[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30829.1

[Show Plain Result]


## Summary of Sequence Search
    1::111
    1::111     1e-61 100%  111 aa  RS6_FRATW RecName: Full=30S ribosomal protein S6;
    1::111     1e-61 100%  111 aa  RS6_FRATT RecName: Full=30S ribosomal protein S6;
    1::111     1e-61 100%  111 aa  RS6_FRATN RecName: Full=30S ribosomal protein S6;
    1::111     1e-61 100%  111 aa  RS6_FRATM RecName: Full=30S ribosomal protein S6;
    1::111     1e-61 100%  111 aa  RS6_FRATH RecName: Full=30S ribosomal protein S6;
    1::111     1e-61 100%  111 aa  RS6_FRAT1 RecName: Full=30S ribosomal protein S6;
    1::111     2e-56  87%  111 aa  RS6_FRAP2 RecName: Full=30S ribosomal protein S6;
    1::109     1e-38  61%  113 aa  RS6_PSEHT RecName: Full=30S ribosomal protein S6;
    1::108     1e-38  58%  125 aa  RS6_HAES2 RecName: Full=30S ribosomal protein S6;
    1::110     2e-38  58%  122 aa  RS6_VIBCM RecName: Full=30S ribosomal protein S6;
    1::110     2e-38  58%  122 aa  RS6_VIBCH RecName: Full=30S ribosomal protein S6;
    1::110     2e-38  58%  122 aa  RS6_VIBC3 RecName: Full=30S ribosomal protein S6;
    1::108     2e-38  58%  119 aa  RS6_HALHL RecName: Full=30S ribosomal protein S6;
    1::108     3e-38  59%  126 aa  RS6_ALISL RecName: Full=30S ribosomal protein S6;
    1::107     3e-38  62%  114 aa  RS6_THICR RecName: Full=30S ribosomal protein S6;
    1::108     3e-38  57%  125 aa  RS6_MANSM RecName: Full=30S ribosomal protein S6;
    1::109     3e-38  57%  119 aa  RS6_ALHEH RecName: Full=30S ribosomal protein S6;
    1::111     4e-38  56%  126 aa  RS6_ACTSZ RecName: Full=30S ribosomal protein S6;
    1::108     6e-38  59%  126 aa  RS6_VIBFM RecName: Full=30S ribosomal protein S6;
    1::108     6e-38  59%  126 aa  RS6_VIBF1 RecName: Full=30S ribosomal protein S6;
    1::107     6e-38  57%  125 aa  RS6_PASMU RecName: Full=30S ribosomal protein S6;
    1::108     6e-38  58%  125 aa  RS6_HAES1 RecName: Full=30S ribosomal protein S6;
    1::109     6e-38  61%  125 aa  RS6_BORPD RecName: Full=30S ribosomal protein S6;
    1::108     7e-38  58%  125 aa  RS6_HAEIN RecName: Full=30S ribosomal protein S6;
    1::108     7e-38  58%  125 aa  RS6_HAEIG RecName: Full=30S ribosomal protein S6;
    1::108     7e-38  58%  125 aa  RS6_HAEI8 RecName: Full=30S ribosomal protein S6;
    1::108     1e-37  57%  131 aa  RS6_SHESR RecName: Full=30S ribosomal protein S6;
    1::108     1e-37  57%  131 aa  RS6_SHESM RecName: Full=30S ribosomal protein S6;
    1::108     1e-37  58%  125 aa  RS6_HAEIE RecName: Full=30S ribosomal protein S6;
    1::103     1e-37  61%  123 aa  RS6_VIBVY RecName: Full=30S ribosomal protein S6;
    1::103     1e-37  61%  123 aa  RS6_VIBVU RecName: Full=30S ribosomal protein S6;
    1::105     1e-37  63%  136 aa  RS6_METCA RecName: Full=30S ribosomal protein S6;
    1::103     2e-37  61%  135 aa  RS6_CHRSD RecName: Full=30S ribosomal protein S6;
    1::108     2e-37  58%  131 aa  RS6_SHEON RecName: Full=30S ribosomal protein S6;
    1::109     2e-37  59%  134 aa  RS6_PSYWF RecName: Full=30S ribosomal protein S6;
    1::108     3e-37  57%  131 aa  RS6_SHESA RecName: Full=30S ribosomal protein S6;
    1::107     4e-37  62%  156 aa  RS6_NITOC RecName: Full=30S ribosomal protein S6;
    1::107     4e-37  57%  128 aa  RS6_AZOSE RecName: Full=30S ribosomal protein S6;
    1::104     6e-37  60%  129 aa  RS6_VIBHB RecName: Full=30S ribosomal protein S6;
