEILVYENAVALS-------------KVGHPENFGVVELGYDNKIINLLEKPKKEELPSNLINAGIYKLQ
GLMU_METVS      ----------ILEFLNYENAVGLSKV--DNPENFGVIELGYDNKVINLLEKPNEDEIKSSNLIAGIYKLE
GLMU_META3      --------LTNIVNDDVKNIITLNEV--DNPSNFGVIVVDNQNNIIELQEKPKNPKSNLINA--GIYKFE
RMLA1_ECOLI     ----LPKLMEAAVNKESGATVFAYHV--NDPERYGVVEFDKNGTAISLEEKPLEPK--SNYAVTGLYFYD
RMLA_SALAN      ----LPKLMEAAVNKESGATVFAYHV--NDPERYGVVEFDQSGTAVSLEEKPLQPK--SNYAVTGLYFYD
RMLA_SALTY      ----LPKLMEAAVNKESGATVFAYHV--NDPERYGVVEFDQKGTAVSLEEKPLQPK--SNYAVTGLYFYD
RMLA1_SHIFL     ----LPKLMDTAVNRESGATVFAYHV--NDPERYGVVEFDDNGTAISLEEKPQEPK--SNYAVTGLYFYD
GLMU_METMP      D-----------EILNYENAVSLSNV--DNPENFGVIELGYDNKIINLLEKPKKEEITSNLINAGIYKLQ
RMLA3_ECOLX     ----LPKLMEAAVNKESGATVFAYHV--NDPERYGVVEFDNNGTAISLEEKPLEPK--SNYAVTGLYFYD
RMLA_STRMU      GPG-LSRMLQKAASKESGATVFGYQVK--DPERFGVVEFDNDRNAISIEEK--PEHPKSHYAVTGLYFYD
GLMU_METJA      ----LEEF--------LXXXXXXXXXXXXNPENFGVVVLDDENNIIELQEKPENPKSNLINA--GIYKFD
RMLA_NEIMB      -TQTLKQAAAQTHG----ATVFAYQVKNPE--RFGVV-EFNEN-FRAVSIEEKPQRPKSDWAVTGLYFYD
RMLA_XANCP      -TDTLRRADAREQGATVFGYWVNDPER------YGVAEFDQHGKVIDIAEK--PEKPRSNYAVTGLYFYD
RMLA_XANCB      -TDTLRRADAREQGATVFGYWVNDPER------YGVAEFDQHGKVIDIAEK--PEKPRSNYAVTGLYFYD
RMLA_NEIMA      -TQTLKQAAAQTHG----ATVFAYQVKNPE--RFGVV-EFNEN-FRAVSIEEKPQRPKSDWAVTGLYFYD
STRD_STRGR      -VGVVEDSVREFRAARPDAHLMLTRVPEPR--SFGVAELSDSGQVLGLEEKPAHPK--SDLALVGVYLFS
RMLA_NEIGO      -TQTLKQAAAKTHGATVFG------YRVKDPERFGVVEFDENFNALSIEEKPQQPK--SDWAVTGLYFHD
SPSI_BACSU      ---SLKPYTERFEQQGKGAKVLLKEV--DDPERFGIAEIDEKNRIRSIIEK--PEQPPTNLCVTGIYMYD
GMPPB_DROPS     ---PFKQLVQFHRNHGKEGTIVVTKV--EEPSKYGVVLYDEDGCIKNFIEKPQEFVSNKINA--GIYIFN
MPG1_CRYNE      -----------------EGSIMVTKV--AEPSAYGVVTKPNSTVIDRFVEKPVEFVGNRINA--GIYIFN
MPG12_CANGA     GKGTI---------------VAT---KVDEPSKYGVIVHDTPNLIDRFVEKPKEFVGNRINA--GLYILN
GMPPB_DROME     ---PFKQLVQFHCNHGKEGTIVVTKV--EEPSKYGVVLYDENGCIKNFIEKPQEFVSNKINA--GIYIFN
GLMU_GEOUR      STATLKAMVK--QHRSRHAVITVLTADFAQPNGYGRIVKDGDGFIKRIVEE-------------------
RMLA2_SHIFL     -SPKLRHVAARTEGATVFG---YQVMDPER---FGVVEFDDNFRAISLEEKP---KQPKSNAVTGLYFYD
RMLA2_ECOLI     -SPKLRHVAARTEGATVFG---YQVMDPER---FGVVEFDDNFRAISLEEKP---KQPKSNAVTGLYFYD
GLMU_THETN      TSDTLRKLVEISEGNDV---TILSSIFDDPTGYGRIIRDESGNVVKIVEEKDASEEEKRVKEISGMYVVD
GLMU_LISW6      EASTMEALLKYHHEKRAKATILTTVI--EDPTGYGRIIRDDLGIVEKIVEKDATEKEQRISEITGTYCFD
RMLA_YEREN      G----KQLREVASRNDGATVFGYQVVDAER---FGVIEFDENFNALSIEEK--PQKPKSDWAVTGLYFYD
GLMU_LISMO      EASTMEALLKYHHEKRAKATILTTVI--EDPTGYGRIIRDDLGIVEKIVEKDATEKEQRISEITGTYCFD
GLMU_LISMH      EASTMEALLKYHHEKRAKATILTTVI--EDPTGYGRIIRDDLGIVEKIVEKDATEKEQRISEITGTYCFD
GLMU_LISMF      EASTMEALLKYHHEKRAKATILTTVI--EDPTGYGRIIRDDLGIVEKIVEKDATEKEQRISEITGTYCFD
GLMU_LISMC      EASTMEALLKYHHEKRAKATILTTVI--EDPTGYGRIIRDDLGIVEKIVEKDATEKEQRISEITGTYCFD
MPG1_YEAST      GKGTI---------------VAT---KVDEPSKYGVIVHDTPNLIDRFVEKPKEFVGNRINA--GLYILN
GLMU_LISIN      EASTMEALLKYHHEKRAKATILTTVI--EDPTGYGRIIRDDLGIVEKIVEKDATEKEQRISEITGTYCFD
MPG1_PICAN      HGG---------EAT----IVAT---KVDEPSKYGVIVHDRDNLIERFVEKPVEFVGNRINA--GIYVLN
MPG1_KLULA      GKGTI---------------VAT---KVDEPSKYGVIVHDTPNLIDRFVEKPVEFVGNRINA--GLYILN
MPG11_CANGA     GKGTI---------------VAT---KVDEPSKYGVIVHDTPNLIDRFVEKPKEFVGNRINA--GLYILN
MPG1_GIBZE      ---------HGNEGTIV-------VTKVEEPSKYGVVVHQHRSLIDRFVEKPVEFVGNRINA--GLYIFN
ACBA_ACTS5      DFRPCVQRARETAGGHVFG------VAVADPSAYGVVEFDAAGRVLSIEEKPVRPRSP--YAVPGFYLYD
GMPPB_CAEEL     ---PFKQMVEFHKNHGKEGTIAVTKV--EEPSKYGVVVFDQDGKIDDFVEKPQEYVGNKINA--GLYIFS
MPG1_ASHGO      GKGTI---------------VAT---KVDEPSKYGVIVHDTPNLIDRFVEKPVEFVGNRINA--GLYILN
GLMU_THESQ      SENTLKRMIEERKGADVTILVA----DLEDPSGYGRVIQDGDK-YRIIEDADLPEELKSVTTITGFYVFS
GLMU_PECCP      TLGRLRQ-------TKPQGGIGLLTVKLDDPTGYGRIVRENGAVVGIVEHKDASEEQRQINEINTGILIA
GLMU_THEP1      SENTLKRMIEERKGADVTILVA----DLEDPSGYGRVIQDGDK-YRIIEDADLPEELKSVTTITGFYVFS
GLMU_ENTS8      SVDTLQQLCAAKP----QGGIGLLTVKLDDPTGYGRITRENGNVSGIVEHKDASDEQRQINEINTGILVA
RMLA_RHISN      XXXXXXXXXXXXXXT-----IFAYHV--NDPERYGVVEFDEGMNALSIEEKPAAPK--STWAVTGLYFYD
GLMU_THEMA      SENTLKRMIEERKGADVTILVA----DLEDPSGYGRVIQDGDK-YRIIEDTDLPEELKSVTTITGFYVFS
GLMU_GEOSL      RTETLRAMVTAHEATG--AVLTVLTARQENPHGYGRIIRGFDGRVIRIVEEATPDERSRTEVNAGIYCAA
GLMU_BACA2      TAETMEAMLN--EHTDKGAKATVLTAVADDPAGYGRIIRSEDGAVQKIVEKDASEQERLVKEITGTYCFD
GLGC_MYCMO      ----YSKMLDFHKEKNANVTIATINVSFEEASRFGILNTNENNMVEEFEEKPKIPK--STKASMGVYIFN
GLMU_SERP5      SVDTLQRLMAAKP----QGGIGLLTVKLADPSGYGRIVRENDQVVGIVEHKDANEAQRQINEINTGILVA
MPG1_SULAC      N--------KLLEYHQSKGCNATLTATQEDPSRYGVLITDGHRLIQ-IIEKP---KTPLSNLVAGIYVFK
GLMU_ENTFA      ---TLKNLFDYHQGKNASATILTAHA--EDPTGYGRIIRDHVGIVERIVEQASEEEARVQEINTGTFCFD
GMPPB_CAEBR     ---PFKQMVEFHKQHGKEGTIAVTKV--EEPSKYGVVVFKEDGKIDDFVEKPQEYVGNKINA--GLYIFN
GLMU_BACSU      ---TMEQMLKEHTQREAKRTILT--AVAEDPTGYGRIIRSENGAVQKIVEDASEEERLVTEINTGTYCFD
GLMU_BACLD      MEAMLTEHQKKAAKVTILTAVA------EDPTGYGIIRNENGDVAKIVEHKDATEEERLVKEITGTYCFD
GMPPB_DANRE     -------QQHGREGTIV-------VTKVEEPSKYGVVVYEGDSRIHRFVEKPQVFVSNKINA--GMYIFS
GLMU_BACHD      TAETIDHVMSYHEEEQAKATVLTAEL--ADPTGYGRIVRNDKGLVERIVEDATSEEKQITEVNTGTYCFD
GMPPB_XENTR     ---PFEEMVRFHKHHGKEGTIVVTKV--EEPSKYGVVVYEAESQIQRFVEKP-------------QVFVS
GMPBB_XENLA     ---PFEDMVRFHKHHGKEGTIVVTKV--EEPSKYGVVIYEAESRIQRFVEKP-------------QVFVS
GLMU_BACSK      TAATIKKLMDTHEANGAKATVLTAHA--PDPTGYGRVIRGNQGQVEKIVEDASVDELAIAEVNTGTYCFD
GLMU_LACS1      PLFTAKTFEELFEYHKSKGAVATLTAHAENPFGYGRIIRNEIGIVEKIVEQATVEEATVKEINTGVYCFD
GLMU_SYNWW      SLQQLMESHRQKQAT-----ATVLSVNMQNPSGYGRILRDQQGFLRIIEEKDANDEEKKIKEISGIYFCA
GLMU_RHOFD      QAATLRHLI-AAAGTD---KLALLTIDFADPTGYGRIVRRGD-VVQAIVEQATPVQREITEVYSGIMALP
GMPBA_XENLA     ---PFEDMVRFHKHHGKEGTIVVTKV--EEPSKYGVVVYETESQIQRFVEKP-------------QVFVS
GMPPB_MOUSE     ---PFQAMVQFHRHHGQEGSILVTKV--EEPSKYGVVVCEADGRIHRFVEKPQVFVSNKINA--GMYILS
GLMU_PHOLL      GADTLERLL----AVKPEGGIGLLTAILDNPTGYGRIVRENGEVTGIIEQKDATEEQRKINEINTGILVA
GLMU_LACRJ      PLFTAETFEKLFEYHEQRHAAATTSIAPDPT-GYGRIVRNDVGIVERIVEKDATVQEQAIKEITGVYCFD
GLMU_LACRD      PLFTAETFEKLFEYHEQRHAAATTSIAPDPT-GYGRIVRNDVGIVERIVEKDATVQEQAIKEITGVYCFD
GMPPB_PIG       QEGSI------------------LVTKVEEPSKYGVVVCEADGRIHRFVEKPQVFVSNKINA--GMYILS
GMPPB_HUMAN     ---PFQAMVQFHRHHGQEGSILVTKV--EEPSKYGVVVCEADGRIHRFVEKPQVFVSNKINA--GMYILS
GLMU_THEP3      TSNTLKELINIKEGNSVT---ILSSVLEDPTGYGRIIRDKSGNVIRIVEDKDATEEEKSIHEINSAMYVM
GLMU_NITEC      KSNTLKSLIKACEDS-----LALLTVELNDPAGYGRIIRDKTNRVQAIVEEPSQKKIREIN--TGIMVLP
GMPPB_BOVIN     ---PFEAMVQFHRHHGQEGSILVTKV--EEPSKYGVVVCEADGRVHRFVEKPQVFVSNKINA--GVYILS
GLMU_THEYD      ---TLDSFIELFNKNGLDMALLSFYPQRE--HSYGRILRDGEQKIKKIVEITKDELMLSSEANSGIYILK
GLMU_SALTI      SVETLQRLRDAKP----QGGIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_SALPK      SVETLQRLRDAKP----QGGIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_SALPB      SVETLQRLRDAKP----QGGIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_SALPA      SVETLQRLRDAKP----QGGIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_SALNS      SVETLQRLRDAKP----QGGIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_SALG2      SVETLQRLRDAKP----QGGIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_SALEP      SVETLQRLRDAKP----QGGIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_SALDC      SVETLQRLRDAKP----QGGIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_SALCH      SVETLQRLRDAKP----QGGIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_SALA4      SVETLQRLRDAKP----QGGIGLLTVKLDDPSGYGHITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_OCEIH      GAETFEELIQYHKKTGAKASILTTKV--ENPTGYGRVVRNDQDEVERIVEKDANEGERLIQEITGTYCFD
GLMU_LACSS      TAGTFEKLFAYHHDKGAKATILT--ATAPDPTGYGRIIRNDIGIVEKIVEKDTNDKEAAVNEITGVYCFD
GLMU_FUSNN      PLQTLIDFYNLYKNENADGIILSAIF--ENPFSYGRVIKDGNKVLRIVEEKEANEEQKKVKEIAGVYIFA
GLMU_CLOTE      TSKTIKTLMEYHETNGFHGTILTSII--DNPSGYGRVLRENNGEVDKIIEHKDCLKEELKIKEINAGMYC
GLGC_CORJK      PEQMVQEHIKAGAGVTVAGL----RVPRHEATAFGVIQADDDNKIEQFLEKPAPDDPEVSFASMGNYVFA
GLMU_YERPY      ---TLQRLLAAKP----EGGIGLLTVKLDNPSGYGRIVRENGDVVGIVEHKDASDAQREINEINTGILVA
GLMU_YERPS      ---TLQRLLAAKP----EGGIGLLTVKLDNPSGYGRIVRENGDVVGIVEHKDASDAQREINEINTGILVA
GLMU_YERPP      ---TLQRLLAAKP----EGGIGLLTVKLDNPSGYGRIVRENGDVVGIVEHKDASDAQREINEINTGILVA
GLMU_YERPN      ---TLQRLLAAKP----EGGIGLLTVKLDNPSGYGRIVRENGDVVGIVEHKDASDAQREINEINTGILVA
GLMU_YERPE      ---TLQRLLAAKP----EGGIGLLTVKLDNPSGYGRIVRENGDVVGIVEHKDASDAQREINEINTGILVA
GLMU_YERPB      ---TLQRLLAAKP----EGGIGLLTVKLDNPSGYGRIVRENGDVVGIVEHKDASDAQREINEINTGILVA
GLMU_YERPA      ---TLQRLLAAKP----EGGIGLLTVKLDNPSGYGRIVRENGDVVGIVEHKDASDAQREINEINTGILVA
GLMU_YERP3      ---TLQRLLAAKP----EGGIGLLTVKLDNPSGYGRIVRENGDVVGIVEHKDASDAQREINEINTGILVA
GLMU_YERE8      SVDTLQRLLAAKP----QGGIGLLTVKLDNPSGYGRIVRENGDVVGIVEHKDASDTQREINEINTGILVA
GLMU_SALTY      SVETLQRLRDAKP----QGGIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_SALSV      SVETLQRLRDAKP----QGGIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_SALHS      SVETLQRLRDAKP----QGGIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_PEDPA      PLFTAKTFENLFEYHRQKGAAATILTARENPFSYGRIVRNEVGVVSKIVEQATTEEAEIKEINTGVYCFD
GLMU_ALCBS      RPETLKDFVATVDDS----TLALMTLTLDDPNGYGRIVRDGQNNVQRIVEKDASEAELSIQEINTGILAC
GLGC_EUBE2      ----YKIMLDYHKANNADITIAAMPVPMEEASRFGVVVTDNDNKITEFEEK--PEHPKSNLASMGIYIFS
GLMU_STRSY      ---SLKNLINFHVSHKNVATILTAQA--DNPFGYGRIIRNADGEVQKIVEKDANDFEKQVKEITGTYLFD
GLMU_STRS2      ---SLKNLINFHVSHKNVATILTAQA--DNPFGYGRIIRNADGEVQKIVEKDANDFEKQVKEITGTYLFD
GLMU_STRPZ      ---SLKSLIDFHVNHKNVATILT--ATAQDSFGYGIVRNKNGEVIKIVEQKDANEYEQQLKEITGTYVFD
GLMU_NITEU      KSDTLKALIEKAREDN----LVLLTVELDNPTGYGRIVRDPTNRIQAIVEKDASQSQKKIREITGIMVLP
GLMU_HERAR      TTAASLQRLLDIAGADKLGILT---VDLDNPTGYGRIVRENGAITRIVEQKDANEQERSIREVTGIIVAP
GLMU_ALTMD      ---TLSALKAVKESCD----LALLTVNLDDPTGMGRIIRENDNITAIVEHKDATEAQRAIKEITGMMMMS
