[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30798.1

[Show Plain Result]


## Summary of Sequence Search
    1::268
   83::344     2e-21  33%  384 aa  XYLR1_BACSU RecName: Full=Xylose repressor;
   83::344     9e-21  30%  384 aa  XYLR2_BACSU RecName: Full=Xylose repressor;
    7::260     1e-20  30%  295 aa  Y188_CLOPE RecName: Full=Uncharacterized protein CPE0188;
    5::262     2e-19  37%  317 aa  GLK_STRLI RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:
    5::262     2e-19  37%  317 aa  GLK_STRCO RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:
  404::673     2e-19  33%  722 aa  GLCNE_CRIGR RecName: Full=Bifunctional UDP-N-acetylglucosamine
  404::673     5e-19  33%  722 aa  GLCNE_HUMAN RecName: Full=Bifunctional UDP-N-acetylglucosamine
  404::673     2e-18  32%  722 aa  GLCNE_RAT RecName: Full=Bifunctional UDP-N-acetylglucosamine
  404::673     2e-18  32%  722 aa  GLCNE_MOUSE RecName: Full=Bifunctional UDP-N-acetylglucosamine
    1::288     2e-16  35%  330 aa  GLK_BACHD RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:
    8::284     3e-15  32%  321 aa  GLK_BACSU RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:
   79::369     2e-14  25%  399 aa  XYLR_ANATD RecName: Full=Xylose repressor;
    4::264     9e-13  34%  303 aa  NAGK_VIBF1 RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::287     2e-12  33%  304 aa  NAGK_MANSM RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     6e-12  35%  302 aa  NAGK_ALISL RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::287     3e-11  31%  304 aa  NAGK_HAEI8 RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::264     4e-11  32%  302 aa  NAGK_VIBPA RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::264     4e-11  33%  303 aa  NAGK_VIBFM RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::282     6e-11  29%  303 aa  NAGK_PHOPR RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::287     6e-11  31%  305 aa  NAGK_HAES1 RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::264     1e-10  31%  304 aa  NAGK_YERPY RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::264     1e-10  30%  304 aa  NAGK_YERP3 RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::264     1e-10  32%  303 aa  NAGK_YERE8 RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::264     1e-10  31%  304 aa  NAGK_YERPS RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::264     1e-10  31%  304 aa  NAGK_YERPB RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::287     1e-10  31%  304 aa  NAGK_HAEIN RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     3e-10  34%  303 aa  NAGK_SHIBS RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     3e-10  33%  303 aa  NAGK_ERWT9 RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     3e-10  34%  303 aa  NAGK_ECO7I RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::264     4e-10  31%  302 aa  NAGK_VIBCH RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     4e-10  34%  303 aa  NAGK_SHIDS RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     4e-10  34%  303 aa  NAGK_ECOUT RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     4e-10  34%  303 aa  NAGK_ECOSM RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     4e-10  34%  303 aa  NAGK_ECOSE RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     4e-10  34%  303 aa  NAGK_ECOLU RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     4e-10  34%  303 aa  NAGK_ECOLI RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     4e-10  34%  303 aa  NAGK_ECOLC RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     4e-10  34%  303 aa  NAGK_ECOL5 RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     4e-10  34%  303 aa  NAGK_ECOK1 RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     4e-10  34%  303 aa  NAGK_ECOHS RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     4e-10  34%  303 aa  NAGK_ECODH RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     4e-10  34%  303 aa  NAGK_ECOBW RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     4e-10  34%  303 aa  NAGK_ECO8A RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     4e-10  34%  303 aa  NAGK_ECO81 RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     4e-10  34%  303 aa  NAGK_ECO55 RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     4e-10  34%  303 aa  NAGK_ECO45 RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     4e-10  34%  303 aa  NAGK_ECO27 RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     4e-10  34%  303 aa  NAGK_ECO24 RecName: Full=N-acetyl-D-glucosamine kinase;       