    1::108     6e-37  56%  131 aa  RS6_SHESW RecName: Full=30S ribosomal protein S6;
    1::108     6e-37  56%  131 aa  RS6_SHEPC RecName: Full=30S ribosomal protein S6;
    1::108     8e-37  56%  126 aa  RS6_HAEPS RecName: Full=30S ribosomal protein S6;
    1::109     1e-36  56%  124 aa  RS6_POLSQ RecName: Full=30S ribosomal protein S6;
    1::109     1e-36  58%  134 aa  RS6_MARMS RecName: Full=30S ribosomal protein S6;
    1::102     1e-36  59%  134 aa  RS6_ACIF5 RecName: Full=30S ribosomal protein S6;
    1::102     1e-36  59%  134 aa  RS6_ACIF2 RecName: Full=30S ribosomal protein S6;
    1::108     1e-36  55%  147 aa  RS6_PHOPR RecName: Full=30S ribosomal protein S6;
    1::107     1e-36  56%  127 aa  RS6_AZOSB RecName: Full=30S ribosomal protein S6;
    1::102     1e-36  59%  124 aa  RS6_ACTPJ RecName: Full=30S ribosomal protein S6;
    1::102     1e-36  59%  124 aa  RS6_ACTP7 RecName: Full=30S ribosomal protein S6;
    1::102     1e-36  59%  124 aa  RS6_ACTP2 RecName: Full=30S ribosomal protein S6;
    1::107     2e-36  60%  146 aa  RS6_NITEU RecName: Full=30S ribosomal protein S6;
    1::109     2e-36  56%  144 aa  RS6_NITEC RecName: Full=30S ribosomal protein S6;
    1::109     2e-36  58%  113 aa  RS6_ALCBS RecName: Full=30S ribosomal protein S6;
    1::104     2e-36  59%  129 aa  RS6_VIBPA RecName: Full=30S ribosomal protein S6;
    1::109     2e-36  57%  113 aa  RS6_VESOH RecName: Full=30S ribosomal protein S6;
    1::107     2e-36  58%  116 aa  RS6_IDILO RecName: Full=30S ribosomal protein S6;
    1::107     3e-36  57%  139 aa  RS6_SHEWM RecName: Full=30S ribosomal protein S6;
    1::109     3e-36  56%  124 aa  RS6_POLNS RecName: Full=30S ribosomal protein S6;
    1::102     4e-36  61%  135 aa  RS6_SHEAM RecName: Full=30S ribosomal protein S6;
    1::107     4e-36  55%  125 aa  RS6_LARHH RecName: Full=30S ribosomal protein S6;
    1::105     4e-36  56%  124 aa  RS6_HAEDU RecName: Full=30S ribosomal protein S6;
    1::107     5e-36  57%  135 aa  RS6_SHELP RecName: Full=30S ribosomal protein S6;
    1::109     7e-36  55%  131 aa  RS6_METFK RecName: Full=30S ribosomal protein S6;
    1::104     9e-36  57%  137 aa  RS6_VIBSL RecName: Full=30S ribosomal protein S6;
    1::100     9e-36  60%  138 aa  RS6_THISH RecName: Full=30S ribosomal protein S6;
    1::105     9e-36  58%  137 aa  RS6_SHEPW RecName: Full=30S ribosomal protein S6;
    1::105     9e-36  59%  126 aa  RS6_BORPE RecName: Full=30S ribosomal protein S6;
    1::105     9e-36  59%  126 aa  RS6_BORPA RecName: Full=30S ribosomal protein S6;
    1::105     9e-36  59%  126 aa  RS6_BORBR RecName: Full=30S ribosomal protein S6;
    1::105     1e-35  57%  131 aa  RS6_CITK8 RecName: Full=30S ribosomal protein S6;
    1::108     2e-35  56%  131 aa  RS6_SHEB9 RecName: Full=30S ribosomal protein S6;
    1::108     2e-35  56%  131 aa  RS6_SHEB8 RecName: Full=30S ribosomal protein S6;
    1::108     2e-35  56%  131 aa  RS6_SHEB5 RecName: Full=30S ribosomal protein S6;
    1::108     2e-35  56%  131 aa  RS6_SHEB2 RecName: Full=30S ribosomal protein S6;
    1::109     2e-35  57%  113 aa  RS6_RUTMC RecName: Full=30S ribosomal protein S6;
    1::105     2e-35  55%  141 aa  RS6_PSEE4 RecName: Full=30S ribosomal protein S6;
    1::108     2e-35  56%  108 aa  RS6_DICNV RecName: Full=30S ribosomal protein S6;
    1::105     2e-35  56%  130 aa  RS6_SHEFN RecName: Full=30S ribosomal protein S6;