GLGC2_VIBCH     AAMLEEHISKNATLT-----IACMQVPRHEASAFGVMAIDDDSRITCFVEKPAPNRPDHSLASMGIYI--
GLMU_STRU0      PLITGESLKNLIDFHVNHKNVATLTAKAEDPFGYGIIRNHDDEVVKIVEQKDANEYEQKVKEITGTYVFD
GLMU_STRR6      ITG---ESLKNLIDFHINHKNVATILTAETDNPFGIVRNDNAEVLRIVEQKDATDFEKQIKEITGTYVFD
GLMU_STRP2      ITG---ESLKNLIDFHINHKNVATILTAETDNPFGIVRNDNAEVLRIVEQKDATDFEKQIKEITGTYVFD
GLMU_SHEAM      ---TRKETLEALLAARQPDGVAVLTVHLDNPTGYGRMVREGGKVVGIVEQKDAPEQLKINEINSGIMALP
GLMU_SALAR      SVETLQRLRDAKP----QGGIGLLTVKLDDPSGYGRITRVNGKVTGIVEHKDATDEQRQIKEINTGILIA
GLGC2_VIBPA     AAMLEEHKEKGAKLT-----VACMDVPVKDASAFGVMGIAENGLVKSFVEKPEPPTLPDDNASMGIYIFD
GLMU_STRSV      PLITGESLKNLIDFHINHKNVAT-ILTAEADNPFGIVRNQHDEVLKIVEQKDASDFEQQIKEITGTYVFD
GLMU_SHISS      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_SHIFL      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_SHIF8      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_SHIBS      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIS
GLMU_SHIB3      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_PELCD      --ETLERLIAEHEKT--RAAVTVLTAELSQPFGYGRILREGDEVLGIVEEKDASSEQKTIREITGIYAFE
GLMU_LACPL      ---TFEELFEYHQAKGAAGTILTS--KAPNPQGYGRVVRNRLGIVEKIVEKDATKEEQEIHEITGVYCFD
GLMU_ESCF3      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_ECOUT      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_ECOSM      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_ECOSE      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_ECOLU      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_ECOLI      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_ECOLC      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_ECOL6      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_ECOK1      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_ECOHS      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_ECODH      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_ECOBW      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_ECO8A      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_ECO81      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_ECO7I      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_ECO5E      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_ECO57      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_ECO55      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDELRQIQEINTGILIA
GLMU_ECO45      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_ECO24      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_SHIDS      SVETLQRLRDARP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_NEIMA      DVETLETLLEAA-GNEV-GLLTDVPA---DPSGLGRIIRDSSGSVTAIVEEKDADAAQKAVKEIGILVLP
GLMU_EDWI9      SAATLQRLIAAKP----QGGIGLLTVKLDDPSGYGRIVRHHDRVVGIVEHKDASEAQRRINEINTGILVA
GLMU_ECOL5      SVETLQHLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_ACIBS      ---TLEQLIEASNKTGI-GMIT---LHVDNPTGYGRIVR-QDGKIQAIVEKDATEAQRQIQEITGIYCVS
GLMU_STRZT      ITG---ESLKNLIDFHINHKNVATILTAETDNPFGIVRNDNAEVLRIVEQKDATDFEKQIKEITGTYVFD
GLMU_STRZJ      ITG---ESLKNLIDFHINHKNVATILTAETDNPFGIVRNDNAEVLRIVEQKDATDFEKQIKEITGTYVFD
GLMU_STRPN      ITG---ESLKNLIDFHINHKNVATILTAETDNPFGIVRNDNAEVLRIVEQKDATDFEKQIKEITGTYVFD
GLMU_STRPI      ITG---ESLKNLIDFHINHKNVATILTAETDNPFGIVRNDNAEVLRIVEQKDATDFEKQIKEITGTYVFD
GLMU_STRPG      ---SLKSLIDFHVNHKNVATILT--ATAQDPFGYGRIVRNKDEVIKIVEQKDANEYEQQLKEITGTYVFD
GLMU_STRPF      ---SLKSLIDFHVNHKNVATILT--ATAQDPFGYGRIVRNKDEVIKIVEQKDANEYEQQLKEITGTYVFD
GLMU_STRPC      ---SLKSLIDFHVNHKNVATILT--ATAQDPFGYGRIVRNKDEVIKIVEQKDANEYEQQLKEITGTYVFD
GLMU_STRPB      ---SLKSLIDFHVNHKNVATILT--ATAQDPFGYGRIVRNKDEVIKIVEQKDANEYEQQLKEITGTYVFD
GLMU_STRP7      ITG---ESLKNLIDFHINHKNVATILTAETDNPFGIVRNDNAEVLRIVEQKDATDFEKQIKEITGTYVFD
GLMU_STRP6      ---SLKSLIDFHVNHKNVATILT--ATAQDPFGYGRIVRNKDEVIKIVEQKDANEYEQQLKEITGTYVFD
GLMU_STRMU      ---SLKNLLHYHKSHKNVATILTAEA--DDPFGYGIIRNQNAEVIKIVEQKDASDYEQQVKEITGTYVFD
GLMU_LACBA      ---TFEDLFAYHEAKHAAATILTSMA--PDPTGYGRIVRNNIGIVEKIVEKDANSEEQEIHEITGVYVFD
GLMU_KLEP3      SVETLQRLRAAKP----LGGIGLLTVKLDNPTGYGRITRENDQVTGIVEHKDASEAQRQIQEINTGILIA
GLMU_DIAST      -AATLRALVEAGAGER----LALLTVRLPNPTGYGRIVRGEGGTVQRIVEKDANDAERAIDEVYGIMAVP
GLGC_GEOLS      ----VTQMIQFHRMNRADLTIASLEVPKEEASRFGVFSVDDDNRVTAFTEKPKPETIPGREASMGNYIFP
GLGC_CLOPE      ----YDKMLEMHKQKEADATIAVINVPMHEASRFGIMNTNEDLSIYEFEEKP--EHPKSTNASMGIYIFN
GLMU_STRP1      ---SLKSLIDFHVNHKNVATILT--ATAQDPFGYGRIVRNKDEVIKIVEQKDANEYEQQLKEITGTYVFD
GLMU_ECO27      SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLGC_THELT      NDIIDFHILKGAEGT-----IACIEVPPEETNRFGIMMTDLDSRIVDFEEK--PQRARSNLASLGIYVFN
GLMU_STRP4      ITG---ESLKNLIDFHINHKNVATILTAETDNPFGIVRNDNAEXLRIVEQKDATDFEKQIKEITGTYVFD
GLMU_SHESH      QASTLEALLAAREDNG----LAILTVNLANPMGYGRIVREANKVVGIVEQKDASAEQLAINEITGIMAAP
GLMU_SHELP      QVSTLEALLAA---RDANG-LAILTVNLHDPTGYGRIVREAGKVVGIVEQKDANEEQLKINEITGIMAAP
GLMU_LACLA      ITGTLEALFDYHFAQNATATILT--AIAPNPTGYGRIIRDENGSVEKIVEKDANDFEKSTEINTGTYIFD
GLMU_HAEIN      PLITKETLEKLIEAKPENG-IALLTVNLDNPTGYGRIIRENGNVVAIVEQKDANAEQLNIKEVTGVMVSD
GLMU_ERWCT      SSQTLVHLREAKP----QGGIGLLTVKLDDPAGYGRIVREKGAVVGIVEHKDASEAQRQINEINTGILIA
GLMU_DESHD      ---TLRNLVRIAAATLLTACF-------ENPHGLGRILKEGDQFLRVVEEKDAPEERLIQEINTGTYCFV
GLMU_COLP3      -VSTLESLL-AAKPTD---GMALLTVHLANPMGYGRIVRQKQQVVGIIEQKDANEEQLKINEANTGILLA
GLMU_CELJU      -AATLQKLVAGV--TDQQMALLT--VDLPDPSGYGRIVRDTSGAVVAIVEKDASDEQTGIMAVKARHLLP
GLGC_CLOPS      ----YDKMLEMHKQKEADATIAVINVPMHEASRFGIMNTNEDLSIYEFEEKP--EHPKSTNASMGIYIFN
GLMU_STRT1      ---SLKNLIDFHVNHKNVATILT--ATADNPFGYGIIRNENGEVTKIVEQKDANEFEQQVKEITGTYVFD
GLMU_STRP8      ITGSLKSLIDFHVNHKNVATILTATAP--DPFGYGRIVRNKDGVIKIVEQKDANEYEQQLKEITGTYVFD
GLMU_STRP3      ITGSLKSLIDFHVNHKNVATILTATAP--DPFGYGRIVRNKDGVIKIVEQKDANEYEQQLKEITGTYVFD
GLMU_DESHY      ---TLRNLIRIAAATLLTACF-------ENPHGLGRILKEGDQFLRVVEEKDAPEERLVQEINTGTYCFV
GLGC_RHOPS      EK-MLQQHVE--QGADVTGCL---EVARSEASAFGVMDVDAKDVIRSFLEKPAPGKPDKSLVSMGIYVFD
GLGC_HAES2      SQMLLDHVSSNAKCTV--GCI---EVPREQASEFGVMAVDENLKVKAFVEKPIPNKPDTSLASMGIYV--
GLGC_HAES1      SQMLLDHVSSNAKCTV--GCI---EVPREQASEFGVMAVDENLKVKAFVEKPIPNKPDTSLASMGIYV--
GLMU_THEM4      ---TLKRLEKEHVKSNSDVTILTSIL--ENPTGYGRIVRDGK--IRIIEDKDATEEVKKIKEITGIYII-
GLMU_STRT2      ---SLKNLIDFHVNHKNVATILT--ATADNPFGYGIIRNENGEVTKIVEQKDANEFEQQVKEITGTYVFD
GLMU_STRPM      ---SLKSLIDFHVNHKNVATILT--ATAQDPFGYGRIVRNKDEVIKIVEQKDANEYEQQLKEITGTYVFD
GLMU_KOSOT      ---TLINLYKIRREKDYDVVVAS--TFQEDPTGYGRIVRENGKL-RIIEEKDASEE--------------
GLMU_HAEI8      PLITKETLEKLIEAKPENG-IALLTVNLDNPTGYGRIIRENGNVVAIVEQKDANAEQLNIKEVTGVMVSD
GLMU_ACIBY      ---TLEQLIEVSNKTGI-GMIT---LHVDNPTGYGRIVR-QDGKIQAIVEKDATEAQRQIQEITGIYCVS
GLMU_ACIBC      ---TLEQLIEVSNKTGI-GMIT---LHVDNPTGYGRIVR-QDGKIQAIVEKDATEAQRQIQEITGIYCVS
MPG1_NEUCR      ------------EGTIV-------VTKVEEPSKYGVVVPNHPSRIDRFVEKPVQFVGNRINA--GLYIFP
GLMU_STRGC      PLITGESLKNLIDFHINHKNVAT-ILTAEADNPFGIVRNQHGEVLKIVEQKDASDFEQQIKEITGTYVFD
GLMU_RALME      SVDTLKGLVQAA-GAERLGVLT---VEMPDPTGYGRIVRDAGNIVRIVEQKDASEDVRAIREITGIIVCP
GLMU_NITOC      KIETLKRLLAMVD----QGGVGLLTVELANPNGYGRIIRDRVGGVSKIIEEASPEQRRIREVNTGITAIE
GLMU_HAEIG      PLITKETLEKLIEAKPENG-IALLTVNLDNPTGYGRIIRENGNVVAIVEQKDANADQLNIKEVTGVMVSD
GLMU_FERNB      ---TINKLKK--EHEEQKNQVTVLTFVTDNPAGYGRIIRENGK-VRIVEDKDATEEEKKIKEVSGIYIFS
GLMU_CORJK      SPETLQELTATHDGASV----TVLSVNQDNPTGYGRILRTNDGMVTAIVEKDATEKQKETEVNSGVFAFD
GLMU_ACTSZ      ---TLERLVAAKP----ENGIALLTVELENPTGYGRIIRENGSVVAIVEQKDAPEQLKITEVNTGVMVSD
MPG1_CANAL      AAGTI---------------VAT---KVDEPSKYGVIVHDRDNLIDRFVEKPVEFVGNRINA--GLYILN
GLMU_HAES1      ---ISKETLECLISQKPENGIALLTVNLDNPTGYGRVIRENGTVTAIVEQKDAPEQLKITEVNTGVMVSD
GLMU_HAEIE      PLITKETLEKLIDAKPENG-IALLTVNLDNPTGYGRIIRENGNVVAIVEQKDANADQLNIKEVTGVMVSD
GLMU_DESPS      ---SLEEMYDRHRTNSATVTLMTTQLG-DPTN-YGRIISDNGNLLRIVEEKPAEKRIKEINA--GIYCVR
GLMU_AERHH      ---TLQRLLKASDG------MALLTVVLDNPTGYGRIVRSNGQVVGIVEQKDANAEQLAIREVNTGVLVA
GLMU_ACHLI      ---SIDRMFAVHEDNGNDFTIVTAHY--EDPEGYGRIVRNEQGVIQRIVEKDANDFEKEIKEVTGIYIVX
GLGC_STRZT      ----YDDMLQSHKDNNASLTVAVLDVPLKEASRFGIMNTDANNRIVEFEEKPAQPK--STKASMGIYIFD
GLGC_STRZP      ----YDDMLQSHKDNNASLTVAVLDVPLKEASRFGIMNTDANNRIVEFEEKPAQPK--STKASMGIYIFD
GLGC_STRZJ      ----YDDMLQSHKDNNASLTVAVLDVPLKEASRFGIMNTDANNRIVEFEEKPAQPK--STKASMGIYIFD
GLGC_STRR6      ----YDDMLQSHKDNNASLTVAVLDVPLKEASRFGIMNTDANNRIVEFEEKPAQPK--STKASMGIYIFD
GLGC_STRPN      ----YDDMLQSHKDNNASLTVAVLDVPLKEASRFGIMNTDANNRIVEFEEKPAQPK--STKASMGIYIFD
GLGC_STRPJ      ----YDDMLQSHKDNNASLTVAVLDVPLKEASRFGIMNTDANNRIVEFEEKPAQPK--STKASMGIYIFD
GLGC_STRPI      ----YDDMLQSHKDNNASLTVAVLDVPLKEASRFGIMNTDANNRIVEFEEKPAQPK--STKASMGIYIFD
GLGC_STRP7      ----YDDMLQSHKDNNASLTVAVLDVPLKEASRFGIMNTDANNRIVEFEEKPAQPK--STKASMGIYIFD
GLGC_STRP2      ----YDDMLQSHKDNNASLTVAVLDVPLKEASRFGIMNTDANNRIVEFEEKPAQPK--STKASMGIYIFD
EI2BE_YEAST     ----------------------------------------------------------------------
MPG1_EMENI      ------------EGTIV-------VTKVDEPSKYGVVVPNHPSRIDRFVEKPVEFVGNRINA--GMYILN
GLMU_STRTD      ---SLKNLIDFHVNHKNVATILT--ATADNPFGYGIIRNENGEVTKIVEQKDANKFEQQVKEITGTYVFD
GLMU_PSEF5      ---TLQRLLKQV-GPEQLGLLT---VELDDPTGYGRIVRDADGKVVAIVEQKDADEATRTEGNTGILAVP
GLMU_NEIM0      DVETLKTLLEA--AGDKVGLLT--DVPTDPT-GLGRIIRDGNGSVTAIVEETAQKAVKETN--TGILVLP
GLMU_KLEP7      SVETLQRLRAAKP----QGGIGLLTVKLDDPTGYGRITRENGQVTGIVEHKDASEAQRQIQEINTGILIA
GLMU_ERWT9      ITGETLRRLQAVKPD---GGIGLLTVNLANPTGYGRIIRENGRVVGIIEQKDAAPEQLAIGEINTGILLA
GLMU_ACISJ      -AATLRALVEAGAGER----LALLTVRLPDPTGYGRIVRGEGGTVQRIVEKDANDAERAIDEVYGIMAVP
GLGC_STRU0      ----YEEMLQVHKDNMASLTVAVLDVPLKEASRFGIMNTDSNDRIVEFEEKP--EHPKSTKASMGIYIFN
GLGC_STRP4      ----YDDMLQSHKDNNASLTVAVLDVPLKEASRFGIMNTDANNRIVEFEEKPAQPK--STKASMGIYIFD
GLGC_SALTI      SRMLIDHVEKGARCT-----VACMPVPIKEATAFGVMAVDENDKIIDFVEKPAPGDASKSLASMGIYV--