  152::364     5e-10  32%  399 aa  XYLR_CALSR RecName: Full=Putative xylose repressor;
    4::255     5e-10  34%  303 aa  NAGK_SALHS RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     5e-10  34%  303 aa  NAGK_ECOL6 RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     7e-10  34%  303 aa  NAGK_SALPK RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     7e-10  33%  303 aa  NAGK_SALPC RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     7e-10  34%  303 aa  NAGK_SALPA RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     7e-10  33%  303 aa  NAGK_SALCH RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     7e-10  33%  303 aa  NAGK_SALAR RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     9e-10  33%  303 aa  NAGK_SALPB RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     9e-10  34%  303 aa  NAGK_ESCF3 RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     9e-10  34%  303 aa  NAGK_ECO5E RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     9e-10  34%  303 aa  NAGK_ECO57 RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     9e-10  33%  303 aa  NAGK_CITK8 RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     1e-09  33%  303 aa  NAGK_SALSV RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     1e-09  33%  303 aa  NAGK_SALG2 RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     1e-09  33%  303 aa  NAGK_SALEP RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     1e-09  33%  303 aa  NAGK_SALA4 RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     3e-09  33%  303 aa  NAGK_SHIFL RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     3e-09  33%  303 aa  NAGK_SHIF8 RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     4e-09  33%  303 aa  NAGK_SHISS RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     5e-09  32%  303 aa  NAGK_SALTY RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     5e-09  32%  303 aa  NAGK_SALNS RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::255     5e-09  32%  303 aa  NAGK_SALDC RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::264     5e-09  30%  304 aa  NAGK_PASMU RecName: Full=N-acetyl-D-glucosamine kinase;       
    3::273     5e-09  24%  302 aa  MAK_ECOLI RecName: Full=Fructokinase;         EC=2.7.1.4;AltName:
    4::264     6e-09  31%  302 aa  NAGK_VIBSL RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::254     6e-09  33%  302 aa  NAGK_SALTI RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::113     2e-08  32%  256 aa  NAGK_YERPN RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::113     2e-08  32%  256 aa  NAGK_YERPE RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::113     2e-08  32%  256 aa  NAGK_YERPA RecName: Full=N-acetyl-D-glucosamine kinase;       
  153::329     7e-08  27%  388 aa  XYLR_LACPE RecName: Full=Xylose repressor;
    4::113     1e-07  32%  303 aa  NAGK_VIBVY RecName: Full=N-acetyl-D-glucosamine kinase;       
    4::113     1e-07  32%  303 aa  NAGK_VIBVU RecName: Full=N-acetyl-D-glucosamine kinase;       
  124::360     1e-06  22%  406 aa  MLC_ECOLI RecName: Full=Protein mlc;AltName: Full=Making large
    2::166     2e-06  34%  328 aa  GLK_STAXY RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:
    4::238     2e-04  28%  299 aa  SCRK_BACSU RecName: Full=Putative fructokinase;       
    4::263     2e-04  27%  304 aa  NAGK_ERWCT RecName: Full=N-acetyl-D-glucosamine kinase;       
    1::268

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxIKNRTVVGVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTSEVEGI
XYLR1_BACSU     ------------VGIDVGVDYINGTDLEGTIVLDQYRHLESNSPEITKDILIDMIHHFITQMPQSPLIGI
XYLR2_BACSU     ------------IGIDVGVDYISGTDLEGTIILDQHHHLESNSPEITKDILIDMIHHFITRMPQSPLIGI
Y188_CLOPE      --------------IDIGGTSIKYGVINEDGTLLETNDR-DTEAYKGGLSIIEKVKDIIHELINNDISGI
GLK_STRLI       ------------IGVDIGGTKIAAGVVDEENILSTHKVPTPTTPE----AIVDAIASAVEGARVGEIVAV
GLK_STRCO       ------------IGVDIGGTKIAAGVVDEENILSTHKVPTPTTPE----AIVDAIASAVEGARVGEIVAV
GLCNE_CRIGR     ------LETLSALAVDLGGTNLRVAIVSMKGIVKKYTQFNPKTYEERISLILQMCVEAAAEAVKLNCRIL
GLCNE_HUMAN     ------LETLSALAVDLGGTNLRVAIVSMKGIVKKYTQFNPKTYEERINLILQMCVEAAAEAVKLNCRIL
GLCNE_RAT       ------LETLSALAVDLGGTNLRVAIVSMKGIVKKYTQFNPKTYEERISLILQMCVEAAAEAVKLNCRIL
GLCNE_MOUSE     ------LETLSALAVDLGGTNLRVAIVSMKGIVKKYTQFNPKTYEERISLILQMCVEAAAEAVKLNCRIL
GLK_BACHD       ------MSDRWYVGVDVGGTTIKMATTAGE-IVDKW--EIPTNKQDGGALITTNIADALDKRLSSDLIGI