    1::105     2e-35  57%  130 aa  RS6_SHEDO RecName: Full=30S ribosomal protein S6;
    1::109     2e-35  56%  122 aa  RS6_METPP RecName: Full=30S ribosomal protein S6;
    1::109     2e-35  55%  142 aa  RS6_HAHCH RecName: Full=30S ribosomal protein S6;
    1::105     2e-35  56%  131 aa  RS6_ENT38 RecName: Full=30S ribosomal protein S6;
    1::107     3e-35  55%  127 aa  RS6_THIDA RecName: Full=30S ribosomal protein S6;
    1::105     3e-35  54%  138 aa  RS6_PSEU5 RecName: Full=30S ribosomal protein S6;
    1::105     3e-35  56%  139 aa  RS6_PSEAE RecName: Full=30S ribosomal protein S6;
    1::105     3e-35  56%  139 aa  RS6_PSEAB RecName: Full=30S ribosomal protein S6;
    1::105     3e-35  56%  139 aa  RS6_PSEA8 RecName: Full=30S ribosomal protein S6;
    1::105     3e-35  56%  139 aa  RS6_PSEA7 RecName: Full=30S ribosomal protein S6;
    1::105     3e-35  55%  131 aa  RS6_PROMH RecName: Full=30S ribosomal protein S6;
    1::107     3e-35  54%  125 aa  RS6_NITMU RecName: Full=30S ribosomal protein S6;
    1::102     3e-35  59%  127 aa  RS6_ACIBY RecName: Full=30S ribosomal protein S6;
    1::102     3e-35  59%  127 aa  RS6_ACIBT RecName: Full=30S ribosomal protein S6;
    1::102     3e-35  59%  127 aa  RS6_ACIBS RecName: Full=30S ribosomal protein S6;
    1::102     3e-35  59%  127 aa  RS6_ACIB5 RecName: Full=30S ribosomal protein S6;
    1::102     3e-35  59%  127 aa  RS6_ACIB3 RecName: Full=30S ribosomal protein S6;
    1::104     4e-35  55%  124 aa  RS6_TOLAT RecName: Full=30S ribosomal protein S6;
    1::108     4e-35  53%  132 aa  RS6_SERP5 RecName: Full=30S ribosomal protein S6;
    1::108     4e-35  54%  127 aa  RS6_COXB1 RecName: Full=30S ribosomal protein S6;
    1::107     4e-35  54%  124 aa  RS6_CHRVO RecName: Full=30S ribosomal protein S6;
    1::105     4e-35  56%  136 aa  RS6_AZOVD RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_SHISS RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_SHIFL RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_SHIF8 RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_SHIDS RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_SHIBS RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_SHIB3 RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_SALTY RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_SALTI RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_SALSV RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_SALPK RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_SALPC RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_SALPB RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_SALPA RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_SALNS RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_SALHS RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_SALG2 RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_SALEP RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_SALDC RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_SALCH RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_SALA4 RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  55%  141 aa  RS6_PSEF5 RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_ESCF3 RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_ENTS8 RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_ECOUT RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_ECOSM RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_ECOSE RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_ECOLU RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  135 aa  RS6_ECOLI RecName: Full=30S ribosomal protein S6;Contains:
    1::105     6e-35  56%  131 aa  RS6_ECOLC RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_ECOL6 RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_ECOK1 RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_ECOHS RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_ECODH RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_ECOBW RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_ECO8A RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_ECO81 RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_ECO7I RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_ECO5E RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_ECO57 RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_ECO55 RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_ECO45 RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_ECO27 RecName: Full=30S ribosomal protein S6;
    1::105     6e-35  56%  131 aa  RS6_ECO24 RecName: Full=30S ribosomal protein S6;
    1::108     8e-35  53%  130 aa  RS6_YERPY RecName: Full=30S ribosomal protein S6;
    1::108     8e-35  53%  130 aa  RS6_YERPS RecName: Full=30S ribosomal protein S6;
    1::108     8e-35  53%  130 aa  RS6_YERPP RecName: Full=30S ribosomal protein S6;
    1::108     8e-35  53%  130 aa  RS6_YERPN RecName: Full=30S ribosomal protein S6;
    1::108     8e-35  53%  130 aa  RS6_YERPG RecName: Full=30S ribosomal protein S6;
    1::108     8e-35  53%  130 aa  RS6_YERPE RecName: Full=30S ribosomal protein S6;
    1::108     8e-35  53%  130 aa  RS6_YERPB RecName: Full=30S ribosomal protein S6;
    1::108     8e-35  53%  130 aa  RS6_YERPA RecName: Full=30S ribosomal protein S6;
    1::108     8e-35  53%  130 aa  RS6_YERP3 RecName: Full=30S ribosomal protein S6;
    1::108     8e-35  53%  130 aa  RS6_YERE8 RecName: Full=30S ribosomal protein S6;
    1::105     8e-35  55%  131 aa  RS6_SALAR RecName: Full=30S ribosomal protein S6;
    1::109     8e-35  52%  124 aa  RS6_RALEJ RecName: Full=30S ribosomal protein S6;
    1::105     8e-35  54%  140 aa  RS6_PSEFS RecName: Full=30S ribosomal protein S6;
    1::103     8e-35  59%  122 aa  RS6_NEIGO RecName: Full=30S ribosomal protein S6;
    1::103     8e-35  59%  122 aa  RS6_NEIG1 RecName: Full=30S ribosomal protein S6;
    1::102     8e-35  57%  137 aa  RS6_MARAV RecName: Full=30S ribosomal protein S6;
    1::102     1e-34  57%  143 aa  RS6_COLP3 RecName: Full=30S ribosomal protein S6;
    1::103     1e-34  59%  147 aa  RS6_CELJU RecName: Full=30S ribosomal protein S6;
    1::105     1e-34  54%  141 aa  RS6_PSEU2 RecName: Full=30S ribosomal protein S6;
    1::105     1e-34  54%  141 aa  RS6_PSESM RecName: Full=30S ribosomal protein S6;
    1::105     1e-34  54%  141 aa  RS6_PSEPW RecName: Full=30S ribosomal protein S6;
    1::105     1e-34  54%  141 aa  RS6_PSEPK RecName: Full=30S ribosomal protein S6;
    1::105     1e-34  54%  141 aa  RS6_PSEPG RecName: Full=30S ribosomal protein S6;
    1::105     1e-34  54%  142 aa  RS6_PSEPF RecName: Full=30S ribosomal protein S6;
    1::105     1e-34  54%  141 aa  RS6_PSEP1 RecName: Full=30S ribosomal protein S6;
    1::105     1e-34  54%  141 aa  RS6_PSE14 RecName: Full=30S ribosomal protein S6;
    1::109     1e-34  54%  122 aa  RS6_JANMA RecName: Full=30S ribosomal protein S6;