GLGC_RHOPT      EK-MLQQHVE--QGADVTGCL---EVPRAEATAFGVMHTDTTDRIISFLEKPAPGKADKSLVSMGIYVFE
GLGC_RHOPB      EQ-MLQQHVE--QGADVTGCL---EVPRREASGFGVMAVDADDVIHSFVEK-------------------
GLGC_RHOPA      EK-MLQQHVE--QGADVTGCL---EVPRAEATAFGVMHTDTTDRIISFLEKPAPGKADKSLVSMGIYVFE
GLGC_RHOP5      EK-MLQQHVQ--QGAHVTGCL---EVPRKEASGFGVMHVDANDQILSFIEKPAPDKPDMALASMGIYVFE
GLGC_RHOP2      EK-MLQQHVE--QGADVTGCL---EVARSEATAFGVMHVDAKDVIQSFLEKPAPGKPDRALVSMGIYVFD
GLMU_STRSZ      -TPLIRESLKALLDYHIREKNVATILTANAKDPFGIIRNAAGEVVNIVEQKDANEAEQEVKEITGTYIFD
GLMU_LACLM      -LGALFDYHFAQKATTILTAIA------PNPTGYGRIIRDEKDSVEKIVEQKAFEKS-ITEINTGTYIFD
GLMU_LACGA      ---TFNNLFKKHEESGNSATVLT--AKAPNPFGYGRIIRDEDGNVLRIVEQKTPEELAVDEINTGVFCFD
GLMU_HAES2      ---ISKETLECLISQKPENGIALLTVNLDNPTGYGRVIRENGTVTAIVEQKDAPEQLKITEVNTGVMVSD
GLMU_CALS8      ---TLKKLSQKRKEEAAALCLLTAIFE----NPYGIIADENGNVLKIVEERDATEEQRKIKKI-------
GLMU_ALISL      STATVENLLDA----QPTGGIALLTVVLDNPMGYGRIIRRNGPVIAIVEQKDATEKEINTGVMVA---TG
GLGC_STRPS      ----YDDMLQSHKDNNASLTVAVLDVPLKEASRFGIMNTDANNRIVEFEEKPAQPK--STKASMGIYIFD
GLGC_CLOD6      ----YSKMLKFHKEKGSKATIAVIEVPWDEASRFGIMNTNEDSSIYEFEEKPSEPK--SNLASMGVYIFD
GLMU_STRA3      PLIT-GESLKNLIGFHVNHKNVATILTADAANPFGIIRNSDDEVTKIVEQKDANDFEQQVKEITGTYVFD
GLMU_SHESW      QASTLEALLAARP----ENGVAILTVNLANPTGYGRIVREQGKVVGIIEQKDAPEQLLINEINTGIMAVP
GLMU_SHEPC      QASTLEALLAARP----ENGVAILTVNLANPTGYGRIVREQGKVVGIIEQKDAPEQLLINEINTGIMAVP
GLMU_SHEPA      QASTLEALLAARE----ENGLAILTVNLPNPTGYGRIVREGGSVVGIIEQKDANTEQLAINEITGIMAAP
GLMU_SHEHH      QASTLEALLAAREDNG----LAILTVNLPNPTGYGRIVREDGNVVGIVEQKDAAEQLAISEINTGIMATP
GLMU_NEIMF      DVKTLKTLLEAA-GNEV-GLLT--DVPADPT-GLGRIIRDGNGSVTAIVEEKDADAAQKAVKEIGILVLP
GLMU_MARAV      -KDTLETMVADLDERN----LALLTVDMDNPHGYGRIVRNEQGLVQAIVEQKDATAEQQQIQEVNTGILA
GLMU_LACLS      -LGALFDYHFAQKATTILTAIA------PNPTGYGRIIRDEKGSVEKIVEKDANDFEKSTEINTGTYIFD
GLMU_HYPNA      PAATIEDLFGTLSDKTGLGVLG---FEAEDPGLYGRLITGEDGSLEAIVE--AREATPNSGVMAGR---A
GLGC_THEM4      NELVDYHVAKSALGT-----VACMEVPLSEANRFGIMVTDLENRIIEFQEKPKFPK--STLASLGIYVFQ
GLGC_PASMU      SQMLLDHIHSGAKCTV--GCI---EVEREKATEFGVMAVNENLKVKSFVEKPKDPPAPNTSASMGIYV--
GLGC2_ALHEH     GP----MLARHVEGADVTGCL---EVPVEEASAFGVMAVDGDNRVVRFQEKPAPGQSDRALASMGIYILF
GLMU_THISH      GETVRRLLAQLDEGGDL--VILTAALK--SPTGYGRILRDDSGRVQRIVEKDASDSERRVNEVNTGIMAA
GLMU_THELT      --GTIQ---KIINSHNLSNCDATVSVEMNDPTGYGRIVRDKSGKFVKIVEE--SEASNREKAIVGVYIFG
GLMU_STRA5      PLITGESLKNLIDFHVNHKNVAT-ILTADAANPFGIIRNSDDEVTKIVEQKDANDFEQQVKEITGTYVFD
GLMU_STRA1      PLITGESLKNLIDFHVNHKNVAT-ILTADAANPFGIIRNSDDEVTKIVEQKDANDFEQQVKEITGTYVFD
GLMU_LEGPC      QVGTLQSLIECSQRQNDHSVLALLVAELENPSGLGRIIRNNQGEIYSIVEKDANEQVKNIKEIYSGVTLA
GLMU_LEGPA      QVGTLQSLIECSQRQNDHSVLALLVAELENPSGLGRIIRNNQGEIYSIVEKDANEQVKNIKEIYSGVTLA
GLMU_GEOLS      XXXXXXXXXXXXEHAASGAAVTVLTAKLDRPFGYGRIVRDSEGRVRRIVEQASPEEQAIDEVNSGIYCME
GLMU_CLOD6      --ETLKRLFEYHIENKYHATVLTTRV--GNPTGYGRIIRDKGDLLKIVEQKDANSEEKMISEISGIYCFN
GLGC_STRGC      ----YDDMLQSHKDNNASLTVAVLDVPLKEASRFGIMNTDANNRIVEFEEKP--ENPKSTKASMGIYIFD
GLGC_RHISN      EL-MLQQHVDS--GADVTGCL---EVPRMEATGFGVMHVDNEDRIIAFVEKPA-----------------
GLGC_BIFLI      ----FEQMVQQHIESGAEFTVAGIRQPIEESNQFGVIEVDHDNMIKNFQEKPAPDNPNQILASMGNYVAN
GLMU_PSEA7      ---TLQRLLAQVTPDQ----LSLLTVDMLDPTGYGRIVRDDQGAVQAIVETPAQRQIGEIN--TGILAVP
GLMU_LACJO      ---TFNNLFKKHEESGNSATVLT--AKAPNPFGYGRIIRDEDGNVLRIVEQKTPEELAVDEINTGVFCFD
GLGC_KLEP7      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENEKIIEFVEKPANPPAMPTD---------
GLMU_SHEWM      QASTLEALLAARE----ENGLAILTVNLPNPTGYGRIVREANKVVGIIEQKDANAEQLAINEITGIMAAP
GLGC_STRSV      ----YDDMLQSHKDNNASLTVAVLDVPLKEASRFGIMNTDANNRIVEFEEK--PENPKSTKASMGIYIFD
GLGC_GRABC      EI-MLHQHVERQADVTV-GCI---EVPREEATGFGVMQVDDTGRITAFLEKPSPGQPDIALASMGIYVFK
GLGC_ESCF3      SRMLIDHVEKGARCT-----VACMPVPIQEASAFGVMAVDQDEKIIEFVEKPAPPSMPN-----------
GLGC_BACHD      ----YDRMISHHKKLGADATISVIEVPWEEASRFGIMNTNEEMTITQFEEKPT---TPISNASMGIYIFN
GMPPB_DICDI     ADLLAFHKSHGGEGT-------IMVTKVEEPSKYGVVVKEENGQILKFVEKPQVYVGNKINAGV------
GLMU_SHEFN      --STLEALL-AVRPTN---GLAILTVNLPNPTGYGRIVREQGKVVGIIEQKDANAEQLAINEVTGIMAVP
GLMU_NEIMB      DVETLETLLEAA-GNEV-GLLT--DVPNDPTGLGRIIRDSNGSVTAIVEEKDADAVQKAVKEITGILVLP
GLGC_KLEP3      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENEKIIEFVEKPANPPAMPTD---------
GLGC_ECO7I      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPA--NPPS---------MP
GLMU_PSEPF      ---TLQRLLKHV----VPGQMGLLTVELDDPTGYGRIVRDADGKVAAIVEKDASEQRAITEGNTGILAVP
GLMU_PSEMY      -TATLQRLL-ALVSDDQLGLLT---VELADPTGYGRIVRDDSGVVQAIVEHKDASDAQRREGNTGILAVP
GLMU_PSEAE      ---TLQRLLAQVTPDQ----LSLLTVDMLDPTGYGRIVRDDQGAVQAIVETPAQRQIGEIN--TGILAVP
GLMU_PSEAB      ---TLQRLLAQVTPDQ----LSLLTVDMLDPTGYGRIVRDDQGAVQAIVETPAQRQIGEIN--TGILAVP
GLMU_PSEA8      ---TLQRLLAQVTPDQ----LSLLTVDMLDPTGYGRIVRDDQGAVQAIVETPAQRQIGEIN--TGILAVP
GLMU_NITMU      SVETLKKLI-AMAGKQTLGLLT---VELPDPAGYGIVRHSETGEVAAIVEKDASESQRSIGEITGIMAVP
GLMU_CLOAB      ---TVKNLIDFHEKGGYKATIITALI--DNPEGYGRIIRNVDGSVKKIVEKDCTEKVKEINSAMYCFDIK
GLGC_THEAB      ----YNELLDYHKAKSALATVACMEVPLSEASRFGIMVTDLENRIIEFQEKPKQPK--STLASLGIYVFQ
GLGC_STRS7      ----YDDMLQTHKANMASLTVAVIDVPLKEAGRFGIMNTDTNDRIVEFEEKPANPK--STKASMGIYIFN
GLMU_RALEH      SAATLQALV-AEAGTQRLGVLT---VEMPDPTGYGRIVRDAAGSIVRIVEKDASEAEKAIREITGIIVCP
GLMU_PROM5      PLETLKKLIHYHDSQ--KADVSLITTKKKNPHGYGRVFA-KDNLIEMIIEEKDCNNVQKSNLLIGIYCFN
GLMU_AZOSB      GVPTLQRLAAAAGDTR----LALLTVELDNPTGYGRILRDAAGRVVRIVEEKDASDAERRVREVNTGILV
GLGC_SALAR      SRMLIDHVEKGARCT-----VACMPVPIKEATAFGVMAVDESEKIIDFVEKPA-----------------
GLGC_NOVAD      EL-MLRQHVES--GADVTGCLV---VPRIEATGFGVMAVDTSDTITAFVEKPAPGNEDMALASMGIYVFD
GLGC_CLOK5      ANMLKFHKEKKADVT-----IAVIEVPIEETYRFGIVNTKSDMEIYEFQEKPM--KAKSTKASMGVYIFK
GLMU_VIBVY      SSETIESLLDA----QPKGGIALLTVVLDNPTGYGRIVRKNGPVVAIVEQKDANEKEINTGVMVA---TG
GLMU_VIBVU      SSETIESLLDA----QPKGGIALLTVVLDNPTGYGRIVRKNGPVVAIVEQKDANEKEINTGVMVA---TG
GLMU_PSEFS      ---TLQRLLKHV----VPGQMGLLTVELDDPTGYGRIVRNADGKVAAIVEKDASEQRAITEGNTGILAVP
GLMU_BURPS      -TATLKRLADA--ATDARYGVLT--VTLDDPTGYGRIVRDQAGCVTRIVEQASPDELRIDEINTGIVVAP
GLMU_BURP6      -TATLKRLADA--ATDARYGVLT--VTLDDPTGYGRIVRDQAGCVTRIVEQASPDELRIDEINTGIVVAP
GLMU_BURP1      -TATLKRLADA--ATDARYGVLT--VTLDDPTGYGRIVRDQAGCVTRIVEQASPDELRIDEINTGIVVAP
GLMU_BURP0      -TATLKRLADA--ATDARYGVLT--VTLDDPTGYGRIVRDQAGCVTRIVEQASPDELRIDEINTGIVVAP
GLMU_BURMS      -TATLKRLADA--ATDARYGVLT--VTLDDPTGYGRIVRDQAGCVTRIVEQASPDELRIDEINTGIVVAP
GLMU_BURMA      -TATLKRLADA--ATDARYGVLT--VTLDDPTGYGRIVRDQAGCVTRIVEQASPDELRIDEINTGIVVAP
GLMU_BURM7      -TATLKRLADA--ATDARYGVLT--VTLDDPTGYGRIVRDQAGCVTRIVEQASPDELRIDEINTGIVVAP
GLMU_BUCAP      SIESIKKLFTSKKQSDI--SLLTAYVK--NPDGYGRVFKKNGKVIKIIEEQDA-----------------
GLGC_STRA5      MLQTHKDNLASLT-------VAVLDVPLKEASRFGIMNTDSNDRIVEFEEK--PEHPKSTKASMGIYIFD
GLGC_STRA1      MLQTHKDNLASLT-------VAVLDVPLKEASRFGIMNTDSNDRIVEFEEK--PEHPKSTKASMGIYIFD
GLGC_SHISS      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLGC_SHIFL      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLGC_SHIF8      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLGC_SHIDS      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLGC_SHIBS      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLGC_SHIB3      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLGC_RHORU      SKLLAHHIARGSDCT-----VACVDVPREEATGYGCVEVDNDDNIVHFLEKPAPGRPDRAFASMGIYIFA
GLGC_RHORT      SKLLAHHIARGSDCT-----VACVDVPREEATGYGCVEVDNDDNIVHFLEKPAPGRPDRAFASMGIYIFA
GLGC_RHIME      EL-MLQQHVDS--GADVTGCL---EVPRMEATGFGVMHVDNADRIIAFVEKPA-----------------
GLGC_OCEIH      ----YQQMLEQHKRTNADVTISVIEVPWAEAGRFGILHANDEQIIYEFEEKP---KNPSSNASMGIYIFN
GLGC_ECOUT      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLGC_ECOSM      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLGC_ECOSE      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLGC_ECOLU      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLGC_ECOLI      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLGC_ECOLC      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLGC_ECOL6      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLGC_ECOL5      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLGC_ECOHS      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLGC_ECODH      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLGC_ECOBW      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLGC_ECO8A      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLGC_ECO81      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLGC_ECO5E      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLGC_ECO57      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLGC_ECO55      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLGC_ECO45      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLGC_ECO24      SRMLIDHVEKGARCT-----VACMPVPIEEASAFGVMAVDENDKIIEFVEKPAPPSMPN-----------
GLMU_VIBFM      SAETVENLLDA----QPTGGIALLTVVLDNPMGYGRIIRRNGPVIAIVEQKDATEKEINTGVMVA---TG
GLMU_VIBF1      SAETVENLLDA----QPTGGIALLTVVLDNPMGYGRIIRRNGPVIAIVEQKDATEKEINTGVMVA---TG
GLGC_STRA3      ----YDDMLQTHKDNLASLTVAVLDVPLKEASRFGIMNTDSNDRIVEFEEK--PEHPKSTKASMGIYIFD
GLGC_RHIE6      -EWMLQQHVDS--GADVTGCL---EVPRMEATGFGVMHVNDKDEILAFVEKPAPDKPDFALASMGIYVFH
GLGC_MANSM      SQMLLDHVSSGAKCTV--GCI---EVPREEAKEFGVMAVNETLKVKAFVEKPQDPKPNSSLASMGIYVFA
GLGC_LACS1      ----YEAMLDQHKETGASLTVAVIDVPWDEASRFGIMNTDDNNRIIDFEEKPAEPK--SNHASMGIYIFN
GLGC_GEOMG      ----VSQMIGYHRRNRADITIAALEVPVEEARRFGVFCVDDDNRVTAFEEKPAPVTIPGREASMGNYIFS
GLGC_BACLD      GKMLEYHAEKQADAT-----IAVIEVSWAEAGRFGILHTNDKMEITSFEEKP---KYPKSNASMGVYVFK
EI2BG_RAT       ----------------------------------------------------------------------
EI2BG_BOVIN     ----------------------------------------------------------------------
