[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30777.1

[Show Plain Result]


## Summary of Sequence Search
    1::268
    1::171     7e-31  46%  357 aa  YNT1_YEAST RecName: Full=Uncharacterized protein YNL191W;
   27::255     1e-24  34%  304 aa  Y199_SYNY3 RecName: Full=Putative glutamine amidotransferase
   32::206     9e-10  36%  471 aa  PUR1_METJA RecName: Full=Probable amidophosphoribosyltransferase;  
   43::215     2e-09  29%  294 aa  Y1037_HAEIN RecName: Full=Putative glutamine amidotransferase
   15::136     2e-07  33%  355 aa  Y1515_METJA RecName: Full=Uncharacterized protein MJ1515;
   27::134     6e-07  33%  255 aa  YAFJ_ECOLI RecName: Full=Putative glutamine amidotransferase yafJ; 
   51::173     1e-05  33%  597 aa  GLMS_HELPJ RecName: Full=Glucosamine--fructose-6-phosphate
   70::173     2e-05  33%  597 aa  GLMS_HELPY RecName: Full=Glucosamine--fructose-6-phosphate
   70::188     2e-04  30%  608 aa  GLMS_GLUOX RecName: Full=Glucosamine--fructose-6-phosphate
  113::188     3e-04  27%  301 aa  GLXB_RHIME RecName: Full=Glutamine amidotransferase-like protein
   72::130     4e-04  36%  612 aa  GLMS_WIGBR RecName: Full=Glucosamine--fructose-6-phosphate
   69::152     6e-04  30%  607 aa  GLMS_ZYMMO RecName: Full=Glucosamine--fructose-6-phosphate
   61::151     6e-04  31%  610 aa  GLMS_PASMU RecName: Full=Glucosamine--fructose-6-phosphate
   70::113     6e-04  34%  609 aa  GLMS_ECOLI RecName: Full=Glucosamine--fructose-6-phosphate
   70::113     6e-04  34%  609 aa  GLMS_ECO57 RecName: Full=Glucosamine--fructose-6-phosphate
   57::115     6e-04  31%  610 aa  GLMS_BUCBP RecName: Full=Glucosamine--fructose-6-phosphate
   69::152     8e-04  35%  608 aa  NODM_BRAJA RecName: Full=Glucosamine--fructose-6-phosphate
   70::154     8e-04  31%  610 aa  GLMS_HAEIN RecName: Full=Glucosamine--fructose-6-phosphate
   62::130     8e-04  33%  600 aa  GLMS_BACHD RecName: Full=Glucosamine--fructose-6-phosphate
    1::268

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MCRWLMYHGDKIKMSDLLVDPENSLIHQSIHSSQGAVPVNGDGFGVGWYTSLHKEPGVYKDPLPAWNNQN
YNT1_YEAST      MCRFLIFKGKQIRLSHLLTRPAHSIINQXXXXXXXXXPMNGDGFGVAYYTELSEDPCLFKAITPAWNNQN
Y199_SYNY3      MCRLLGYLGQPLRPEQLIYRPEHSLIVQSYQPQETAGLLNADGFGLGWFDQESPNPYLYKNVLPIWSDIN
PUR1_METJA      ---------------------------------EGAGIATSDGKNIHYYKNIGLVTDVFK-------NET
Y1037_HAEIN     ----------------------------------GLTDCHSDGFGIAFFEG--RGVRIFRDNQAASLSPI
Y1515_METJA     -------------------------VELSLNSFKHRSEDHPNGWGIAFYPDGFVR--VIKEPIKM--NEA
YAFJ_ECOLI      ----------------------------------GGTGPHKDGWGITFYEG--KGCRTFKDPQPSFNSPI
GLMS_HELPJ      ----------------------------------------------------------------------
GLMS_HELPY      ----------------------------------------------------------------------
GLMS_GLUOX      ----------------------------------------------------------------------
GLXB_RHIME      --------------------------------------------GAGDSVEIYKEVGLPKDVVARFD---
GLMS_WIGBR      ----------------------------------------------------------------------
GLMS_ZYMMO      ----------------------------------------------------------------------
GLMS_PASMU      ----------------------------------------------------------------------
GLMS_ECOLI      ----------------------------------------------------------------------
GLMS_ECO57      ----------------------------------------------------------------------
GLMS_BUCBP      ---------------------------------------------------------------------N
NODM_BRAJA      ----------------------------------------------------------------------
GLMS_HAEIN      ----------------------------------------------------------------------
GLMS_BACHD      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LISLAKHIKSRNFMAHVRASTIAPTSRVNCHPFTFKNHLFMHNGSIAGFDDIRQEIEQLVKPQYFKARFG
YNT1_YEAST      LSTLAEKTKSDLVFAHVRASTYGVLSETNCHPFTYHSLCFMHNGGISNFKGIKRKLLNHIKDEYLNFIQG
Y199_SYNY3      LPHLSRYIQSSCFVSYVRSATPLAVDLTNCQPFTEEGLLFVHNGFINNFTTLYRPLRNLLSDASYQFIHG
PUR1_METJA      LQNLFGYIG----IGHVRYSTTGGKAVENCQPFSFGNIAIAHNGDLVNSDELRRELE--MKGHIFTS---
Y1037_HAEIN     ADCIKQYIKSLNVIAHIRKATQGEVNIENTHPFIGQNWVFAHNGNLKNLPDM---------TDHFLQPIG
Y1515_METJA     LLAECVRIKSNIFIAHIRKASAGSESYVNTHPFVDKEIAFAHNGTLLGYEDLELD-------GYYP--IG
YAFJ_ECOLI      AKLVQDYIKSCSVVAHIRQANRGEVALENTHPFTGRNWTYAHNGQLTGYKSLETGNFRPV---------G
GLMS_HELPJ      LENLRTELKNKEFLAHTRWATHGKPSSANAHPHFTENLALVHNGIIENYASLKKELEN--KGHAF---LS
GLMS_HELPY      -------------IAHTRWATHGKPSSANAHPHFTENLALVHNGIIENYASLKKELEN--KGHAF---LS
GLMS_GLUOX      -------------IGHTRWATHGAPTENNAHPHEAGRVAIVHNGIIENFAELKKELE--AKGRVFRT---
GLXB_RHIME      ----VRSMGGSHGIGHTRMATESAVTTLGAHPFTGSDQCLVHNGSLSNHNNLRREL--------------
GLMS_WIGBR      -------------VAHTRWATHGPPTENNAHPHISGNIAVVHNGIIENHEHLRSKLKS------YKYKFN
GLMS_ZYMMO      -------------IAHTRWATHGAPTVANAHPHIAGDVAVVHNGIIENFKTLRDEL--LERGHHFES---
GLMS_PASMU      ----AEKITGGTGIAHTRWATHGAPSEDNAHPHVSGQFAVVHNGIIENYEQLRIDLQQ--KGYQF---LS
GLMS_ECOLI      -------------IAHTRWATHGEPSEVNAHPHVSEHIVVVHNGIIENHEPLREELK-------------
GLMS_ECO57      -------------IAHTRWATHGEPSEVNAHPHVSEHIVVVHNGIIENHEPLREELK-------------
GLMS_BUCBP      LIHKTKQLIGNIGIAHTRWATHGLALKKNAHPHVSKNIAIVHNGIIENYLNIKTKLQK------------
NODM_BRAJA      -------------IGHTRWATHGKPTESNAHPHATENVAVVHNGIIENFRELRAELER------NGAGFN
GLMS_HAEIN      -------------IAHTRWATHGEPSETNAHPHSSGTFAVVHNGIIENHEELR----ELLKSRGY-VFLS
GLMS_BACHD      -------VKSTVGIGHTRWATHGEPSKVNAHPHQSESSRFVHNGVIENYEQLKRDYLQAVTLQ------S