    1::109     2e-34  55%  131 aa  RS6_PSYCK RecName: Full=30S ribosomal protein S6;
    1::109     2e-34  55%  132 aa  RS6_PSYA2 RecName: Full=30S ribosomal protein S6;
    1::104     2e-34  55%  140 aa  RS6_PSEMY RecName: Full=30S ribosomal protein S6;
    1::107     2e-34  55%  131 aa  RS6_EDWI9 RecName: Full=30S ribosomal protein S6;
    1::108     2e-34  52%  131 aa  RS6_PHOLL RecName: Full=30S ribosomal protein S6;
    1::109     2e-34  53%  122 aa  RS6_HERAR RecName: Full=30S ribosomal protein S6;
    1::113     2e-34  52%  143 aa  RS6_HAMD5 RecName: Full=30S ribosomal protein S6;
    1::105     2e-34  54%  128 aa  RS6_AERHH RecName: Full=30S ribosomal protein S6;
    1::100     3e-34  57%  151 aa  RS6_TERTT RecName: Full=30S ribosomal protein S6;
    1::107     3e-34  53%  131 aa  RS6_ERWT9 RecName: Full=30S ribosomal protein S6;
    1::97      3e-34  58%  127 aa  RS6_DECAR RecName: Full=30S ribosomal protein S6;
    1::109     3e-34  54%  124 aa  RS6_BURXL RecName: Full=30S ribosomal protein S6;
    1::109     3e-34  54%  124 aa  RS6_BURPP RecName: Full=30S ribosomal protein S6;
    1::104     3e-34  58%  124 aa  RS6_BORA1 RecName: Full=30S ribosomal protein S6;
    1::104     4e-34  53%  152 aa  RS6_SACD2 RecName: Full=30S ribosomal protein S6;
    1::108     4e-34  53%  127 aa  RS6_COXBU RecName: Full=30S ribosomal protein S6;
    1::108     4e-34  53%  127 aa  RS6_COXBR RecName: Full=30S ribosomal protein S6;
    1::108     4e-34  53%  127 aa  RS6_COXB2 RecName: Full=30S ribosomal protein S6;
    1::103     5e-34  55%  122 aa  RS6_RALPJ RecName: Full=30S ribosomal protein S6;
    1::105     5e-34  54%  130 aa  RS6_PECCP RecName: Full=30S ribosomal protein S6;
    1::105     5e-34  54%  130 aa  RS6_ERWCT RecName: Full=30S ribosomal protein S6;
    1::97      5e-34  58%  133 aa  RS6_ALTMD RecName: Full=30S ribosomal protein S6;
    1::109     6e-34  54%  141 aa  RS6_VEREI RecName: Full=30S ribosomal protein S6;
    3::110     6e-34  56%  145 aa  RS6_STRM5 RecName: Full=30S ribosomal protein S6;
    1::103     6e-34  55%  122 aa  RS6_RALSO RecName: Full=30S ribosomal protein S6;
    1::109     6e-34  51%  124 aa  RS6_RALEH RecName: Full=30S ribosomal protein S6;
    1::109     6e-34  51%  124 aa  RS6_CUPTR RecName: Full=30S ribosomal protein S6;
    1::107     8e-34  51%  131 aa  RS6_SODGM RecName: Full=30S ribosomal protein S6;
    1::109     8e-34  51%  124 aa  RS6_RALME RecName: Full=30S ribosomal protein S6;
    1::103     2e-33  56%  124 aa  RS6_BURTA RecName: Full=30S ribosomal protein S6;
    1::103     2e-33  56%  124 aa  RS6_BURPS RecName: Full=30S ribosomal protein S6;
    1::103     2e-33  56%  124 aa  RS6_BURP6 RecName: Full=30S ribosomal protein S6;
    1::103     2e-33  56%  124 aa  RS6_BURP1 RecName: Full=30S ribosomal protein S6;
    1::103     2e-33  56%  124 aa  RS6_BURP0 RecName: Full=30S ribosomal protein S6;
    1::103     2e-33  56%  124 aa  RS6_BURMS RecName: Full=30S ribosomal protein S6;
    1::103     2e-33  56%  124 aa  RS6_BURMA RecName: Full=30S ribosomal protein S6;
    1::103     2e-33  56%  124 aa  RS6_BURM9 RecName: Full=30S ribosomal protein S6;
    1::103     2e-33  56%  124 aa  RS6_BURM7 RecName: Full=30S ribosomal protein S6;
    1::103     2e-33  56%  124 aa  RS6_BURCJ RecName: Full=30S ribosomal protein S6;
    1::103     2e-33  56%  124 aa  RS6_BURCC RecName: Full=30S ribosomal protein S6;