EI2BE_CANAL     ----------------------------------------------------------------------
GLMU_VIBHB      SAETIENLLDA----QPTGGIALLTVMLDNPMGYGRIIRKNGPVVAIVEQKEATEKECNTGVLVA---TG
GLMU_SHEPW      QASTLESLLAV---RDENG-LAILTVNLPNPMGYGRIVREDNKVVGIVEQKDAAEQLAISEINTGIMAAP
GLMU_NEIGO      DVETLETLLEAA-GNEV-GLLTDVPA---DPAGLGRIIRDGSGSVTAIVEEKDASATQKTIREIGILVLP
GLMU_NEIG1      DVETLETLLEAA-GNEV-GLLTDVPA---DPAGLGRIIRDGSGSVTAIVEEKDASATQKTIREIGILVLP
GLMU_LEGPH      QVETLQSLIECSQRQNDHSVLALLVAELENPSGLGRIIRNNQGEIYSIVEKDANEQVKNIKEIYSGVTLA
GLMU_HYDS0      GMQRFLHMVEEYEKIKV-GALVLSSFLPDPTGYGRIVKNGKGDVIKIVEEKEATYEQKQINEVNG-----
GLGC_ACTSZ      SQMILDHVNSGAKCTV--GCI---EVPRESAKEFGVMAVNENLKVKAFVEKPSDPKPNSSLASMGIYVFA
EI2BG_HUMAN     ----------------------------------------------------------------------
GLMU_SHESA      QASTLEALLAARPDNG----VAILTVNLSNPTGYGRIVREQGKVVGIVEQKDANAEQLAINEITGIMAVP
GLMU_CITK8      SVETLQRLRDAKP----QGGIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
GLMU_CHRVO      -ASTLQRLEQAAAG----GMAVLTDVLAD-ASGYGRMVRGADGKLQAIVEHKTPEQLAIREINTGMMALP
GLMU_CARHZ      -ASTLQALIKKHLETGAYATVLTCFL----SNPYGIVRDGYGKIIKIVEEKDATEEKQIAEVNTGIYCFN
GLMU_SACD2      -TDTLAELRAKVSDSS----MGLLTVNLADPNGYGRIVRTNGSVTAIVEQKDAPEQ--------------
GLMU_PSESM      ---TLQRLLKRVTPEQ----LGLLTVKLDDPTGYGRIVRDDQHRVCAIVEHKDATDAQKTEGNTGILAVP
GLMU_PASMU      GPLITAETLQTLIAAKPEHGIALLTVVLDDPTGYGRIVRENGNVVAIVEQKDAAEQLKIQEINTGLLVAD
GLMU_LEGPL      QVETLQSLIECSQRQNDHSVLALLVAELENPSGLGRIIRNNQGEIYSIVEKDANEQVKNIKEIYSGVTLA
GLMU_CLOB8      IERLFNEHIEAKNSATILTAIVND------PTGYGRIVRTNDGVSKIVEHKDCTEKINEMNSGIYCFDIE
GLMU_BURP8      -ASTLKRLTDAA-GHDGYGVLT---VTLDDPTGYGRIVRDAQGKVERIVEQATAEQQKIAEINTGIVVMP
GLGS_BRANA      ----YEKFIQAHRETDADITVAALPMDEKRATAFGLMKIDDEGRIIEFAEKPKGEQ--------------
GLMU_RALEJ      TAATLKALVEAAGNTR----FGVLTVEMPDPTGYGRIVRDAAGSIVRIVEKDASEAVRAIREITGIIVCP
GLMU_MANSM      SKETLEKLIAAKP----ENGIALLTVNLDNPTGYGRIIREKGSVVAIVEQKDAAEQLKITEVNTGVMVSD
GLMU_CLOPS      KAETVKNLVDTHINEKNSATLLTSVI--ENPTGYGRIVRNGESVEKIVEHKDCNEKIQEVNAGMYCFDIE
GLMU_BURCH      -ASTLQRLVDAAR--DGRYGILT--VTLDDPTGYGRIVRDASGFVTRIVEQASPEELKIAEINTGIIVTP
GLMU_BURCA      -ASTLQRLVDAAR--DGRYGILT--VTLDDPTGYGRIVRDASGFVTRIVEQASPEELKIAEINTGIIVTP
GLMU_BURA4      -ASTLRRLVDAAR----EGSYGILTVTLDDPTGYGRIVRDAAGFVTRIVEQASPEQLKIAEINTGIIVTP
GLGS_SOLTU      ----YEKFIQAHRETDADITVAALPMDEKRATAFGLMKIDEEGRIIEFAEKPQGEQ--------------
GLGS_BETVU      ----YERFVQAHRETDADITVAALPMDEKRATAFGLMKIDEEGRIIEFAEKPKGEQ--------------
GLGC_ENTS8      SRMLIDHVEKGARCT-----VACLPVPVAEARAFGVMAVDENSKVIDFVEKPA-----------------
GLGC_ACIAC      ----VRQMIDFHVKNDAHVSVATLPVKLADCNQFGIVETDDNHRIVDFVEKPRPMPGSSTHALMGNYLFN
MPG1_TRIRE      ------------EGTIV-------VTKVEEPSKYGVVVPNHPSRIDRFVEKPVEFVGNRINA--GMYIFN
GLMU_PSEA6      KANTLHNLLQVKNNAD----VALLTVNVADPTGMGRIIRQGDNVTAIVEHKDASDAQRQICEITGMMVLN
GLMU_PSE14      ---TLTRLLKLVNPQQ----LGLLTVTLDDPTGYGRIVRDQQNRVCAIVEKDANDQKAITEGNTGILAVP
GLMU_NOCFA      ---TLGALLDEHRSYQERSAVTVLTFVPDDPNGYGRIVRDADGQVVEIVEDATPEQAAITEVNSGVYAFD
GLMU_EXIS2      ETGA-KVTVLTAHADDATG--------------YGRIVRGEDGNVSKIVEKDAAEELLIKEINTGTYVFD
GLMU_CLOPE      KPETVKNLVDTHINEKNSATLLTSVI--ENPTGYGRIVRNGESVEKIVEHKDCNEKIQEVNAGMYCFDIE
GLMU_CLOK5      ---TIKNMLDFHEAGGYGATILTSIV--QNPFGYGRIIREEDEQVLKIVEHKLQEELQVKEINSGMYCIE
GLMU_CLOK1      ---TIKNMLDFHEAGGYGATILTSIV--QNPFGYGRIIREEDEQVLKIVEHKLQEELQVKEINSGMYCIE
GLMU_BAUCH      ----------------------------------------------------------------------
GLMU_ACIAD      --QTLEKLL-AVSSTTGIGMIT---LRVEDPTGYGRIIRESDKIQAIVEHKDASEQQRQIQEITGIYCVS
GLGS_SOLLC      ----YEKFIQAHRETDADITVAALPMDEKRATAFGLMKIDEEGRIIEFAEKPQGEQ--------------
GLGC_STRMU      ----YDDMLQTHKDNMASLTVAVIDVPLKEASRFGIMNTDSNDRIVEFEEKP--EQPKSTKASMGIYIFN
GLGC_BACCL      QQMLDYHIAKQADAT-----ISVIEVPWEEASRFGIMNTNENMEIVEFAEKPANPK--SNLASMGIYIFN
GLGC_AZOSE      ----LRQMIEFHIATQADATVAALPVPLEHTSSFGIIRTDSAGRIRDFREKPMPGRPGHALASMGNYVFS
GLGC_AZOSB      ----IRQMVQYHVDTHADATVAAIPIPLEQVSSFGIIRTDSAGRIRDFQEKPMPNRPGVALASMGNYVFS
EI2BG_MACFA     ----------------------------------------------------------------------
GLMU_VIBCM      ---TIESLLEA-QPTD---GIALLTVVLEDPTGYGRIVRKRGPVVAIVEQKDASEEQKLIKEVNTGVLVA
GLMU_VIBC3      ---TIESLLEA-QPTD---GIALLTVVLEDPTGYGRIVRKRGPVVAIVEQKDASEEQKLIKEVNTGVLVA
GLMU_VESOH      KRSTLYDLINKTQ----QSGIALLSVILNNPTGYGRIIRNNKQIQAIVEQKDASNMQLNINEVTGIMAIN
GLMU_CLOP1      KPETVKNLVDTHINEKNSATLLTSVI--ENPTGYGRIVRNGESVEKIVEHKDCNEKIQEINAGMYCFDIE
GLMU_CLONN      ---TVKDCIEFHNKGEYKATILTAIV--GNPFGYGRIIRDENGEVKKIVEHKTPEELKVNEINSGMYCFD
GLMU_BURPP      -AGTLQALTERAG----QGGYGVLTVTLADPSGYGRIVRDAQGKVARIVEQATPEQLEIAEINTGIIVAP
GLMU_BDEBA      ----IKDFVRIFRDEKCDLAVVTAVLK--NPGEFGRIVRHKGDLAAIVEAKDASAEALKIREITGIYIVK
GLGC_THESQ      NDLIDYHLLKEADGT-----IACMEVPIEEASRFGIMITDVDGRIVDFEEKPA--KPRSNLASLGIYVFN
GLGC_THEMA      NDLIDYHLLKEADGT-----IACMEVPIEEASRFGIMITDVDGRIVDFEEKPA--KPRSNLASLGIYVFN
GLGC_HAEI8      SVMLMDHVNSGAKCTI--GCI---EVPRSEAHEFGVMAVNENLKVKAFVEKP------------------
GLGC_FERNB      SEFVYYHISKGALAT-----IACMEVPITEAHRFGIMVTDIENKIIEFQEKP---KNPKSNASLGIYVFT
GLGC_CLONN      ----YSKMLQFHKEKNSDATIAVIDVPIEEASRFGIMNTNDDDKIYEFEEK--PEQPKNNKASMGIYIFN
GLMU_THEAB      SYETLKRLEK------------------------------------------------------------
GLMU_SODGM      SPDTLQCLLAARP----QGGIGLLTVTLDNPEGYGRIVRLNGEVAGIVEQKDASEQQRQIKEINTGILVA
GLMU_SHESR      QASTLEALLAARPDQG----VAILTVNLSNPTGYGRIVREQGKVVGIVEQKDANAEQLAINEITGIMAVP
GLMU_CORGL      ---TLSALLDA--HVEVPTAVTVLTMRLDDPTGYGRIVRNEEGEVTAIVEKDASAEVQAIDEVSGVFAFD
GLMU_BURM1      -ASTLQRLVDAAR--DGRYGILT--VTLDDPTGYGRIVRDASGFVTRIVEQATPDELKIAEINTGIIVTP
GLGC_SERP5      SRMLIDHVEKGAQCT-----VACLPVPRDEASEFGVMEVDENDLILEFLEK-------------------
GLGC_LACAC      ES-MLEEHIK--NGASLT--VAVIDVPMKEASRFGIMNTDVSGRITEFEEKP--EHPKSNHASMGIYIFN
GLMU_VIBCH      ---TIESLLEA-QPTD---GIALLTVVLEDPTGYGRIVRKRGPVVAIVEQKDASEEQKLIKEVNTGVLVA
GLMU_PROMS      KNADVSLIT----------------TKKTNPHGYGRVFLNGDFIERIVEEKDCNEENPLINAGVYCFNWG
GLMU_PROM2      --STLKRLLNLHDSKNADVSLIT--TKKTHPHGYGRVFLKGDFIERIVEEKDCNDLERENELIAGVYCIL
GLMU_AZOVD      ---TLRRLLAQV-GPE---RLALLTVDLVDPSGYGRIVRDAAGRVVAIVEDASPEQRAICEGNTGILAVP
GLGC_FRAP2      SV-----MLRDHAQSGYKCTVGCVEIAEEEAYAFGIMGIDEDRKITSFIEKP-KKNAPT---------IP
GLMU_PROM9      ---TLKNLLNLHDSKNADVSLIT--TKKKNPHGYGRVFLKGD-FIERIVEEKDCNNQERLNLLIGVYCFN
GLMU_CORGB      ---TLSALLDA--HVEVPTAVTVLTMRLDDPTGYGRIVRNEEGEVTAIVEKDASAEIQAIDEVSGVFAFD
GLGS_ORYSJ      ----YEKFIQAHRETDSDITVAALPMDEKRATAFGLMKIDEEGRIVEFAEKPKGEQ--------------
GLGC_THENN      NDLIDYHLLKGADGT-----IACMEVPLEEASRFGIMITDVEGRIVDFEEK--PPKPRSNLASLGIYVFN
GLGC_ROSDO      AE-MIRHHVES--GADVTGCI---EVPRMEASGFGVMKVDTEDRILDFIEKPGPGHPDQALASMGIYVFE
GLGC_LACCB      ----YQAMLDYHKAKKASLTVAVMPVEKEEAKRFGIMNTDDTDRIIEFEEKPA--KPKSNLASMGIYIFP
GLGC_LACC3      ----YQAMLDYHKAKKASLTVAVMPVEKEEAKRFGIMNTDDTDRIIEFEEKPA--KPKSNLASMGIYIFP
GLGC_CLOB8      TKMLDFHKEKQAEAT-----IAVIEVPMDEASRFGIMNTREDLSIYEFEEKP---KNPKNNASMGIYIFN
GLMU_STAES      ---TLQSLIEHHEST--QSHVTVLSASTINPYGYGRIIRNHNGILERIVEKDANDSERAIKEISGIFAFN
GLMU_STAEQ      ---TLQSLIEHHEST--QSHVTVLSASTINPYGYGRIIRNHNGILERIVEKDANDSERAIKEISGIFAFN
GLMU_STAEP      ---TLQSLIEHHEST--QSHVTVLSASTINPYGYGRIIRNHNGILERIVEKDANDSERAIKEISGIFAFN
GLMU_PSEU5      ---TLQRLLQKVGPEQ----LALLTVTLDDPTGYGRIVRDGRGEVQAIVEDASADQRAIREGNTGILAVP
GLMU_PELPD      --GTLTDLLAFHRSQGAAVTVLT--ARMENPHGYGRVLRDEAGRVLRIVEQASPQECSVREINSGIYCMA
GLMU_MICAN      RPETLQNLLQIHQDHGNAATLLTANLPNPK--GYGRVFCDGNNLVKQIVEERDCTDAQRQNHRIGIYCFN
GLMU_GEOMG      ----------------------------------------------------------------------
GLMU_BURVG      -ATTLKRLVDAAH--DGRYGILT--VTLDDPTGYGRIVRDAAGFVTRIVEQASPEQLKIAEINTGIIVTP
GLGC_MYCSS      -----EQMVQFHIESGAGATVAGIRVPRAEATAFGVIDADESGRIRSFVEKPAPDNPDEAFVSMGNYIFT
GLGC_FRATW      SI-----MLRDHAQSGYKCTVGCVEIAKEEAYAFGIMGIDENRKITSFIEKP-KKNAPT---------IP
GLGC_FRATO      SI-----MLRDHAQSGYKCTVGCVEIAKEEAYAFGIMGIDENRKITSFIEKP-KKNAPT---------IP
GLGC_FRATN      SI-----MLRDHAQSGYKCTVGCVEIAKEEAYAFGIMGIDENRKITSFIEKP-KKNAPT---------IP
GLGC_FRATH      SI-----MLRDHAQSGYKCTVGCVEIAKEEAYAFGIMGIDENRKITSFIEKP-KKNAPT---------IP
GLGC_FRATF      SI-----MLRDHAQSGYKCTVGCVEIAKEEAYAFGIMGIDENRKITSFIEKP-KKNAPT---------IP
GLGC_EXIS2      ----YEKMIEEHRQGGADVTISVREVPWEEAPRFGILNTDEDLRINEFEEK--PENPKSNLASMGIYVFN
GLGC_ACIBL      ----LMMRQHKDSGADVT--LATILIDPSETRHFGVVDVDNQSHVNGFVEKPSPYDPSKVSASMGIYI--
ISPD_IDILO      ----------------------------------------------------------------------
GLMU_SOLUE      RTETLRRLIAQAAEGPAAGVLLSAMM--DDPYGYGRVIRDSRGHVLDVVEQKSPEQLAIKEANMGIYCFR
GLMU_RUTMC      KKSTLADLIHKAQ----QSGLSLLSVILDNPTGYGRIIR-KDKQIQAIVEKDATNTQLNINEVTGIMAVH
GLMU_PSEHT      --STLERLLAATP----KHGLAVLTVNLANPNGYGRMLRVDGKLVGIVEQKDAPEQLLISEVNTGIMAVN
GLMU_BURCM      -ASTLRRLVDAARD----GSYGILTVTLDDPTGYGRIVRDAAGFVTRIVEQASPEQLKIAEINTGIIITP
GLMU_BURCC      -ASTLQRLVDAAR--DGRYGILT--VTLDDPTGYGRIVRDASGFVTRIVEQASPEELKIAEINTGIIVTP
GLMU_BORPE      QPATLQNLLQARG----RGVAVLTEVLADST-GYGRIVRDAQGQVCRIVEHKDASEAERAIKEVNTGILA
GLGC_THEP1      NDLIDYHLLKEADGT-----IACMEVPIEEASRFGIMITNVDGKIVDFEEKPA--KPRSNLASLGIYVFN
GLGC_DESRM      SLMLDFHKEKQADAT-----IAVIEVPWQEASGFGIMNTAKDARIVEFEEKP---KVPRSNASMGVYIFN


                         .         .         .         +         .         .         .:280
query           NKIFRCLESTSEGAGGEIQLTDAIAKLLDQDEKILSYEFKGTRYDCGSKLGFLIANYEIALQHQELGHKF
GALU_HAEIN      AAIWDLLEKTPIGVGDEIQLTDAIDMLIEK-ETVEAFHMTGETFDCGDKIGYMEAFVEYGIRHEKLGKEF
GALU_HAEDU      ATIWDLLERTPVGVGDEIQLTDAIDMLIEK-ETVEAFHMTGRAFDCGDKLGYMEAFVEYSLRHEKCGQQF
GALU_PSEAE      PDIFDLIEQTEPGKGGEIQITDALMKQA-QDGCVLAYKFKGKRFDCGSAEGYIEA---------------
CAP4C_STRPN     PEIFEILEKQAPGAGNEIQLTDAI-DTLNKTQRVFAREFKGARYDVGDKFGFMKTSIDYALKHPQVKDDL
GALU_SHIFL      ADIWPLLAKTPPGAGDEIQLTDAIDMLIEK-ETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEF
GALU_ECOLI      ADIWPLLAKTPPGAGDEIQLTDAIDMLIEK-ETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEF
GALU_ECOL6      ADIWPLLAKTPPGAGDEIQLTDAIDMLIEK-ETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEF
GALU_ECO57      ADIWPLLAKTPPGAGDEIQLTDAIDMLIEK-ETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEF
GALU2_PSEAE     PDIFKLIEETEPGKGGEIQITDALLKQA-KDGCVIAYKFKGQRFDCGGAEGYIEA---------------
HASC_STRPY      PEIFDILERQTPGAGNEVQLTDAI-DTLNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALEHPQVKEDL
HASC1_STRP8     PEIFDILERQTPGAGNEVQLTDAI-DTLNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALEHPQVKEDL
HASC1_STRP1     PEIFGILERQTPGAGNEVQLTDAI-DTLNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALEHPQVKEDL
HASC2_STRP6     PEIFDILERQVPGAGNEVQLTDAI-DTLNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALEHPQVKEDL
HASC1_STRP3     PEIFDILERQVPGAGNEVQLTDAI-DTLNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALEHPQVKEDL
HASC2_STRP8     PEIFSILEKQEPGAGNEVQLTDAI-DTLNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQVKDDL
HASC2_STRP3     PEIFSILEKQEPGAGNEVQLTDAI-DTLNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQVKDDL
HASC2_STRP1     PEIFSILEKQEPGAGNEVQLTDAI-DTLNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQVKDDL
HASC1_STRP6     PEIFSILEKQEPGAGNEVQLTDAI-DTLNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQVKDDL
GTAB2_STAS1     PDIFDYLATQGEGAGGEIQLTDAIER-LNRADQVYAYDFEGDRYDVGEKLGFVKTTIEYALKDESMHDEL
CAP3C_STRPN     PEIFSILETQKPGAGNEIQLTDAI-DTLNKTQSVFAREFVGKRYDVGDKFNFMKTSIDYALQHPQIKESL
GTAB1_STAS1     PDIFDYLERQEIGRGGEIQLTDAI-EHLNSEDCVYAYNFEGERYDVGEKIGFVKTTIQFALKDDYMKKEI
GTAB_BACSU      PEIFMYLEEQQVGAGGEIQLTDAIQK-LNEIQRVFAYDFEGKRYDVGEKLGFITTTLEFAMQDKELRDQL
GTAB_STAHJ      PEIFDYLETQKEGAGNEIQLTDAIER-MNSDIPVYAYDFDGDRYDVGEKLGFVKTTIEYALKDPKMKDEL
GTAB_STAES      PEIFDYLETQQEGAGNEIQLTDAIER-MNSKQQVYAYDFEGNRYDVGEKLGFVKTTIEYALKDPEMSQDL
GTAB_STAEQ      PEIFDYLETQQEGAGNEIQLTDAIER-MNSKQQVYAYDFEGNRYDVGEKLGFVKTTIEYALKDPEMSQDL
Y1334_METJA     PKIFEKIRETPPGRGGEIQITDAM-NLLLKEEDIIGVEINCKRYDIGDALGWLKANVEIAERFPEFREFL
EXON_RHIME      PEIFSILAHQTRGAGNEIQLTDGML-TLSQSQSFHAHPYEGRTFDCGSKQGFIEANVAFALARADIG---
GALU_MYCPN      PSIFTALKQVPFGVGGELQLTDGLNYCLQQGEPFFAKHFGGTRFDVGTKNGFIKANLYTALK--------
CELA_ACEXY      ADVLKHLAKLEKGAGGEVQLTDAMAKTIGH-VPFHGYRYEGKRFDCGSKI--------------------
GALU_MYCGE      PSIFKALRSVPYGVGGELQLTDGLNFCL-KNENFYARKFTGTRFDVGTKSGFIKANLFTALNNKDI----
GTAB_STAAW      PEIFDYLKTQKEGAGNEIQLTDAIER-MNNDNQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREEL
GTAB_STAAS      PEIFDYLKTQKEGAGNEIQLTDAIER-MNNDNQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREEL
GTAB_STAAN      PEIFDYLKTQKEGAGNEIQLTDAIER-MNNDNQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREEL
GTAB_STAAM      PEIFDYLKTQKEGAGNEIQLTDAIER-MNNDNQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREEL
GTAB_STAAC      PEIFDYLKTQKEGAGNEIQLTDAIER-MNNDNQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREEL
GTAB_STAA8      PEIFDYLKTQKEGAGNEIQLTDAIER-MNNDNQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREEL
GTAB_STAA3      PEIFDYLKTQKEGAGNEIQLTDAIER-MNNDNQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREEL
GTAB_STAAR      PEIFDYLKTQKEGAGNEIQLTDAIER-MNNDNQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREEL
GTAB_STAAB      PEIFDYLKTQKEGAGNEIQLTDAIER-MNNDNQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREEL
GALF_SALTY      ADIWAELERTEPGAWGRIQLTDAIAELA-KKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKF
GALF_SALTI      ADIWAELERTEPGAWGRIQLTDAIAELA-KKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKF
GALF_KLEPN      ADIWAELERTEPGAWGRIQLTDAIAELA-KKQSVDAMLMTGESYDCGKKMGYMQAFVTYGMRNLKEGAKF
GALF_ECOLI      ADIWPELERTQPGAWGRIQLTDAIAELA-KKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKF
GALF_ECO57      ADIWPELERTQPGAWGRIQLTDAIAELA-KKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKF
GALF_SHIFL      ADIWPELERTQPGAWGRIQLTDAIAELA-KKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKF
YTDA_BACSU      PDIFNELEALEADSGGEVQVTDAIKASLGAC-TVYGKLLEGERYDIGLQKDYLKLIYDM-----------
GLMU_METM5      NSVFGILENLVPSERGEIELTDALKKLIEIG-KLHGVELNGYWNDIGHPWDVLSAN--------------
GLMU_METM7      NNVFDILENLVPSERGEIELTDALKKLI-ENGKLHGIELNGYWNDIGHPWDVLSAN--------------
GLMU_METVS      NFVFEILENLLPSERGEIELTDALKKLI-ESSKLYGIELNGYWNDIGRPWDVLSAN--------------
GLMU_META3      NKIFDILETLRPSERGEVELTDAIKELI-KENNIKGIKLNGYWNDIGKPWDLLDANTHI-----------
RMLA1_ECOLI     NDVVQMAKNLKPSARGELEITDINRIYLEQGR--LSVAMMGRGYDTGTHQSLIEASNFIATIEERQGLK-
RMLA_SALAN      NSVVEMAKNLKPSARGELEITDINRIYMEQGR--LSVAMMGRGYDTGTHQSLIEASNFIATIEERQGLK-
RMLA_SALTY      NSVVEMAKNLKPSARGELEITDINRIYMEQGR--LSVAMMGRGYDTGTHQSLIEASNFIATIEERQGLK-
RMLA1_SHIFL     NDVVEMAKNLKPSARGELEITDINRIYMDQGR--LSVAMMGRGYDTGTHQSLIEASNFIATIEERQGLK-
GLMU_METMP      NSVFGILENLAPSERGEIELTDALKKLI-ENGKLHGVELKGYWNDIGHPWDVLSAN--------------
RMLA3_ECOLX     NDVVEARKNLKPSARGELEITDINRIYMEQGR--LSVAMMGRGYDTGTHQSLIEASNFIATIEERQGLK-
RMLA_STRMU      NSVVDIAKNIKPSPRGELEITDVNKAYLDRGD--------------------------------------
GLMU_METJA      KKIFELIEKTKISERGERELTDAIKHLI-KEEKVKGIKLNGYWNDVGRPWDILEAN--------------
RMLA_NEIMB      NRAVEFAKQLKPSARGELEITD------------------------------------------------
RMLA_XANCP      GKASDYAAALKPSPRGELEITDLNRCYLD-----------------------------------------
RMLA_XANCB      GKASDYAAALKPSPRGELEITDLNRCYLD-----------------------------------------
RMLA_NEIMA      NRAVEFAKQLKPSARGELEISD------------------------------------------------
STRD_STRGR      PAIHEAVAAITPSWRGELEITDAVQWLIDAGRDVRSTVISGYWKDTGNVTDMLEVN--------------
RMLA_NEIGO      NRAVEFAKQLKPSARGELEISD------------------------------------------------
SPSI_BACSU      AEVFSYIEQISPSKRGELEITD-VNNLYIENSQLTYDVLSGWWVDAGTHESLYLAS---QLVHQAL----
GMPPB_DROPS     PSVLERIEVKPTSIEKE------VFPAMAEQQELYAMDLTGFWMDIGQPKDFL-----------------
MPG1_CRYNE      PSVLDRIELRPTSI--EKEIFPAIA----ADQQLHSFDLQGFWMDVGQPKDFL-----------------
MPG12_CANGA     PEVIDLIEMKPTSIE-----TETFPKLVN-EKSLYTFDLEGFWMDVGQPKDFLAGT---GLYLQSLSRRH
GMPPB_DROME     PSVLDRIEVKPTSIEKE------VFPEMTQQQELYAMDLTGFWMDIGQPKDFL-----------------
GLMU_GEOUR      ----------------------------------------------------------------------
RMLA2_SHIFL     SKVVEYAKQVKPSERGELEIT-------------------------------------------------
RMLA2_ECOLI     SKVVEYAKQVKPSERGELEIT-------------------------------------------------
GLMU_THETN      IAKLRAAEITNDNAQGEYYLTDAVEIIRNMGGKI------------------------------------
GLMU_LISW6      NKLFEALENVSDNVQGEYYLPDVIKILKDLDEVVAAYRMESFEESLG-----------------------
RMLA_YEREN      KDVVEMAKEIKPSERGELEIT-------------------------------------------------
GLMU_LISMO      NKLFEALENVSDNVQGEYYLPDVIKILKDSDEVVAAYRMESFEESLG-----------------------
GLMU_LISMH      NKLFEALENVSDNVQGEYYLPDVIKILKDSDEVVAAYRMESFEESLG-----------------------
GLMU_LISMF      NKLFEALENVSDNVQGEYYLPDVIKILKDSDEVVAAYRMESFEESLG-----------------------
GLMU_LISMC      NKLFEALENVSDNVQGEYYLPDVIKILKDSDEVVAAYRMESFEESLG-----------------------
MPG1_YEAST      PEVIDLIEMKPTSIEKE------TFPILVEEKQLYSFDLEGFWMDVGQPKDFL-----------------
GLMU_LISIN      NKLFEALENVSDNVQGEYYLPDVIKILKDADEVVAAYKMESFEESLG-----------------------
MPG1_PICAN      PSVIDLIEMRPTSIEHE------TFPILVEQKKLYSFDLPGYWMDVGQPKDFL-----------------
MPG1_KLULA      PEVIDLIDLKPTSIEKE------TFPILVEQKSLYSFDLEGYWMDVGQPKDFL-----------------
MPG11_CANGA     PEVIDLIEMKPTSIETE------TFPILVEQKSLYSFDLEGFWMDVGQPKDFL-----------------
MPG1_GIBZE      TSILDRIELRPTSI--EKETFPAMVK----DNQLHSFDLEGFWMDVGQPKDFL-----------------
ACBA_ACTS5      ADVVETARSLRPSARGELEITE------------------------------------------------
GMPPB_CAEEL     SKI-------------------------------------------------------------------
MPG1_ASHGO      PEVIDLIELRPTSIEKE------TFPILVEQKSLYSFDLEGYWMDVGQPKDFL-----------------
GLMU_THESQ      GDLLRALEIKNENAKGEYYLTDAV----------------------------------------------
GLMU_PECCP      NDLKRWLQLNNNNAQGEFYITDIIAMAAEEGQRV------------------------------------
GLMU_THEP1      GDLLRVLEIKNENAKGEYYLTDAV----------------------------------------------
GLMU_ENTS8      NDLKRWLKLDNNNAQGEYYITDIIAMAWNEGREI------------------------------------
RMLA_RHISN      SEVVDIAANLKPSARGEYEITD------------------------------------------------
GLMU_THEMA      GDLLRALEIKNENAKGEYYLTDAV----------------------------------------------
GLMU_GEOSL      SFLFDAVKRINDNAQGEYYLTDIITMANDR----------------------------------------
GLMU_BACA2      NELFRVIEQVSENAQGEYYLPDVIEILKDEGETVAAYQ-------TGNFQETLGVNDRVALSQAEMYMKN
GLGC_MYCMO      YQLLKDTFEELKSKGNNFQDFNILPYILKKYSKIFAYEFNGYWKDVGTISTFYEANLDLIKNHKNLDLRE
GLMU_SERP5      NDLKRWLGMNNDNAQGEFYITDIIALAHADGKKI------------------------------------
MPG1_SULAC      KELLNKIDGLSIS-------RDFLPKLLVSDTCVSVYPYKGLWMDIGVPRDYMRINLEL-----------
GLMU_ENTFA      NELFEALAKTTNNTQGEYYLTDIIEILKKEGKAVAAYQ--------------------------------
GMPPB_CAEBR     SAI-------------------------------------------------------------------
GLMU_BACSU      NELFRAIDQVSDNAQGEYYLPDVIEILKNEGETVAAYQ--------------------------------
GLMU_BACLD      NELFQTIEQVSDNVQGEYYLPDVIEILKNQGETVAAYQTVNFQETLG-------VNDRVALSQAEIYMKN
GMPPB_DANRE     PAMLRRIQLRPTSIEKE------IFPVMAEEGQLYAMELQGFWMDIGQPKDFL-----------------
GLMU_BACHD      NELFQALEVGNNNAQGEYYLPDVIQILQTKGEKVAAYK--------------------------------
GMPPB_XENTR     NKINSGLYIFSPAVLDRIQLRPTIFPAMAQEGQLFAMELQGFWMDIGQPKDFLTG---MCMYLQSVRQKH
GMPBB_XENLA     NKINSGLYIFSPAVLDRIQLRPTIFPVMAQEGQLFALELQGFWMDIGQPKDFLTG---MCMYLQSVRHKH
GLMU_BACSK      NELFEALEVKNENAQGEYYLPDVIGILRQKGETISAYQ--------------------------------
GLMU_LACS1      NKLFAALQIKNDNAQGEYYLPDVMEIFQKQGKVVAAYQMKNFEESMG-----------------------
GLMU_SYNWW      RKVFSALHSTSRNAQGEYYLTEALELLKNQQESI------------------------------------
GLMU_RHOFD      ARQLKAARLDKQNAQGEYYLTDIVKFAVADGVPVVAHKIADATQVAGVNSPVQLAALERAFQ--------