GLK_BACSU       -------------GIDLGGTTIKLAFI-------NQYGEIQHKWEVPTDKTGDTITVTIAKTIDSKLDEI
XYLR_ANATD      ----------SIIGIDLGVDYIHISNFVGEVIFEEYANKIGEDKEKLLRLLFDLIEKSVKKATPKXXXXX
NAGK_VIBF1      -------------GFDVGGTKIEFGAF-NEKLERVATERIPTQTE-NYSLLVDDIASLIAK-YDAEVEGV
NAGK_MANSM      -------------GFDIGGTKIELA-VFNDKLERQYTERVETPKDSYEQW-LDVIVNLVEKADQKFAGSV
NAGK_ALISL      -------------GFDVGGTKIEFGAF-NEKLERVATERIPTQTEDYSLLVNDIA-SLIAK-YDAEVEGV
NAGK_HAEI8      -------------GLDIGGTKIELA-VFNEELEKLYSERVPTDYEEWLNTIVDLVNRADEKF--GEVGTV
NAGK_VIBPA      -------------GFDVGGTKIEFGAF--NEKLERVATERVPTPTDNYELLVDTIAELVNK-YDAEFEGI
NAGK_VIBFM      -------------GFDVGGTKIEFGAF-NEKLERVATERIPTQTE-NYSLLVDDIASLIAK-YDAEVEGV
NAGK_PHOPR      -------------GFDVGGTKIEFGAF--NEKLERVATERVATPRDDYDKLVDTIVGIIQKADNDGCEGV
NAGK_HAES1      -------------GFDIGGTKIELA-VFNEKLEKRYSERVDTP-KHSYDEWLNVITHLVQKADEKACKGV
NAGK_YERPY      -------------GFDMGGTKIELG-VFDENLQRIWHKRVPTPCEDYPQ-LLQILLTEEADTYCGVQGSV
NAGK_YERP3      -------------GFDMGGTKIELG-VFDENLQRIWHKRVPTPREDYPQ-LLQILLTEEADTYCGVQGSV
NAGK_YERE8      -------------GFDMGGTKIELG-VFDANLQRIWHKRVPTPREDYSQTLHDLTRE--ADEFCGSKGSV
NAGK_YERPS      -------------GFDMGGTKIELG-VFDENLQRIWHKRVPTPREDYPQ-LLQILLTEEADTYCGVQGSV
NAGK_YERPB      -------------GFDMGGTKIELG-VFDENLQRIWHKRVPTPREDYPQ-LLQILLTEEADTYCGVQGSV
NAGK_HAEIN      -------------GLDIGGTKIELA-VFNEKLEKLYSERVPTDYEEWLNTIVDLVNRADEKF--GEVGTV
NAGK_SHIBS      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCR-GSV
NAGK_ERWT9      -------------GFDIGGSKIALGVYAHRQLIWQRRVATPKDDYAQLLAAIDTLTQQ-ADGFCGVRGSV
NAGK_ECO7I      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_VIBCH      -------------GFDVGGTKIEFGAF-NEQLERVATERVATPTDDYAK-LVETIAGLVHKYDAQGVEGV
NAGK_SHIDS      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_ECOUT      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_ECOSM      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_ECOSE      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_ECOLU      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_ECOLI      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_ECOLC      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_ECOL5      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_ECOK1      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_ECOHS      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_ECODH      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_ECOBW      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_ECO8A      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_ECO81      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_ECO55      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_ECO45      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_ECO27      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_ECO24      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
XYLR_CALSR      ----------------------------------------------------------------------
NAGK_SALHS      -------------GFDIGGTKIALGVFDSTRRLQ-WEKRVPPHASYSA--FLDAVCELVAEADQRGVKGV
NAGK_ECOL6      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_SALPK      -------------GFDIGGTKIALGVFDSTRRLQ-WEKRVPPHASYGA--FLDAVCELVAEADQRGVKGV
NAGK_SALPC      -------------GFDIGGTKIALGAFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVAEADQRGVKGV
NAGK_SALPA      -------------GFDIGGTKIALGVFDSTRRLQ-WEKRVPPHASYGA--FLDAVCELVAEADQRGVKGV
NAGK_SALCH      -------------GFDIGGTKIALGAFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVAEADQRGVKGV
NAGK_SALAR      -------------GFDIGGTKIALGVFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVAEALRFGVKGV
NAGK_SALPB      -------------GFDIGGTKIALGVFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVAEADQRGVKGV
NAGK_ESCF3      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_ECO5E      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_ECO57      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_CITK8      -------------GFDIGGTKIALGVFDNERRLR--WEKRVPTPREGYEAFLTAVCDLVAEADQRDVKGV
NAGK_SALSV      -------------GFDIGGTKIALGVFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVAEADQRGVKGV
NAGK_SALG2      -------------GFDIGGTKIALGVFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVAEADQRGVKGV
NAGK_SALEP      -------------GFDIGGTKIALGVFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVAEADQRGVKGV
NAGK_SALA4      -------------GFDIGGTKIALGVFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVAEADQRGVKGV
NAGK_SHIFL      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_SHIF8      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_SHISS      -------------GFDIGGTKIALGVFDSGRQLQ--WEKRVPTPRDSYDAFLDAVCELVAEAFGCK-GSV
NAGK_SALTY      -------------GFDIGGTKIALGVFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVEEADQRGVKGV
NAGK_SALNS      -------------GFDIGGTKIALGVFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVEEADQRGVKGV
NAGK_SALDC      -------------GFDIGGTKIALGVFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVEEADQRGVKGV
NAGK_PASMU      -------------GFDIGGTKIELA-VFNDQLEKQYSERVETPKE-SYEEWLNTIVRLVHKADEMQCQGV
MAK_ECOLI       ------------IGIDLGGTKTEVIALAGEQL---YRHRLPTPRDDYRQTIETIALVDMAEQATGQRGTV
NAGK_VIBSL      -------------GFDVGGTKIEFGAF-NEKLERVATERVPTPTE-DYQLLLDTIAGLVKKYDNESCEGI
NAGK_SALTI      -------------GFDIGGTKIALGVFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVAEADQRGVKGV
NAGK_YERPN      -------------GFDMGGTKIELG-VFDENLQRIWHKRVPTPREDYPQ-LLQILLTEEADTYCGVQGSV
NAGK_YERPE      -------------GFDMGGTKIELG-VFDENLQRIWHKRVPTPREDYPQ-LLQILLTEEADTYCGVQGSV
NAGK_YERPA      -------------GFDMGGTKIELG-VFDENLQRIWHKRVPTPREDYPQ-LLQILLTEEADTYCGVQGSV
XYLR_LACPE      ----------------------------------------------------------------------
NAGK_VIBVY      -------------GFDVGGTKIEFGAF--NEKLERVATERVPTPTDDYPLLLETIAGLVAKYFACEGK-I
NAGK_VIBVU      -------------GFDVGGTKIEFGAF--NEKLERVATERVPTPTDDYPLLLETIAGLVAKYFACEGK-I
MLC_ECOLI       --------------------------------------------------LLDRIISHIDQFFIERLTSI
GLK_STAXY       --------NKIILAADIGGTTCKLG-IFDENL--NRLSKWSIDTDTSLKNIYDSFIQHIDKSDNSDVLXX
SCRK_BACSU      -------------GIEAGGTKF----VCAVGREDGTII----DRIEFPTKMPDETIEKVIQYFSQSLQAI
NAGK_ERWCT      -------------GFDMGGTKIELGVFDAE--LNKVWQKRVPTPRNNYDDLLAMLIDLVADAXXXXXXXX


                         .         .         *         .         .         .         .:140
query           GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGKQYENFVXXX
XYLR1_BACSU     GICVPGLIDKDQKIVFTPNS--NWRDIDLKSSIQEKYNVPVFIENEANAGAYGEKVFGAAKNHDNXXXXX
XYLR2_BACSU     GICVPGLIDKNQKIVFTPNS--NWRDIDLKSFIQEKFNVPVFIENEANAGAYGEKVFGAAKNHNNIIYAS
Y188_CLOPE      CVSTAGVCPKEGKIVYAGPTIPNYTGVEVKKILEEEFNLPCFVENDVNCAALGEFFGGAGKGTHSMACXX
GLK_STRLI       GIGAAGYVNRQRSTVYFAPNI-DWRQEPLKEKVEARVGLPVVVENDANAAAWGEYKFGGGKGHRNVICXX
GLK_STRCO       GIGAAGYVNRQRSTVYFAPNI-DWRQEPLKEKVEARVGLPVVVENDANAAAWGEYKFGGGKGHRNVICXX
GLCNE_CRIGR     GVGISTVNPQEGIVLHSTKLIQEWNSVDLRTPLSDTLHLPVWVDNDGNCAAMAERKFGQGKGQENFVTLX
GLCNE_HUMAN     GVGISTVNPREGIVLHSTKLIQEWNSVDLRTPLSDTLHLPVWVDNDGNCAALAERKFGQGKGLENFVTLX
GLCNE_RAT       GVGISTVNPQEGVVLHSTKLIQEWNSVDLRTPLSDTLHLPVWVDNDGNCAAMAERKFGQGKGQENFVTLX
GLCNE_MOUSE     GVGISTVNPQEGVVLHSTKLIQEWNSVDLRTPLSDTLHLPVWVDNDGNCAAMAERKFGQGKGQENFVTLX
GLK_BACHD       GLGAPGFIEMDTGFIYHAVNI-GWRDFPLKDKLEEETKLPVIVDNDANIAALGEMWKGAGDGAKNMXXXX
GLK_BACSU       GMGAPGPVDMAAGVVYETVNL-GWKNYALKNHLETETGIPAVIENDANIAALGEMWKGAGDGAKDXXXXX
XYLR_ANATD      XXXXXXXXEKESGTVLLAPNLK-WQNVPLRSIVQQKFNLPVYIDNEANAGALGEKWFGEWGKVSDLIYLS
NAGK_VIBF1      GLGIPGMEDAETGALL-TSNVPAAKGQFLRKDLEAKIGRSVKIDNDANCFALSEAWDEELKDSPSVMXXX
NAGK_MANSM      GLGLPGFVNHETGIA-EITNIRVADNKPIIKDLSERLGREVRAENDANCFALSEAWDEENQQYP-FVXXX
NAGK_ALISL      GLGIPGMEDAETGALL-TSNVPAAKGQFLRKDLEAKIGRSVKIDNDANCFALSEAWDEELKDSPSXXXXX
NAGK_HAEI8      GLGVPGFVNQQTGLA-EITNIRVADNKPILRDLSVRLGREVRAENDANCFALSEAWDTENQQYPXXXXXX
NAGK_VIBPA      GLGLPGMEDADDATVLTV-NVPAAKGKPLRADLEAKIGRSVKIENDANCFALSEAWDEELQDEPSVXXXX
NAGK_VIBFM      GLGIPGMEDAETGALL-TSNVPAAKGQFLRKDLEAKIGRSVKIDNDANCFALSEAWDEELKDSPSVMXXX
NAGK_PHOPR      GIGLPGMEDARDGSVL-TSNIPAAKGRFLRKDLEAKLGRTVTIDNDANCFALSEAWDESLQGEKSXXXXX
NAGK_HAES1      GIGVPGFVNQETGIA-EITNIRVADNKPILKDLSERLGREVRAENDANCFALSEAWDKDNQQYPXXXXXX
NAGK_YERPY      GIGIPGLPNADDGTVFTA-NVPSAMGQPLQADLSRLIQREVRIDNDANCFALSEAWDPEFRTYPXXXXXX
NAGK_YERP3      GIGIPGLPNADDGTVFTA-NVPSAMGQPLQADLSRLIQREVRIDNDANCFALSEAWDPEFRTYPXXXXXX
NAGK_YERE8      GIGIPGLPNADDGTVFTA-NVPAAMGQSLQGDLSGLIGREVRIDNDANCFALSEAWDPEFRRYPXXXXXX
NAGK_YERPS      GIGIPGLPNADDGTVFTA-NVPSAMGQPLQADLSRLIQREVRIDNDANCFALSEAWDPEFRTYPXXXXXX
NAGK_YERPB      GIGIPGLPNADDGTVFTA-NVPSAMGQPLQADLSRLIQREVRIDNDANCFALSEAWDPEFRTYPXXXXXX
NAGK_HAEIN      GLGVPGFVNQQTGLA-EIANIRVADNKPILCDLSTRLGREVRAENDANCFALSEAWDTENQQYSXXXXXX
NAGK_SHIBS      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_ERWT9      GIGVPGLPIADDGTIFSA-NIPAARGRTLRADLSARLGREVRIDNDANCFALSEAWDDEFMQYPXXXXXX
NAGK_ECO7I      GIGIPGMPETEDGTLY-ASNVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_VIBCH      GLGIPGMEDADNGCVLTV-NVPAAKGKPLRADLETKLGRAVKVENDANCFALSEAWDDELKEAASVMXXX