    1::109     3e-33  55%  120 aa  RS6_DELAS RecName: Full=30S ribosomal protein S6;
    1::104     3e-33  53%  126 aa  RS6_COXBN RecName: Full=30S ribosomal protein S6;
    1::103     3e-33  56%  124 aa  RS6_BURP8 RecName: Full=30S ribosomal protein S6;
    1::111     3e-33  50%  125 aa  RS6_BAUCH RecName: Full=30S ribosomal protein S6;
    1::109     4e-33  53%  121 aa  RS6_POLNA RecName: Full=30S ribosomal protein S6;
    1::103     4e-33  56%  124 aa  RS6_BURS3 RecName: Full=30S ribosomal protein S6;
    1::103     4e-33  56%  124 aa  RS6_BURM1 RecName: Full=30S ribosomal protein S6;
    1::109     5e-33  54%  121 aa  RS6_RHOFD RecName: Full=30S ribosomal protein S6;
    1::107     5e-33  51%  131 aa  RS6_KLEP7 RecName: Full=30S ribosomal protein S6;
    1::107     5e-33  51%  131 aa  RS6_KLEP3 RecName: Full=30S ribosomal protein S6;
    1::103     5e-33  56%  124 aa  RS6_BURVG RecName: Full=30S ribosomal protein S6;
    1::103     5e-33  56%  124 aa  RS6_BURCM RecName: Full=30S ribosomal protein S6;
    1::103     5e-33  56%  124 aa  RS6_BURCH RecName: Full=30S ribosomal protein S6;
    1::103     5e-33  56%  124 aa  RS6_BURCA RecName: Full=30S ribosomal protein S6;
    1::103     5e-33  56%  124 aa  RS6_BURA4 RecName: Full=30S ribosomal protein S6;
    1::105     9e-33  54%  121 aa  RS6_POLSJ RecName: Full=30S ribosomal protein S6;
    1::108     9e-33  54%  112 aa  RS6_LEGPL RecName: Full=30S ribosomal protein S6;
    1::108     9e-33  54%  112 aa  RS6_LEGPH RecName: Full=30S ribosomal protein S6;
    1::108     9e-33  54%  112 aa  RS6_LEGPC RecName: Full=30S ribosomal protein S6;
    1::108     9e-33  54%  112 aa  RS6_LEGPA RecName: Full=30S ribosomal protein S6;
    3::110     2e-32  56%  143 aa  RS6_XANC5 RecName: Full=30S ribosomal protein S6;
    3::110     2e-32  56%  143 aa  RS6_XANAC RecName: Full=30S ribosomal protein S6;
    1::103     2e-32  57%  122 aa  RS6_NEIMB RecName: Full=30S ribosomal protein S6;
    1::109     2e-32  54%  125 aa  RS6_ACIAC RecName: Full=30S ribosomal protein S6;
    1::105     3e-32  54%  124 aa  RS6_VARPS RecName: Full=30S ribosomal protein S6;
    1::97      3e-32  55%  133 aa  RS6_PSYIN RecName: Full=30S ribosomal protein S6;
    1::103     3e-32  56%  122 aa  RS6_NEIMF RecName: Full=30S ribosomal protein S6;
    1::103     3e-32  56%  122 aa  RS6_NEIMA RecName: Full=30S ribosomal protein S6;
    1::103     3e-32  56%  122 aa  RS6_NEIM0 RecName: Full=30S ribosomal protein S6;
    1::109     4e-32  52%  121 aa  RS6_LEPCP RecName: Full=30S ribosomal protein S6;
    3::110     6e-32  56%  144 aa  RS6_XANCP RecName: Full=30S ribosomal protein S6;
    3::110     6e-32  56%  144 aa  RS6_XANCB RecName: Full=30S ribosomal protein S6;
    3::110     6e-32  56%  144 aa  RS6_XANC8 RecName: Full=30S ribosomal protein S6;
    3::110     8e-32  55%  143 aa  RS6_XANOR RecName: Full=30S ribosomal protein S6;
    3::110     8e-32  55%  143 aa  RS6_XANOP RecName: Full=30S ribosomal protein S6;
    3::110     8e-32  55%  143 aa  RS6_XANOM RecName: Full=30S ribosomal protein S6;
    1::102     8e-32  55%  139 aa  RS6_SHESH RecName: Full=30S ribosomal protein S6;
    3::106     1e-31  57%  143 aa  RS6_XYLFM RecName: Full=30S ribosomal protein S6;
    1::102     1e-31  55%  128 aa  RS6_ACIAD RecName: Full=30S ribosomal protein S6;
    1::109     1e-31  52%  125 aa  RS6_DIAST RecName: Full=30S ribosomal protein S6;
    1::109     1e-31  52%  125 aa  RS6_ACISJ RecName: Full=30S ribosomal protein S6;