GMPBA_XENLA     NKINSGLYIFSPAVLDRIQLRPTIFPAMAQEGQLYAMELQGFWMDIGQPKDFLTG---MCMYLQSVRQKH
GMPPB_MOUSE     PAVLQRIQLKPTSIEKE------IFPVMAKEGQLYAMELQGFWMDIGQPKDFLTG---MCLFLQSLRQKH
GLMU_PHOLL      NDLKRWLQLDNNNVQGEYYLTDVIALAYKEGRKI------------------------------------
GLMU_LACRJ      NKLFAALSKTNDNAQGEYYLTDVIGILKQENEIVTAYK--------------------------------
GLMU_LACRD      NKLFAALSKTNDNAQGEYYLTDVIGILKQENEIVTAYK--------------------------------
GMPPB_PIG       PAVLQRIQLQPTSIEKE------IFPVMAKEGQLYAMELQGFWMDIGQPKDFL-----------------
GMPPB_HUMAN     PAVLQRIQLQPTSIEKE------VFPIMAKEGQLYAMELQGFWMDIGQPKDFL-----------------
GLMU_THEP3      DKLKKALRMTNNNAQGEYYLTDAVEIIRDMDGKI------------------------------------
GLMU_NITEC      NMY---LESSNANTQGEYYLTDIIAMAVNDGVQI------------------------------------
GMPPB_BOVIN     PSVLRRIQLQPTSIEKE------IFPVMAKEGQLYAMELQGFWMDIGQPKDFL-----------------
GLMU_THEYD      REVAELVKEIKQNPNGEFYLTDIVEIAVNKGFNIEAY---------------------------------
GLMU_SALTI      NDLKRWLSKTNNNAQGEYYITDIIALAYQEGREI------------------------------------
GLMU_SALPK      NDLKRWLSKTNNNAQGEYYITDIIALAYQEGREI------------------------------------
GLMU_SALPB      NDLKRWLSKTNNNAQGEYYITDIIALAYQEGREI------------------------------------
GLMU_SALPA      NDLKRWLSKTNNNAQGEYYITDIIALAYQEGREI------------------------------------
GLMU_SALNS      NDLKRWLSKTNNNAQGEYYITDIIALAYQEGREI------------------------------------
GLMU_SALG2      NDLKRWLSKTNNNAQGEYYITDIIALAYQEGREI------------------------------------
GLMU_SALEP      NDLKRWLSKTNNNAQGEYYITDIIALAYQEGREI------------------------------------
GLMU_SALDC      NDLKRWLSKTNNNAQGEYYITDIIALAYQEGREI------------------------------------
GLMU_SALCH      NDLKRWLKMTNNNAQGEYYITDIIALAYQEGREI------------------------------------
GLMU_SALA4      NDLKRWLSKTNNNAQGEYYITDIIALAYQEGREI------------------------------------
GLMU_OCEIH      NQLFAALEVSNDNAQGEYYLPDVIKILRHQGDTVSAF---------------------------------
GLMU_LACSS      NKLFQALEVTNENAQGEYYLTDVVEILKKKGEIVAAYK--------------------------------
GLMU_FUSNN      QALVKALEKNNNNEKGEYYITDVI-EILSNDKKVISYSLE------------------------------
GLMU_CLOTE      FNIQALLEADNNNAQGEYYLTDVI-EILKKD---------------GKKVGALAVNFE------------
GLGC_CORJK      QTLIDALKEDSEDENSNHDMGDIIPRLVDRGEAYV-YDF-------------------------------
GLMU_YERPY      NDLKRWLSLDNNNAQGEFYITDIIALAHADGKKI------------------------------------
GLMU_YERPS      NDLKRWLSLDNNNAQGEFYITDIIALAHADGKKI------------------------------------
GLMU_YERPP      NDLKRWLSLDNNNAQGEFYITDIIALAHADGKKI------------------------------------
GLMU_YERPN      NDLKRWLSLDNNNAQGEFYITDIIALAHADGKKI------------------------------------
GLMU_YERPE      NDLKRWLSLDNNNAQGEFYITDIIALAHADGKKI------------------------------------
GLMU_YERPB      NDLKRWLSLDNNNAQGEFYITDIIALAHADGKKI------------------------------------
GLMU_YERPA      NDLKRWLSLDNNNAQGEFYITDIIALAHADGKKI------------------------------------
GLMU_YERP3      NDLKRWLSLDNNNAQGEFYITDIIALAHADGKKI------------------------------------
GLMU_YERE8      NDLKRWLSLNNNNAQGEFYITDIIALAHADGKKI------------------------------------
GLMU_SALTY      NDMKRWLSKTNNNAQGEYYITDIIALAYQEGREI------------------------------------
GLMU_SALSV      NDLKRWLSKTNNNAQGEYYITDIIALAYHEGREI------------------------------------
GLMU_SALHS      NDMKRWLSKTNNNAQGEYYITDIIALAYQEGREI------------------------------------
GLMU_PEDPA      NKLFAALHQVNDNAQGEYYLPDVIGIMKDAGEIVAAYE--------------------------------
GLMU_ALCBS      SRRFSLPKLSSNNAQGEYYLTDLIA---------------------------------------------
GLGC_EUBE2      WKV----------------LKDALIKLKDQQERIFAYEYNGYWKDVGTLSSYWEANMEL-----------
GLMU_STRSY      NKLFEALKDNTDNAQGEYYLTDVISIFRQAGEKVGAY---------------------------------
GLMU_STRS2      NKLFEALKDNTDNAQGEYYLTDVISIFRQAGEKVGAY---------------------------------
GLMU_STRPZ      NKLFEALKCTTNNAQGEYYLTDVVAIFRANKEKVGAYILRDFNESLGVNDRVALATAETVMRQR------
GLMU_NITEU      NRLGNWLDNLSDNTQGEYYLTDIIAMAVD-----------------------------------------
GLMU_HERAR      TKQLKLANLSNKNAQGEYYLTDIVASAVADGVQVVS----------------------------------
GLMU_ALTMD      GDLKRWLELSNDNAQGEYYLTDVIAMAASEGKRIQSAQPQSAVEVEGVNNRLQLANLERALQNRQ-----
GLGC2_VIBCH     ----------------------------------------------------------------------
GLMU_STRU0      NKLFEALKNNTNNAQGEYYLTDVISIFRENKEKVGAYVLRDFNESLGVNDRVALATAESVMRRR------
GLMU_STRR6      NRLFEALKNNTNNAQGEYYITDVIGIFRETGEKVGAYTLKDFDESLGVNDRVALATAE-SVMRRRINHK-
GLMU_STRP2      NRLFEALKNNTNNAQGEYYITDVIGIFRETGEKVGAYTLKDFDESLGVNDRVALATAE-SVMRRRINHK-
GLMU_SHEAM      GKRLKAWLGRLENAQGEFYLTDVIA---------------------------------------------
GLMU_SALAR      NDMKRWLSKTNNNAQGEYYITDIIALAYQEGREI------------------------------------
GLGC2_VIBPA     MDVLK--EALTEDAKLETSSNDIIPKLID-TESVYAYKF------CGSK---------------------
GLMU_STRSV      NRLFEALKNNTNNAQGEYYITDVIGIFRENGEKVGAYTLK------------------------------
GLMU_SHISS      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_SHIFL      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_SHIF8      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_SHIBS      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_SHIB3      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_PELCD      APVFEALSGVGDNAQREYYLTDVL----------------------------------------------
GLMU_LACPL      NKLFAALEVTNDNAQGEYYLTDVIQIMKNQGDVVAAYQ--------------------------------
GLMU_ESCF3      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_ECOUT      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_ECOSM      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_ECOSE      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_ECOLU      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_ECOLI      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_ECOLC      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_ECOL6      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_ECOK1      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_ECOHS      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_ECODH      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_ECOBW      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_ECO8A      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_ECO81      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_ECO7I      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_ECO5E      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_ECO57      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_ECO55      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_ECO45      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_ECO24      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_SHIDS      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_NEIMA      NKLEAWLNSSSNNAQGEYYLTDLIAKAVADGIKIHPVQVRSSHLAAGVNNKLQLAELERIFQTEQ-----
GLMU_EDWI9      NGVDLLARLDNNNAQGEFYITDIIAMAHQEGRQI------------------------------------
GLMU_ECOL5      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLMU_ACIBS      NKLHEWLPKLSENAQGEYYLTDIVAMAVADGLEIASIQ--------------------------------
GLMU_STRZT      NRLFEALKNNTNNAQGEYYITDVIGIFRETGEKVGAYTLKDFDESLGVNDRVALATAE-SVMRRRINHK-
GLMU_STRZJ      NRLFEALKNNTNNAQGEYYITDVIGIFRETGEKVGAYTLKDFDESLGVNDRVALATAE-SVMRRRINHK-
GLMU_STRPN      NRLFEALKNNTNNAQGEYYITDVIGIFRETGEKVGAYTLKDFDESLGVNDRVALATAE-SVMRRRINHK-
GLMU_STRPI      NRLFEALKNNTNNAQGEYYITDVIGIFRETGEKVGAYTLKDFDESLGVNDRVALATAE-SVMRRRINHK-
GLMU_STRPG      NKLFEALKCTTNNAQGEYYLTDVVAIFRANKEKVGAYILRDFNESLGVNDRVALATAETVMRQR------
GLMU_STRPF      NKLFEALKCTTNNAQGEYYLTDVVAIFRANKEKVGAYILRDFNESLGVNDRVALATAETVMRQR------
GLMU_STRPC      NKLFEALKCTTNNAQGEYYLTDVVAIFRANKEKVGAYILRDFNESLGVNDRVALATAETVMRQR------
GLMU_STRPB      NKLFEALKCTTNNAQGEYYLTDVVAIFRANKEKVGAYILRDFNESLGVNDRVALATAETVMRQR------
GLMU_STRP7      NRLFEALKNNTNNAQGEYYITDVIGIFRETGEKVGAYTLKDFDESLGVNDRVALATAE-SVMRRRINHK-
GLMU_STRP6      NKLFEALKCTTNNAQGEYYLTDVVAIFRANKEKVGAYILRDFNESLGVNDRVALATAETVMRQR------
GLMU_STRMU      NKLFEALEINTNNAQGEYYLTDVISIFKEADEKVGAYK--------------------------------
GLMU_LACBA      NKLFKALHETSDNAQGEYYLTDVIEILKQQGDIVAAYQ--------------------------------
GLMU_KLEP3      GDLKRWLKLTNNNAQGEYYITDIIAMAYQEGREIVA----------------------------------
GLMU_DIAST      AQRLALARLTNDNAQGEYYLTDIVS---------------------------------------------
GLGC_GEOLS      TR--KLIEVLLEGKKHYEDLKHVIPMMLEKGDRIYAYNF-------------------------------
GLGC_CLOPE      WKILKKFQSSSNDFGKNI-----IPKMLNSGKKLIAYPFNGYWKDVGTIESLWEANMDLLKYEDEL----
GLMU_STRP1      NKLFEALKCTTNNAQGEYYLTDVVAIFRANKEKVGAY---------------------------------
GLMU_ECO27      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
GLGC_THELT      WKFLKLIRDEQNNESTHDFGHDIIPLMINEGCQIYAFKFNGYWRDVGTVRSYWESNLEL-----------
GLMU_STRP4      NRLFEALKNNTNNAQGEYYITDVIGIFRETGEKVGAYTLKDFDESLGVNDRVALATAE-SVMRRRINHK-
GLMU_SHESH      GKQLKAWQLSSDNAQGEYYLTDIVA---------------------------------------------
GLMU_SHELP      GKQLKAWQLSSDNAQGEYYLTDIVA---------------------------------------------
GLMU_LACLA      NKLFKALEITTDNAQGEYYLTDVI----------------------------------------------
GLMU_HAEIN      GASFKLARVGNNNAQGEYYLTDLIA-LANQD---------------------------------------
GLMU_ERWCT      NDLKRWLQLNNNNAQGEFYITDIIAMASAEGQRV------------------------------------
GLMU_DESHD      AKLREALKNTPKNAQGEYYLTDVFAVFHAQGEVIRTY---------------------------------
GLMU_COLP3      NDLKRWLSNSSDNAQGEYYLTDIIA---------------------------------------------
GLMU_CELJU      -------RLGNNNAQGEYYLTDIIA---------------------------------------------
GLGC_CLOPS      WKILKKLDPSSSNDFGK----NIIPKMLNSGKKLIAYPFNGYWKDVGTIESLWEANMDLLKYEDEL----
GLMU_STRT1      NKLFEALKNNTNNAQGEYYLTDVISIFRENGEKVGAYTLR------------------------------