NAGK_SHIDS      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_ECOUT      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_ECOSM      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_ECOSE      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_ECOLU      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_ECOLI      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_ECOLC      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_ECOL5      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_ECOK1      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_ECOHS      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_ECODH      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_ECOBW      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_ECO8A      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_ECO81      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_ECO55      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_ECO45      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_ECO27      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYSXXXXXX
NAGK_ECO24      GIGIPGMPETEDGTLY-AANVPAASGQPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
XYLR_CALSR      --------EKNSGTVLLAPNLK-WQDVPLKRMVESRFGLPVYIDNEANAGALGEKWFGGWGDVSHLLYXX
NAGK_SALHS      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_ECOL6      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_SALPK      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_SALPC      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_SALPA      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_SALCH      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_SALAR      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLERDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_SALPB      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_ESCF3      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_ECO5E      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_ECO57      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_CITK8      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_SALSV      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_SALG2      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_SALEP      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_SALA4      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_SHIFL      GIGIPGMPETEDGKLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_SHIF8      GIGIPGMPETEDGKLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_SHISS      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_SALTY      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_SALNS      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_SALDC      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_PASMU      GLGIPGFVNPATGIA-EIVNIRAADHKPIIQDLETRLGREVRAENDANCFALSEAWDEENAQYPSVXXXX
MAK_ECOLI       GMGIPGSISPYTGVVKNANS--TWLNGQFDKDLSARLQREVRLANDANCLAVSEAVDGAAAGAQTVFAVI
NAGK_VIBSL      GLGLPGMEDADDGTML-VVNVPASTGKPLRKDLEALIGRSVKIENDANCFALSEAWDDELKDEPSVAXXX
NAGK_SALTI      GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
NAGK_YERPN      GIGIPGLPNADDGTVFTA-NVPSAMGQPLQADLSRLIQREVRIDNDANCFALSE----------------
NAGK_YERPE      GIGIPGLPNADDGTVFTA-NVPSAMGQPLQADLSRLIQREVRIDNDANCFALSE----------------
NAGK_YERPA      GIGIPGLPNADDGTVFTA-NVPSAMGQPLQADLSRLIQREVRIDNDANCFALSE----------------
XYLR_LACPE      ------------GIINDNQIVHSWIDMHDIDIVKAEFDVPVILENEANLSAIYERDFNAGLDYRNSITLS
NAGK_VIBVY      GLGLPGMEDADDATVLTV-NVPAAKGKPLRADLEAKIGRSVKIENDANCFALSE----------------
NAGK_VIBVU      GLGLPGMEDADDATVLTV-NVPAAKGKPLRADLEAKIGRSVKIENDANCFALSE----------------
MLC_ECOLI       AITLPGIIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVV
GLK_STAXY       XXXXXXXXNFETGEVNGAVNLYWKGTVNVRDIFKQFVDCPVYVDNDANVAALGEKHKGAGNGADDVVAXX
SCRK_BACSU      GIGSFGPVDNDKGTITATPKA-GWRHYPFLQTVKNEMKIPVGFSTDVNAAALGEFLFGEAKGLDSCLYXX
NAGK_ERWCT      XXXXXXXXTGDEGALFTA-NLPATMGKPLRIDLSQRLQRDVRISNDANCFVLSEAWDAEFRSYPXXXXXX


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXNKGSLLKDSNCGAGEFGMLPYLDGILEDYCSGQFFIKKIGVEGVEILKRARNNDKDTINI
XYLR1_BACSU     XXXXXXXXXXXNNHLYRGVSGFSGEMGHMT-IDGCWELYASEKALLKSLQTKEQDIINLAHLNDIGTLNA
XYLR2_BACSU     ISTXXXXXXXXNNHLYRGVSGFSGEMGHMT-IDGCWELYASEKALLKSLKVSYQDIIDLAHLNDIGTLNA
Y188_CLOPE      XXXXXXXXXXXDGKVLHGFSNSAGEIGYMMVNGEHIQDIASASALVKNVSIDGRYVLDNYENGDLICKEE
GLK_STRLI       XXXXXXXXXXXXNKLRRGHFGVAAEFGMVP--DGLLEQYASGRALVRYAGIEGKHISVAARQGCPVAVDS
GLK_STRCO       XXXXXXXXXXXXNKLRRGHFGVAAEFGMVP--DGLLEQYASGRALVRYAGIEGKHISVAARQGCPVAVDS