                         +         .         .         .         .         *         .:210
query           STDSEAIFLLAVSNGLENDPKLAIVKSIEQITKIQAKNGLKESIKASIAYSNGEISYSLKISTIGNEPSL
YNT1_YEAST      STDSECAFALFLDDKLGYDPK-------------------------------------------------
Y199_SYNY3      TTDSEHIFALILDNGDSDWAKTSLGKALEALTLVELARQHDTFFSANILLADGQRIVACRYASRQPEPSL
PUR1_METJA      STDSEVIAQLLVRELLKTSDKIEAI-----------KNTLKKLVGALIMFNDSLIAWGFKPLCIGRDESN
Y1037_HAEIN     STDSEAAFCYMLKNTFRKKPEMEIFEAIQKVTKGLAQHGTFNFILSNIAHCSTNLHYVMRKAPFG-----
Y1515_METJA     ETDSEYVFCYLLS---------------------------------------------------------
YAFJ_ECOLI      ETDSEKAF--------------------------------------------------------------
GLMS_HELPJ      QTDTEVIHLLEETLKSEGDLLKAFEKSISLLKGSYAILMLHKRAKESLFYA-------------------
GLMS_HELPY      QTDTEVIHLLEETLKSESDLLKAFEKSISLLKGSYAILMLHKRAKESLFYA-------------------
GLMS_GLUOX      ETDSETVAHLVLGQGLEREAAFAAIKRLEGAYAIALLIGARHGAPLAVGYGNGEM---------------
GLXB_RHIME      ----------------------------------------------------------------------
GLMS_WIGBR      STDTEVI---------------------------------------------------------------
GLMS_ZYMMO      ETDTEVVHLLDEQMQAGKDPRHAVSKVLKKL---------------------------------------
GLMS_PASMU      QTDTEVIAHL-VHWVMRNETSL--LRAVQQVVK-------------------------------------
GLMS_ECOLI      ----------------------------------------------------------------------
GLMS_ECO57      ----------------------------------------------------------------------
GLMS_BUCBP      ----------------------------------------------------------------------
NODM_BRAJA      STDTEVVAHL-VDSYLKNSPQDAVQASLPRL---------------------------------------
GLMS_HAEIN      QTDTEVIAHLVEWEMRTTDSLLAVKKAVKQLT--------------------------------------
GLMS_BACHD      DTDTEVVVQL------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YYISYKDIIETLDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YNT1_YEAST      ----------------------------------------------------------
Y199_SYNY3      YWLA------------------------------------------------------
PUR1_METJA      IYISSEDALTTLD---------------------------------------------
Y1037_HAEIN     ----------------------------------------------------------
Y1515_METJA     ----------------------------------------------------------
YAFJ_ECOLI      ----------------------------------------------------------
GLMS_HELPJ      ----------------------------------------------------------
GLMS_HELPY      ----------------------------------------------------------
GLMS_GLUOX      ----------------------------------------------------------
GLXB_RHIME      ----------------------------------------------------------
GLMS_WIGBR      ----------------------------------------------------------
GLMS_ZYMMO      ----------------------------------------------------------
GLMS_PASMU      ----------------------------------------------------------
GLMS_ECOLI      ----------------------------------------------------------
GLMS_ECO57      ----------------------------------------------------------
GLMS_BUCBP      ----------------------------------------------------------
NODM_BRAJA      ----------------------------------------------------------
GLMS_HAEIN      ----------------------------------------------------------
GLMS_BACHD      ----------------------------------------------------------