GLMU_STRP8      NKLFEALKCTTNNAQGEYYLTDVVAIFRANKEKVGAYILRDFNESLGVNDRVALATAETVMRQR------
GLMU_STRP3      NKLFEALKCTTNNAQGEYYLTDVVAIFRANKEKVGAYILRDFNESLGVNDRVALATAETVMRQR------
GLMU_DESHY      AKLREALKNTPKNAQGEYYLTDVFAVFHAQGEVIRTY---------------------------------
GLGC_RHOPS      TK--------------------------------------------------------------------
GLGC_HAES2      ----------------------------------------------------------------------
GLGC_HAES1      ----------------------------------------------------------------------
GLMU_THEM4      ----------------------------------------------------------------------
GLMU_STRT2      NKLFEALKNNTNNAQGEYYLTDVISIFRENGEKVGAY---------------------------------
GLMU_STRPM      NKLFEALKCTTNNAQGEYYLTDVVTIFRANKEKVGAYILRDFNESLGVNDRVALATAETVMRQR------
GLMU_KOSOT      ----------------------------------------------------------------------
GLMU_HAEI8      GASFKLARVGNNNAQGEYYLTDLIA-LANQD---------------------------------------
GLMU_ACIBY      NKLHEWLPKLSENAQGEYYLTDIVAMAVADGLEIASIQ--------------------------------
GLMU_ACIBC      NKLHEWLPKLSENAQGEYYLTDIVAMAVADGLEIASIQ--------------------------------
MPG1_NEUCR      SVIDRVLRPTS--------IEQETFPAMVRDGQLHSFDLEGFWMDIGQPKDFL-----------------
GLMU_STRGC      NRLFEALKNNTNNAQGEYYITDVIGIFRENGEKVGAYTLK------------------------------
GLMU_RALME      TAHLRQWLATNDNSQGEYYLTDTIERAVNDGVEVVS----------------------------------
GLMU_NITOC      ARYLKQIKLSNNNAQGEYYLTDIIEHAVASGEKVVA----------------------------------
GLMU_HAEIG      GASFKLARVGNNNAQGEYYLTDLIA-LANQD---------------------------------------
GLMU_FERNB      GKVLENLDKLSNNAQGEYYLTDLV----------------------------------------------
GLMU_CORJK      AAILRLAQLNTDNAQGELYLTDVLS---------------------------------------------
GLMU_ACTSZ      GASFKLARLDNDNAQGEYYMTDVIG-LANQD---------------------------------------
MPG1_CANAL      PSVIDLIEMRPTSIEKE------TFPILVEQKQLYSFDLEGYWMDVGQPKDFL-----------------
GLMU_HAES1      GASFRLARLDNNNAQGEYYMTDVIGLANQDGLKVVAVQAKDLMEVEGVNNRLQLANLERHFQRKQV----
GLMU_HAEIE      GASFKLARVGNNNAQGEYYLTDLIA-LANQD---------------------------------------
GLMU_DESPS      RDLYRALQKVNNNSQGELYLTDIIDLAVKSEQKVQRY---------------------------------
GLMU_AERHH      NQLRSWLSRDNKNAQGEFYLTDVIA---------------------------------------------
GLMU_ACHLI      XXXXXXXXXXXXXAKGEYYITDMV-ELMKKDYKIGSYMIKNNSLAMG-----------------------
GLGC_STRZT      WQRLRNMLVAAEKS--KVGMSDVIPNYLESGESVYAYEFSGYWKDVGTIESLWEANMEYISPENALDSRN
GLGC_STRZP      WQRLRNMLVAAEKS--KVGMSDVIPNYLESGESVYAYEFSGYWKDVGTIESLWEANMEYISPENALDSRN
GLGC_STRZJ      WQRLRNMLVAAEKS--KVGMSDVIPNYLESGESVYAYEFSGYWKDVGTIESLWEANMEYISPENALDSRN
GLGC_STRR6      WQRLRNMLVAAEKS--KVGMSDVIPNYLESGESVYAYEFSGYWKDVGTIESLWEANMEYISPENALDSRN
GLGC_STRPN      WQRLRNMLVAAEKS--KVGMSDVIPNYLESGESVYAYEFSGYWKDVGTIESLWEANMEYISPENALDSRN
GLGC_STRPJ      WQRLRNMLVAAEKS--KVGMSDVIPNYLESGESVYAYEFSGYWKDVGTIESLWEANMEYISPENALDSRN
GLGC_STRPI      WQRLRNMLVAAEKS--KVGMSDVIPNYLESGESVYAYEFSGYWKDVGTIESLWEANMEYISPENALDSRN
GLGC_STRP7      WQRLRNMLVAAEKS--KVGMSDVIPNYLESGESVYAYEFSGYWKDVGTIESLWEANMEYISPENALDSRN
GLGC_STRP2      WQRLRNMLVAAEKS--KVGMSDVIPNYLESGESVYAYEFSGYWKDVGTIESLWEANMEYISPENALDSRN
EI2BE_YEAST     ----------------------------------------------------------------------
MPG1_EMENI      PSVLKRIELRPTSI--EQETFPAIVR----DGQLHSFDLEGFWMDVGQPKDFL-----------------
GLMU_STRTD      NKLFEALKNNTNNAQGEYYLTDVISIFRENGEKVGAYTLR------------------------------
GLMU_PSEF5      GKRLGDWTGSNNNAQGEYYLTDVIA---------------------------------------------
GLMU_NEIM0      NXXXXXXXXXXXXAQGEYYLTDLIAKAVSDGIKVRPVRVRASHLAAGVNNKLQLAELERIFQ--------
GLMU_KLEP7      GDLKRWLKLTNNNAQGEYYITDIIAMAHQEGHQIVA----------------------------------
GLMU_ERWT9      GDLKRWLSKTNNNAQGEYYITDIIA---------------------------------------------
GLMU_ACISJ      AQRLALARLTNDNAQGEYYLTDIVS---------------------------------------------
GLGC_STRU0      WPRLRKMLVDSEN--GNIDMSDVIPAYLESGERVYTYNFNGYWKDVGTIESLWEANMEYIAENNPLDSRN
GLGC_STRP4      WQRLRNMLVAAEKSGMSXFGKNVIPNYLESGESVYAYEFSGYWKDVGTIESLWEANMEYISPENALDSRN
GLGC_SALTI      ----------------------------------------------------------------------
GLGC_RHOPT      TK--------------------------------------------------------------------
GLGC_RHOPB      ----------------------------------------------------------------------
GLGC_RHOPA      TK--------------------------------------------------------------------
GLGC_RHOP5      TK--------------------------------------------------------------------
GLGC_RHOP2      TK--------------------------------------------------------------------
GLMU_STRSZ      NKLFEALKHTTDNAQGEYYLTDVISIFKASQEKVGAYLLKDFDESLGVNDRLALAQAEVIMQER------
GLMU_LACLM      NKLFKALEITTDNAQGEYYLTDVI----------------------------------------------
GLMU_LACGA      NKLFKALKQVNDNAQGEYYLTDVLEIMRKAGHKVGAYE--------------------------------
GLMU_HAES2      GASFRLARLDNNNAQGEYYMTDVIGLANQDGFKVVAVQAKDLMEVEGVNNRLQLANLERHYQRKQV----
GLMU_CALS8      NPGFYCFEKDNKNSQNEYYLTDAIEILNRSGKKVV----KVTVEDNFEVMG-INSRYELFVAEQELKLRI
GLMU_ALISL      GDLKRWLAAKNENAQGEYYLTDIIAAAHDEGRAV------------------------------------
GLGC_STRPS      WQRLRNMLVAAEKS--KVGMSDVIPNYLELGESVYAYEFSGYWKDVGTIESLWEANMEYISPENALDSRN
GLGC_CLOD6      WKMLRNYFKEAE-KNPEINYDDLIPKMLEDNVGMYAYPFKGYWRDVGTIQSLWDANMDI-----------
GLMU_STRA3      NQLFEALKDNTNNAQGEYYLTDVIGIFKEAGKKVGAYKLRDFDESLGVNDRVALATAEKVMRHR------
GLMU_SHESW      GKQLKTWLSSNNNAQGEYYLTDIIA---------------------------------------------
GLMU_SHEPC      GKQLKTWLSSNNNAQGEYYLTDIIA---------------------------------------------
GLMU_SHEPA      GKQLKAWQLSSDNAQGEYYLTDIVA---------------------------------------------
GLMU_SHEHH      GKQLKAWQLSSDNAQGEYYLTDIVA---------------------------------------------
GLMU_NEIMF      NXXXXXXXXXXXXAQGEYYLTDLIAKAVADGIKV------------------------------------
GLMU_MARAV      SHLKQWLPALSSNAQGEYYLTDIIAMAVD-----------------------------------------
GLMU_LACLS      NKLFKALEITTDNAQGEYYLTDVI----------------------------------------------
GLMU_HYPNA      ADMFRLLKVTNSNAKGEYYLTDLV----------------------------------------------
GLGC_THEM4      WNFIRLMEDAKDENSTHDFGKDIIPKIIN-TKRVYAFPFEGYWKDVGTIYSYWESNLEL-----------
GLGC_PASMU      ----------------------------------------------------------------------
GLGC2_ALHEH     NQLIADARKESDHDFGK----DIIPSLIDQ-ARVIAFPFRGQAYDVGTIDAFWRTNLELVGVNPQLNLYD
GLMU_THISH      SDFTRWLSKTNDNAQGEFYLTDCVA---------------------------------------------
GLMU_THELT      RKLLEVLPMINKNKKGEYYLTDVFAFL-------------------------------------------
GLMU_STRA5      NQLFEALKDNTNNAQGEYYLTDVIGIFKEAGKKVGAYKLRDFDESLGVNDRVALATAEKVMRHR------
GLMU_STRA1      NQLFEALKDNTNNAQGEYYLTDVIGIFKEAGKKVGAYKLRDFDESLGVNDRVALATAEKVMRHR------
GLMU_LEGPC      NNLKKWLQLSNSNAQGEYYLTEIISLAVQNKTPITSLTAKNS----------------------------
GLMU_LEGPA      NNLKKWLQLSNSNAQGEYYLTEIISLAVQNKTPITSLTAKNS----------------------------
GLMU_GEOLS      LEFLRSHRLGSENAQNEYYLTDLV----------------------------------------------
GLMU_CLOD6      GKSLRALDLNNNNSQGEYYLTDTAKIMRDKGLKV------------------------------------
GLGC_STRGC      WQRLRNMLVVAEKSN--VDMSDVIPNYLESGESVYAYEFAGYWKDVGTVESLWEANME------------
GLGC_RHISN      ----------------------------------------------------------------------
GLGC_BIFLI      TKLFEALSLDEKAADTKHDMGGDIAPYFASRNEAGVYDF-------------------------------
GLMU_PSEA7      GKRLALGRLSNDNAQGEYYLTDVIA---------------------------------------------
GLMU_LACJO      NKLFKALKQVNDNAQGEYYLTDVLEIMRKAGHKVGAYE--------------------------------
GLGC_KLEP7      ----------------------------------------------------------------------
GLMU_SHEWM      GKQLKAWQLSSNNAQGEYYLTDIVA---------------------------------------------
GLGC_STRSV      WQRLRNMLVAAEKS--NVDMSDVIPNYLESGESVYAYDFAGYWKDVGTVESLWEANMEYISPENALNRRW
GLGC_GRABC      TK--------------------------------------------------------------------
GLGC_ESCF3      ----------------------------------------------------------------------
GLGC_BACHD      WSVLKSIQDAKQANSSHDFGKDIIPKMLAKDLKLVAYPFEGYWKDVGTIKSYWEANMDLLDEHSSL----
GMPPB_DICDI     ----------------------------------------------------------------------
GLMU_SHEFN      GKQLKAWRLSNNNAQGEYYLTDIIA---------------------------------------------
GLMU_NEIMB      NXXXXXXXXXXXXAQGEYYLTDLIAKAVADGIKVHPVQVRASHLAAG-----------------------
GLGC_KLEP3      ----------------------------------------------------------------------
GLGC_ECO7I      NDPSKSLAS----MGIYVFDADYLYELLEEDDR-----DKNSSHDFGKDLIPKITEAGLAYAH-------
GLMU_PSEPF      NRLADWMSRLSNNAQGEYYLTDVI----------------------------------------------
GLMU_PSEMY      GKRLALGRLSNSNAQGEYYLTDVIA---------------------------------------------
GLMU_PSEAE      GKRLALGRLSNDNAQGEYYLTDVIA---------------------------------------------
GLMU_PSEAB      GKRLALGRLSNDNAQGEYYLTDVIA---------------------------------------------
GLMU_PSEA8      GKRLALGRLSNDNAQGEYYLTDVIA---------------------------------------------
GLMU_NITMU      NRYLHLCKLENNNAQGEYYLTDIVAMAVKDGVKV------------------------------------
GLMU_CLOAB      SLLESLDKLNNNNVQGEYYLTDVIGILEEEGAKI------------------------------------
GLGC_THEAB      WSFIRLIEDAKNDQSSHDFGKDIIPKII-QTERVFAFPFDGYWKDVGTIYSYWESNLEL-----------
GLGC_STRS7      WQRLRTMLVDAEK--NNIDMSDVIPSYLESGERVYTYNFKGYWKDVGTIESLWEANME------------
GLMU_RALEH      TGHLRKWLSTNDNAQGEYYLTDTVER--------------------------------------------
GLMU_PROM5      WKSLSKIINTSNNKQNEIYLTDAI----------------------------------------------
GLMU_AZOSB      APVARLRSLRNDNAQGEYYLTDIIGMAVAEDIEVVTVQ--------------------------------
GLGC_SALAR      ----------------------------------------------------------------------
GLGC_NOVAD      TKLFDILREDAADPSSSRDFGNDIIPKIVRNGKAVAHRF-------------------------------
GLGC_CLOK5      LKRFLKADQSDKNSSNDFG-KNIIPNMLNSGIKMYAYPFRGYWKDVGTIQSLWEANMDLLKEDNEL----