    3::106     2e-31  57%  143 aa  RS6_XYLFT RecName: Full=30S ribosomal protein S6;
    3::106     2e-31  57%  143 aa  RS6_XYLFA RecName: Full=30S ribosomal protein S6;
    3::106     2e-31  57%  143 aa  RS6_XYLF2 RecName: Full=30S ribosomal protein S6;
    1::100     2e-31  53%  113 aa  RS6_BUCAP RecName: Full=30S ribosomal protein S6;
    1::105     7e-31  53%  137 aa  RS6_SHEPA RecName: Full=30S ribosomal protein S6;
    1::105     7e-31  53%  137 aa  RS6_SHEHH RecName: Full=30S ribosomal protein S6;
    1::105     1e-30  50%  129 aa  RS6_AERS4 RecName: Full=30S ribosomal protein S6;
    1::102     4e-29  49%  119 aa  RS6_BUCBP RecName: Full=30S ribosomal protein S6;
    1::108     4e-29  46%  117 aa  RS6_BLOPB RecName: Full=30S ribosomal protein S6;
    1::100     1e-28  50%  113 aa  RS6_BUCAT RecName: Full=30S ribosomal protein S6;
    1::100     1e-28  50%  113 aa  RS6_BUCAI RecName: Full=30S ribosomal protein S6;
    1::100     1e-28  50%  113 aa  RS6_BUCA5 RecName: Full=30S ribosomal protein S6;
    1::109     2e-26  48%  113 aa  RS6_WIGBR RecName: Full=30S ribosomal protein S6;
    1::107     1e-21  42%  120 aa  RS6_BLOFL RecName: Full=30S ribosomal protein S6;
    1::105     1e-19  41%  134 aa  RS6_METNO RecName: Full=30S ribosomal protein S6;
    1::105     2e-19  39%  149 aa  RS6_RHISN RecName: Full=30S ribosomal protein S6;
    1::105     2e-19  39%  153 aa  RS6_AGRVS RecName: Full=30S ribosomal protein S6;
    1::105     3e-19  38%  155 aa  RS6_RHILW RecName: Full=30S ribosomal protein S6;
    1::105     3e-19  38%  155 aa  RS6_RHIL3 RecName: Full=30S ribosomal protein S6;
    1::105     3e-19  38%  154 aa  RS6_METRJ RecName: Full=30S ribosomal protein S6;
    1::105     3e-19  39%  149 aa  RS6_RHIME RecName: Full=30S ribosomal protein S6;
    1::105     5e-19  38%  152 aa  RS6_RHIE6 RecName: Full=30S ribosomal protein S6;
    1::110     5e-19  39%  136 aa  RS6_BARBK RecName: Full=30S ribosomal protein S6;
    1::105     5e-19  38%  150 aa  RS6_AGRRK RecName: Full=30S ribosomal protein S6;
    1::105     6e-19  39%  145 aa  RS6_SINMW RecName: Full=30S ribosomal protein S6;
    1::105     6e-19  38%  152 aa  RS6_RHIEC RecName: Full=30S ribosomal protein S6;
    1::105     8e-19  38%  153 aa  RS6_AGRT5 RecName: Full=30S ribosomal protein S6;
    1::105     1e-18  40%  134 aa  RS6_METS4 RecName: Full=30S ribosomal protein S6;
    1::104     4e-18  40%  135 aa  RS6_BART1 RecName: Full=30S ribosomal protein S6;
    1::104     1e-17  38%  151 aa  RS6_OCHA4 RecName: Full=30S ribosomal protein S6;
    1::103     2e-17  40%  135 aa  RS6_BARHE RecName: Full=30S ribosomal protein S6;
    1::105     2e-17  36%  151 aa  RS6_METPB RecName: Full=30S ribosomal protein S6;
    1::109     6e-17  34%  166 aa  RS6_RHILO RecName: Full=30S ribosomal protein S6;
    1::105     6e-17  35%  151 aa  RS6_METEP RecName: Full=30S ribosomal protein S6;
    1::105     6e-17  35%  151 aa  RS6_METC4 RecName: Full=30S ribosomal protein S6;
    2::92      6e-17  32%   96 aa  RS6_CARHZ RecName: Full=30S ribosomal protein S6;
    1::105     7e-17  36%  148 aa  RS6_MESSB RecName: Full=30S ribosomal protein S6;
    1::104     7e-17  37%  148 aa  RS6_BRUSU RecName: Full=30S ribosomal protein S6;
    1::104     7e-17  37%  148 aa  RS6_BRUSI RecName: Full=30S ribosomal protein S6;
    1::104     7e-17  37%  148 aa  RS6_BRUMB RecName: Full=30S ribosomal protein S6;