GLCNE_CRIGR     XXXXXXXXXXHQHELIHGSSFCAAELGLVVSLDGCIEAYASGQREAKKLHVEGMSVIQAAKLGNVKAQNI
GLCNE_HUMAN     XXXXXXXXXXHQHELIHGSSFCAAELGLVVSLDGCIEAYASGQREAKKLHVEGMSVIQAAKLGNAKAQSI
GLCNE_RAT       XXXXXXXXXXHQHELIHGSSFCAAELGLVVSLDGCIEAYASGQREAKKLHVEGMSVIQAAKLGNVKAQSI
GLCNE_MOUSE     XXXXXXXXXXHQHELIHGSSFCAAELGLVVSLDGCIEAYASGQREAKKLHVEGMSVIQAAKLGNVKAQSI
GLK_BACHD       XXXXXXXXXXXXXXXXHGVNGMAGEIGHITVITGCLETVASAT-GIARIATEGVTEHKEALDYDKHGVLT
GLK_BACSU       XXXXXXXXXXANGEIVHGINGAGGEIGHICSITGCIETIASATGIVRKIALSARDVFEAAGENDEIALEV
XYLR_ANATD      VGIGLGAGIIIDNKLFRGAAGFAGEVGTINFQDGCLENFASERALIKKLVKQGVEIIQAAKEGSRVCRMA
NAGK_VIBF1      XXXXXXXXXXXXXKAFSGYSHVAGELGNAPLLEGCIDNYLSGRGFELLYAKKAIDIIKAHAEGDANAVEH
NAGK_MANSM      XXXXXXXXXXXXXXKVHSGQIGAGELGHLPIYDACLDTYLSGRGFLKGEALSAKEIIERFYAADKTAVDF
NAGK_ALISL      XXXXXXXXXXXXXXXXSGYSHVAGELGKAPLLEGCIDNYLSGRLYAHYYGQEAIDIIKANEAGDADAVEH
NAGK_HAEI8      XXXXXXXXXXXXXKVHSGQVGMAGELGHLQYQCGCLDNYLSGRGFLKGETLSAREIIDLFYQGNESAVDF
NAGK_VIBPA      XXXXXXXXXXYDGKVFSGRNHVAGEVGRLPIKKGCLDSYLSGRLYAHYYGEEAIDIIKAHAEGEAKAVEH
NAGK_VIBFM      XXXXXXXXXXXXXQAFSGYSHVAGELGRLPXXXXXXDSYLSGRGFELLYAKKAIDIIKAHAEGDVNAVEH
NAGK_PHOPR      XXXXXXXXXXXXXXXXSGMNHVAGELGRMPINKGCIDNYLSGRGFEQLYNLKAIEIIKLHATGEAKAVEH
NAGK_HAES1      XXXXXXXXXXXXXXXHSGQSGMAGELGHLPIYEACLDTYLSGRGFLQGKALSAKEIIRCFYDKDESAVKF
NAGK_YERPY      XXXXXXXXXXXXXXXXXXRNHITGEFGRLPVLDGCIENYISGRGFFYQHTLPATDIIAHYAAGEPKAVAH
NAGK_YERP3      XXXXXXXXXXXXXXXXXXRNHITGEFGHIPHVPGCIENYISGRGFFYQHTLPATDIIAHYAAGEPKAVAH
NAGK_YERE8      XXXXXXXXXXXXXXXXSGRNHITGEFGRLPVLDGCIENYISGRGFFNQQSLPATEIIANYNLGESKAVAH
NAGK_YERPS      XXXXXXXXXXXXXXXXXXRNHITGEFGRLPVLDGCIENYISGRGFFYQHTLPATDIIAHYAAGEPKAVAH
NAGK_YERPB      XXXXXXXXXXXXXXXXXXRNHITGEFGRLPVLDGCIENYISGRGFFYQHTLPATDIIAHYAAGEPKAVAH
NAGK_HAEIN      XXXXXXXXXXXXXKVHSGQVGMAGELGHLQYQCGCLDNYLSGRGFLKGETLSARKIINLFYQSNESAVDF
NAGK_SHIBS      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFXXXXXXXAPEIIALYNQGDEQARAH
NAGK_ERWT9      XXXXXXXXXXXXXKPVTGRNYVVGELGHIPLLPGCIEGYLSGHYFYQKTH-SAPEIIRRYYEGDTDALAH
NAGK_ECO7I      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIALYDQGDEQARAH
NAGK_VIBCH      XXXXXXXXXXXXXKVFSGRNHVAGEIGHMPLLKGCMDNYLSGRGFEKK---KAIDIITAQKEGESKAVEH
NAGK_SHIDS      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIALYDQGDEQARAH
NAGK_ECOUT      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIALYDQGDEQARAH
NAGK_ECOSM      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIALYDQGDEQARAH
NAGK_ECOSE      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIALYDQGDEQARAH
NAGK_ECOLU      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIALYDQGDEQARAH
NAGK_ECOLI      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIALYDQGDEQARAH
NAGK_ECOLC      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIALYDQGDEQARAH
NAGK_ECOL5      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIALYDQGDEQARAH
NAGK_ECOK1      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIALYDQGDEQARAH
NAGK_ECOHS      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIALYDQGDEQARAH
NAGK_ECODH      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIALYDQGDEQARAH
NAGK_ECOBW      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIALYDQGDEQARAH
NAGK_ECO8A      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIALYDQGDEQARAH
NAGK_ECO81      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIALYDQGDEQARAH
NAGK_ECO55      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIALYDQGDEQARAH
NAGK_ECO45      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIALYDQGDEQARAH
NAGK_ECO27      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIAFYDQGDEQARAH
NAGK_ECO24      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIALYDQGDEQARAH
XYLR_CALSR      XXXXXXXXXXXXXXXYRGAKGFAGEVGTIDFNDGCLENFASERSLIKTLVESGVEIIQSALQRSRVAMNA
NAGK_SALHS      XXXXXXXXXXXXXKPITGQSYITGEFGRLPVQMGCIENYLSGRGFYYDQSLQAPEIIALWEQGDEQAHAH
NAGK_ECOL6      XXXXXXXXXXFNGRPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIALYDQGDEQARAH
NAGK_SALPK      XXXXXXXXXXXXXKPITGQSYITGEFGRLPVQMGCIENYLSGRGFYYHQSLQAPEIIALWEQGDEQAHAH
NAGK_SALPC      XXXXXXXXXXXXXKPITGQSYITGEFGRLPVQMGCIENYLSGRGFYYDQSLQAPEIIALWEQGDEQAHAH
NAGK_SALPA      XXXXXXXXXXXXXKPITGQSYITGEFGRLPVQMGCIENYLSGRGFYYHQSLQAPEIIALWEQGDEQAHAH
NAGK_SALCH      XXXXXXXXXXXXXKPITGQSYITGEFGRLPVQMGCIENYLSGRGFYYDQSLQAPEIIALWEQGDEQAHAH
NAGK_SALAR      XXXXXXXXXXXXXKPITGQSYITGEFGRLPVQMGCIENYLSGRGFYYHQSLQAPEIIALWEQGDKQAHAH
NAGK_SALPB      XXXXXXXXXXXXXKPITGQSYITGEFGRLPVQMGCIENYLSGRGFYYDQSLQAPEIIALWEQGDEQAQAH