GLMU_VIBVY      GDLKRWLAGNNDNAQGEYYLTDVIAAAHDEGNAV------------------------------------
GLMU_VIBVU      GDLKRWLAGNNDNAQGEYYLTDVIAAAHDEGNAV------------------------------------
GLMU_PSEFS      NKLADWMSRLSNNAQGEYYLTDVI----------------------------------------------
GLMU_BURPS      TAQLSMWLGANDNAQGEYYLTDVVEQAIEAGFEIVT----------------------------------
GLMU_BURP6      TAQLSMWLGANDNAQGEYYLTDVVEQAIEAGFEIVT----------------------------------
GLMU_BURP1      TAQLSMWLGANDNAQGEYYLTDVVEQAIEAGFEIVT----------------------------------
GLMU_BURP0      TAQLSMWLGANDNAQGEYYLTDVVEQAIEAGFEIVT----------------------------------
GLMU_BURMS      TAQLSMWLGANDNAQGEYYLTDVVEQAIEAGFEIVT----------------------------------
GLMU_BURMA      TAQLSMWLGANDNAQGEYYLTDVVEQAIEAGFEIVT----------------------------------
GLMU_BURM7      TAQLSMWLGANDNAQGEYYLTDVVEQAIEAGFEIVT----------------------------------
GLMU_BUCAP      ----------------------------------------------------------------------
GLGC_STRA5      WKRLRTVLIDGEKNG--IDMSDVIPAYLESGERVYTYNFDGYWKDVGTIESLWEANME------------
GLGC_STRA1      WKRLRTVLIDGEKNG--IDMSDVIPAYLESGERVYTYNFDGYWKDVGTIESLWEANME------------
GLGC_SHISS      ----------------------------------------------------------------------
GLGC_SHIFL      ----------------------------------------------------------------------
GLGC_SHIF8      ----------------------------------------------------------------------
GLGC_SHIDS      ----------------------------------------------------------------------
GLGC_SHIBS      ----------------------------------------------------------------------
GLGC_SHIB3      ----------------------------------------------------------------------
GLGC_RHORU      DFLYEILES-------------------------------------------------------------
GLGC_RHORT      DFLYEILES-------------------------------------------------------------
GLGC_RHIME      ----------------------------------------------------------------------
GLGC_OCEIH      WKTLKLIEDANKPNSSRDFGKDIIPSMLNNQHRLYAFKFNGYWKDVGTIQSYWEANMDV-----------
GLGC_ECOUT      ----------------------------------------------------------------------
GLGC_ECOSM      ----------------------------------------------------------------------
GLGC_ECOSE      ----------------------------------------------------------------------
GLGC_ECOLU      ----------------------------------------------------------------------
GLGC_ECOLI      ----------------------------------------------------------------------
GLGC_ECOLC      ----------------------------------------------------------------------
GLGC_ECOL6      ----------------------------------------------------------------------
GLGC_ECOL5      ----------------------------------------------------------------------
GLGC_ECOHS      ----------------------------------------------------------------------
GLGC_ECODH      ----------------------------------------------------------------------
GLGC_ECOBW      ----------------------------------------------------------------------
GLGC_ECO8A      ----------------------------------------------------------------------
GLGC_ECO81      ----------------------------------------------------------------------
GLGC_ECO5E      ----------------------------------------------------------------------
GLGC_ECO57      ----------------------------------------------------------------------
GLGC_ECO55      ----------------------------------------------------------------------
GLGC_ECO45      ----------------------------------------------------------------------
GLGC_ECO24      ----------------------------------------------------------------------
GLMU_VIBFM      GDLKRWLAAKNENAQGEYYLTDIIAAAHDEGRAV------------------------------------
GLMU_VIBF1      GDLKRWLAAKNENAQGEYYLTDIIAAAHDEGRAV------------------------------------
GLGC_STRA3      WKRLRTVLIDGEKNG--IDMSDVIPAYLESGERVYTYNFDGYWKDVGTIESLWEANME------------
GLGC_RHIE6      TK--------------------------------------------------------------------
GLGC_MANSM      DYLYEALDNTSHDFGKDVMLNDGVLYAHPFDRSCKGRNTEGAIYDVGTLDSFWQANIDLVSEEPQL----
GLGC_LACS1      WKRLRLVNSFTRNQDMVDFGKNVIPYYLKSGESVFAYNFKGYWKDVGTIDSLWHANMEFLDENNEL----
GLGC_GEOMG      TR--RLIEVLQEGKKLHADLKHVIPMMLAKKDRVFAYNF-------------------------------
GLGC_BACLD      WSVLEALERDEKNSASSHDFKDVIPALLEENKRLNAYPFKGYWKDVGTVRSLWEANMDLLGDHPPL----
EI2BG_RAT       ----------------------------------------------------------------------
EI2BG_BOVIN     ----------------------------------------------------------------------
EI2BE_CANAL     ----------------------------------------------------------------------
GLMU_VIBHB      GDLKRWLAGNNENAQGEYYLTDVIAAAHDEGRAV------------------------------------
GLMU_SHEPW      GKQLKAWQLSSDNAQGEYYLTDIVA---------------------------------------------
GLMU_NEIGO      NXXXXXXXXXXXXAQGEYYLTDLIAKAVADGIKVRPVRVRASHLAAGVNNKRQLAELERIFQTEQ-----
GLMU_NEIG1      NXXXXXXXXXXXXAQGEYYLTDLIAKAVADGIKVRPVRVRASHLAAGVNNKRQLAELERIFQTEQ-----
GLMU_LEGPH      NNLKKWLQLSNSNAQGEYYLTEIISLAVQNKTPITSLTAKNS----------------------------
GLMU_HYDS0      ----------------------------------------------------------------------
GLGC_ACTSZ      EYLYETLERTVNSPQTSHDFGKDIMPMALEDEVLYAHPF-------------------------------
EI2BG_HUMAN     ----------------------------------------------------------------------
GLMU_SHESA      GKALKTWRLSNNNAQGEYYLTDIIA---------------------------------------------
GLMU_CITK8      NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREI------------------------------------
GLMU_CHRVO      NRLADWLSALNNGAQGEYYLTDVL----------------------------------------------
GLMU_CARHZ      TKILKEILPKAENAQKEYYLTDVIPLLLERGKVV------------------------------------
GLMU_SACD2      ----------------------------------------------------------------------
GLMU_PSESM      ASHLQLGRLSNNNAQGEYYLTDVIA---------------------------------------------
GLMU_PASMU      GKSLKLSQLTNNNAQGEYYITDVIA-LANQD---------------------------------------
GLMU_LEGPL      NNLKKWLQLSNSNAQGEYYLTEIISFAVQNKTPIRSLTTKNS----------------------------
GLMU_CLOB8      LLVDALNKITNNNGQGEYYLTDAIGILKSQGKKI------------------------------------
GLMU_BURP8      TKRLDGWLSSNENAQGEFYLTDVVELAIEAGIEVVT----------------------------------
GLGS_BRANA      ----------------------------------------------------------------------
GLMU_RALEJ      TGHLRRWLATNDNAQGEYYLTDTVERAATEGIDIVS----------------------------------
GLMU_MANSM      GASFKLGRLNNNNAQGEYYMTDVIG-LANQD---------------------------------------
GLMU_CLOPS      SLLTSLEQLSNDNAQGEYYLTDVIEILKKDNKKV------------------------------------
GLMU_BURCH      TQLSMWLGAKNENAQGEYYLTDVVELAIEAGFEVVT----------------------------------
GLMU_BURCA      TQLSMWLGAKNENAQGEYYLTDVVELAIEAGFEVVT----------------------------------
GLMU_BURA4      GQLAMWLGAKNENAQGEYYLTDVV----------------------------------------------
GLGS_SOLTU      ----------------------------------------------------------------------
GLGS_BETVU      ----------------------------------------------------------------------
GLGC_ENTS8      ----------------------------------------------------------------------
GLGC_ACIAC      ADIL--LDALREAETGHSDFGKHILPAMLKSHRLMAYDF-------------------------------
MPG1_TRIRE      PSVLKRIELRPTSIEKE------TFPAMVADNQLHSFDLEGFWMDVGQPKDFL-----------------
GLMU_PSEA6      GKDLKLANLNSNNAQGEFYLTDVIEMAANEGKVI------------------------------------
GLMU_PSE14      AKRLALGRLSNNNAQGEYYLTDVIA---------------------------------------------
GLMU_NOCFA      ATVLRAMRLSTANAQHELYLTDVL----------------------------------------------
GLMU_EXIS2      NELFEALKQVNDNVQGEYYLPDVIEIAKADGETIAAY---------------------------------
GLMU_CLOPE      SLLTSLEQLSNDNAQGEYYLTDVIEILKKENKKV------------------------------------
GLMU_CLOK5      SLIESLGKIRNNNAQGEYYLTDVIEILKQEGKKI------------------------------------
GLMU_CLOK1      SLIESLGKIRNNNAQGEYYLTDVIEILKQEGKKI------------------------------------
GLMU_BAUCH      ----------------------------------------------------------------------
GLMU_ACIAD      NKLHEWLPKLSNNAQGEYYLTDIVAMAVADGLEIASIQ--------------------------------
GLGS_SOLLC      ----------------------------------------------------------------------
GLGC_STRMU      WDRLRTMLVDAEK--NNIDMSDVIPAYLESGERVYTYNFNGYWKDVGTIESLWEANMEYIGEDNDL----
GLGC_BACCL      WPLLRQIDNADPHSSHDFG-KDVIPRLLRENKRLVAYPFKGYWKDVGT----------------------
GLGC_AZOSE      ADLLVDALRRAHSRGGH-DFGKNLLPAMAERNRVMAYDFTTNR---------------------------
GLGC_AZOSB      TDVLVDALTRAHSKGGH-DFGKNLLPAMCESHRLMAYDFSSNR---------------------------
EI2BG_MACFA     ----------------------------------------------------------------------
GLMU_VIBCM      RDLKRWLAGNNNNAQGEYYLTDVIAAAHDEGRAV------------------------------------
GLMU_VIBC3      RDLKRWLAGNNNNAQGEYYLTDVIAAAHDEGRAV------------------------------------
GLMU_VESOH      SQLLKLNEIDSRNTQGELYLTDIIA---------------------------------------------
GLMU_CLOP1      SLLTSLEQLSNDNAQGEYYLTDVIEILKKENKKV------------------------------------
GLMU_CLONN      IKXXXXXXXXXXXSQGEYYLTDIIELLKEKGCKV------------------------------------
GLMU_BURPP      ERLGRWLAAKNDNAQGEFYLTDAVEMAIEAGLEVVT----------------------------------
GLMU_BDEBA      ASVLSLPQISNNNAKKEYYITDLIA---------------------------------------------
GLGC_THESQ      YEFLKLIEDENDPNSSHDFGKDVIPRILRENGSLYAFRFDGYWRDVGTLRSYWEANLELVL---------
GLGC_THEMA      YEFLKLIEDENDPNSSHDFGKDVIPRILRENGSLYAFRFDGYWRDVGTLRSYWEANLELVL---------
GLGC_HAEI8      ----------------------------------------------------------------------
GLGC_FERNB      WNFIKLIEDSKDNSSDHDFGKNIIPKILSTG-KVYAYPFEGYWQDVGTIQSYWETNLEL-----------
GLGC_CLONN      WKILKELEDSDHDFGKNI-----IPSLLDSGYNLYAYSFNGYWKDVGTIESLWQANMDL-----------
GLMU_THEAB      ----------------------------------------------------------------------
GLMU_SODGM      GDIKRWLQLTNKNAQGEFY