NAGK_ESCF3      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIALWEEGDERAQAH
NAGK_ECO5E      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLPAPEIIALYDQGDEQARAH
NAGK_ECO57      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLPAPEIIALYDQGDEQARAH
NAGK_CITK8      XXXXXXXXXXXXXKPITGCSYITGEFGMRLPVDGCIENYLSGRGFYYHQPLQAPEIIALWEQGDERARAH
NAGK_SALSV      XXXXXXXXXXXXXKPITGQSYITGEFGRLPVQMGCIENYLSGRGFYYDQSLQAPEIIALWEQGDEQAHAH
NAGK_SALG2      XXXXXXXXXXXXXKPITGQSYITGEFGRLPVQMGCIENYLSGRGFYYDQSLQAPEIIALWEQGDEQAHAH
NAGK_SALEP      XXXXXXXXXXXXXKPITGQSYITGEFGRLPVQMGCIENYLSGRGFYYDQSLQAPEIIALWEQGDEQAHAH
NAGK_SALA4      XXXXXXXXXXXXXKPITGQSYITGEFGRLPVQMGCIENYLSGRGFYYDQSLQAPEIIALWEQGDEQAHAH
NAGK_SHIFL      XXXXXXXXXXXXXKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIALYDQGDEQARAH
NAGK_SHIF8      XXXXXXXXXXXXXKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIALYDQGDEQARAH
NAGK_SHISS      XXXXXXXXXXFNGKPITGKSYITGEFGRLPVLDGCIENYLSGRGFYYHQPLQAPEIIALYDQGDEQARAH
NAGK_SALTY      XXXXXXXXXXXXXKPITGQSYITGEFGRLPVQMGCIENYLSGRGFYYDQSLQAPEIIALWEQGDEQAHAH
NAGK_SALNS      XXXXXXXXXXXXXKPITGQSYITGEFGRLPVQMGCIENYLSGRGFYYDQSLQAPEIIALWEQGDEQAHAH
NAGK_SALDC      XXXXXXXXXXXXXKPITGQSYITGEFGRLPVQMGCIENYLSGRGFYYHQSLQAPEIIALWEQGDEQAHAH
NAGK_PASMU      XXXXXXXXXXXXXKVHSGQTGMAGEVGALRLLGGCLDTYLSGRGFMQGEALSAQAIIQRFYAGDQSAVKF
MAK_ECOLI       IGTGCGAGVAFNGRAHIGGNGTAGEWGPLPWMDGCIETFISGTGFLSGHALKGSEIIRLVEESDPVXXXX
NAGK_VIBSL      XXXXXXXXXXXXXKVFSGRNHVAGELGHMSYLSGRGFELIYEHYFGEK--KKAIEIIQAYNEGESKAAEH
NAGK_SALTI      XXXXXXXXXXXXKPITGQSYI-TGEFGRLPVQMGCIENYLSGRGFYYDQSLQAPEIIALWEQGDEQAHAH
NAGK_YERPN      ----------------------------------------------------------------------
NAGK_YERPE      ----------------------------------------------------------------------
NAGK_YERPA      ----------------------------------------------------------------------
XYLR_LACPE      IHRGIGAGIILDKHLFRGKQGEAGEVGRSLTLLGSVESICSEEAIINRVTTNRQTVVQLYQQHDREVERI
NAGK_VIBVY      ----------------------------------------------------------------------
NAGK_VIBVU      ----------------------------------------------------------------------
MLC_ECOLI       IDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETISVDSILELAQLRLNQSMSSML
GLK_STAXY       XXXXXXXXXXSNGEIVHGHNGSGAEIG-------------------------------------------
SCRK_BACSU      XXXXXXXXXXVEGRLLQGSHPEMGHIGKCPYHGDCFEGLASGPAIEARWGKKAADL--------SDIAQV
NAGK_ERWCT      XXXXXXXXXXXXXRPVDGRNGIAGEFGHLDALDGCIENYISGRGFLYGEALPAVTIIRHYRGGEEKALEF


                         .         .         .         +         .         .         .:280
query           YKQFGKHLGVAIKSIMYTLDPEVIIIAGSIISAREFFEKAMWDEIKTFAFINQLKKLK
XYLR1_BACSU     LQNFGFYLGIGLTNILNTFNPQAVILRNSIIESHPMVLNSMRSEVSS-----------
XYLR2_BACSU     LQNFGFYLGIGLTNILNTFNPQAIILRNSIIESHPMVLNSIRSEVSS-----------
Y188_CLOPE      VEKLADNLALGISNIVYLINPEVVVLGGGIMAREEVFRPLIENSLRKY----------
GLK_STRLI       YRELARWAGAGLADLASLFDPSAFIVGGGL----------------------------
GLK_STRCO       YRELARWAGAGLADLASLFDPSAFIVGGGL----------------------------
GLCNE_CRIGR     LRTAGTALGLGVVNILHTMDPSLVILSGVLAS--------------------------
GLCNE_HUMAN     LRTAGTALGLGVVNILHTMNPSLVILSGVLAS--------------------------
GLCNE_RAT       LRTAGTALGLGVVNILHTMNPSLVILSGVLAS--------------------------
GLCNE_MOUSE     LRTAGTALGLGVVNILHTMNPSLVILSGVLAS--------------------------
GLK_BACHD       AKHIAYYLGFAIANLANALNPEKIVIGGGVSKAGDTLLKPIKQHFEAYA---------
GLK_BACSU       VDYVAKHLGLVLGNLASSLNPSKIVLGGGVSRAGELLRSKVEKTFRKCAF--------
XYLR_ANATD      ILEVAEKMGIGVANLVNIFNPEMVIIGNKASFFGELFLEKLREVINQRSFIAQFYNLK
NAGK_VIBF1      VDRFMELLAICFANLFTCFDPHVVALGGGLSNFELIYEE-------------------
NAGK_MANSM      VGLFIELCAISLGNIITALDPHVIVLGGGLSNFDYLYEKALPKHLMRSAKVPVIKKAK
NAGK_ALISL      VDRFMELLAICFANLFTCFDPHVVALGGGL----------------------------
NAGK_HAEI8      VNLFVELAAISIGNIITAFDPHMIVLGGGLSNFDYLYEKALPPHLMRTAKVPPIKKAK
NAGK_VIBPA      VERFMELLAICFANIFTATDPHVVVLGGGLSNFELIYEE-------------------
NAGK_VIBFM      VDRFMELLAICFANLFTCFDPHVVALGGGLSNFELIYEE-------------------
NAGK_PHOPR      VDRFMEMLAICLANIFTGLDPHVVVLGGGLSNFELLYQELPKRIAKHLLSVAQVPKI-
NAGK_HAES1      VELFIELCAISIGNIITALDPHVIILGGGLSNFDYLYEKALPQHLMRTAKVPLIKKAK
NAGK_YERPY      VERFMDVLAVCLGNLLTMLDPHLVVVGGGLSNFEKIYQE-------------------
NAGK_YERP3      VERFMDVLAVCLGNLLTMLDPHLVVVGGGLSNFEKIYQE-------------------
NAGK_YERE8      VERFMDVLAVCLGNLLTMLDPHLVVIGGGLSNFEHIYQE-------------------
NAGK_YERPS      VERFMDVLAVCLGNLLTMLDPHLVVVGGGLSNFEKIYQE-------------------
NAGK_YERPB      VERFMDVLAVCLGNLLTMLDPHLVVVGGGLSNFEKIYQE-------------------
NAGK_HAEIN      VNLFVELAAISIGNIITAFDPHMIVLGGGLSNFDYLYEKALPPHLMRKAKVPPIKKAK
NAGK_SHIBS      VERYLDLLAVSLGNILTIVDPDLVVIGGGL----------------------------
NAGK_ERWT9      TERYRELLAVCLGNILTLLDPHLVVLGGGL----------------------------
NAGK_ECO7I      VERYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
NAGK_VIBCH      VERFMELLAICFANIFTANDPHVVVLGGGLSNYDLIYEE-------------------
NAGK_SHIDS      VERYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
NAGK_ECOUT      VERYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
NAGK_ECOSM      VERYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
NAGK_ECOSE      VERYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
NAGK_ECOLU      VERYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
NAGK_ECOLI      VERYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
NAGK_ECOLC      VERYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
NAGK_ECOL5      VERYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
NAGK_ECOK1      VERYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
NAGK_ECOHS      VERYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
NAGK_ECODH      VERYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
NAGK_ECOBW      VERYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
NAGK_ECO8A      VERYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
NAGK_ECO81      VERYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
NAGK_ECO55      VERYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
NAGK_ECO45      VERYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
NAGK_ECO27      VERYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
NAGK_ECO24      VERYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
XYLR_CALSR      ITDIANKLGIGIANLVNIFNPDIVVIGNKASFMGDLFLEELRRIVYKRAFITQ-----
NAGK_SALHS      VERYLDLLAVCLGNILTIVDPDLLVIGGGL----------------------------
NAGK_ECOL6      VERYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
NAGK_SALPK      VERYLDLLAVCLGNILTIVDPDLLVIGGGL----------------------------
NAGK_SALPC      VERYLDLLAVCLGNILTIVDPDLLVIGGGL----------------------------
NAGK_SALPA      VERYLDLLAVCLGNILTIVDPDLLVIGGGL----------------------------
NAGK_SALCH      VERYLDLLAVCLGNILTIVDPDLLVIGGGL----------------------------
NAGK_SALAR      VERYLDLLAVCLGNILTIVDPCLLVIGGGL----------------------------
NAGK_SALPB      VERYLNLLAVCLGNILTIVDPDLLVIGGGL----------------------------
NAGK_ESCF3      VDRYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
NAGK_ECO5E      VERYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
NAGK_ECO57      VERYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
NAGK_CITK8      VERYLDLLAVCLGNILTIVDPDLVVIGGGL----------------------------
NAGK_SALSV      VERYLDLLAVCLGNILTIVDPDLLVIGGGL----------------------------
NAGK_SALG2      VERYLDLLAVCLGNILTIVDPDLLVIGGGL----------------------------
NAGK_SALEP      VERYLDLLAVCLGNILTIVDPDLLVIGGGL----------------------------
NAGK_SALA4      VERYLDLLAVCLGNILTIVDPDLLVIGGGL----------------------------
NAGK_SHIFL      VERYLDLLAVSLGNILTIVDPDLVVIGGGL----------------------------
NAGK_SHIF8      VERYLDLLAVSLGNILTIVDPDLVVIGGGL----------------------------
NAGK_SHISS      VERYLDLLAVCLGNILTIVDSDLVVIGGGL----------------------------
NAGK_SALTY      VERYLDLLAVCLGNILTIVDPDLLVIGGGL----------------------------
NAGK_SALNS      VERYLDLLAVCLGNILTIVDPDLLVIGGGL----------------------------
NAGK_SALDC      VERYLDLLAVCLGNILTIVDPDLLVIGGGL----------------------------
NAGK_PASMU      VELFIELCAISIGNLITVLDPHVIVLGGGLSNFDYLYE--------------------
MAK_ECOLI       XXXXXXXXXKSLAHVVNILDPDVIVLGGGMSNVDRLYQ-TVGQLIKQFVF--------
NAGK_VIBSL      VDRFMELLAICFANLFTGLDPHVVALGGGLSNFELIYEE-------------------
NAGK_SALTI      VERYLDLLAVCLGNILTIVDPDLLVIGGGL----------------------------
NAGK_YERPN      ----------------------------------------------------------
NAGK_YERPE      ----------------------------------------------------------
NAGK_YERPA      ----------------------------------------------------------
XYLR_LACPE      LSQSCSVIAGLIYNVVTTLNPDAIFINSELLA--------------------------
NAGK_VIBVY      ----------------------------------------------------------
NAGK_VIBVU      ----------------------------------------------------------
MLC_ECOLI       HGQVGAHVGRILAIMVNLFNPQKILIGSPLSKAADILFPVISDSIR------------
GLK_STAXY       ----------------------------------------------------------
SCRK_BACSU      WELEGXXXXXXXXXXXXXXXPKKIILGGGVMQQKQVF---------------------
NAGK_ERWCT      VDRFMDXXXXXXXXXXXXFDPHLLVLGGGLSNFDEIYQ--------------------