    1::104     7e-17  37%  148 aa  RS6_BRUC2 RecName: Full=30S ribosomal protein S6;
    1::104     7e-17  37%  148 aa  RS6_BRUAB RecName: Full=30S ribosomal protein S6;
    1::104     7e-17  37%  148 aa  RS6_BRUA2 RecName: Full=30S ribosomal protein S6;
    1::104     7e-17  37%  148 aa  RS6_BRUA1 RecName: Full=30S ribosomal protein S6;
    1::95      1e-16  38%  127 aa  RS6_BUCCC RecName: Full=30S ribosomal protein S6;
    1::103     1e-16  37%  136 aa  RS6_BARQU RecName: Full=30S ribosomal protein S6;
    1::107     2e-16  37%  160 aa  RS6_RHORT RecName: Full=30S ribosomal protein S6;
    1::106     2e-16  34%  155 aa  RS6_PARL1 RecName: Full=30S ribosomal protein S6;
    1::93      2e-16  38%   96 aa  RS6_CORA7 RecName: Full=30S ribosomal protein S6;
    1::105     2e-16  33%  150 aa  RS6_AZOC5 RecName: Full=30S ribosomal protein S6;
    1::104     4e-16  36%  148 aa  RS6_BRUME RecName: Full=30S ribosomal protein S6;
    1::95      5e-16  34%   95 aa  RS6_THETN RecName: Full=30S ribosomal protein S6;
    1::106     6e-16  35%  144 aa  RS6_MAGSA RecName: Full=30S ribosomal protein S6;
    1::104     8e-16  38%  144 aa  RS6_OLICO RecName: Full=30S ribosomal protein S6;
    1::91      8e-16  33%   95 aa  RS6_CLONN RecName: Full=30S ribosomal protein S6;
    1::108     2e-15  32%  117 aa  RS6_MARMM RecName: Full=30S ribosomal protein S6;
    1::104     2e-15  37%  146 aa  RS6_METSB RecName: Full=30S ribosomal protein S6;
    1::104     2e-15  35%  166 aa  RS6_BRAJA RecName: Full=30S ribosomal protein S6;
    1::109     4e-15  32%  112 aa  RS6_HYPNA RecName: Full=30S ribosomal protein S6;
    1::104     4e-15  35%  153 aa  RS6_BRASO RecName: Full=30S ribosomal protein S6;
    1::104     5e-15  34%  124 aa  RS6_ZYMMO RecName: Full=30S ribosomal protein S6;
    1::95      5e-15  34%   95 aa  RS6_THEPX RecName: Full=30S ribosomal protein S6;
    1::95      5e-15  34%   95 aa  RS6_THEP3 RecName: Full=30S ribosomal protein S6;
    1::95      5e-15  32%   95 aa  RS6_DESRM RecName: Full=30S ribosomal protein S6;
    1::105     7e-15  33%  152 aa  RS6_XANP2 RecName: Full=30S ribosomal protein S6;
    1::104     7e-15  35%  153 aa  RS6_BRASB RecName: Full=30S ribosomal protein S6;
    1::104     9e-15  36%  158 aa  RS6_RHOPT RecName: Full=30S ribosomal protein S6;
    1::104     9e-15  36%  158 aa  RS6_RHOPA RecName: Full=30S ribosomal protein S6;AltName:
    1::104     1e-14  37%  159 aa  RS6_RHOP2 RecName: Full=30S ribosomal protein S6;
    1::104     2e-14  36%  160 aa  RS6_RHOPS RecName: Full=30S ribosomal protein S6;
    1::93      2e-14  33%   95 aa  RS6_CORK4 RecName: Full=30S ribosomal protein S6;
    1::104     2e-14  36%  157 aa  RS6_RHOP5 RecName: Full=30S ribosomal protein S6;
    1::104     2e-14  35%  160 aa  RS6_GLUOX RecName: Full=30S ribosomal protein S6;
    1::104     2e-14  36%  151 aa  RS6_BEII9 RecName: Full=30S ribosomal protein S6;
    1::91      3e-14  33%   95 aa  RS6_CORDI RecName: Full=30S ribosomal protein S6;
    1::104     4e-14  35%  168 aa  RS6_RHOPB RecName: Full=30S ribosomal protein S6;
    1::104     4e-14  35%  147 aa  RS6_NITHX RecName: Full=30S ribosomal protein S6;
    8::93      4e-14  41%  152 aa  RS6_BDEBA RecName: Full=30S ribosomal protein S6;
    1::109     6e-14  31%  163 aa  RS6_RHOCS RecName: Full=30S ribosomal protein S6;
   29::108     6e-14  39%  120 aa  RS6_NOVAD RecName: Full=30S ribosomal protein S6;
    1::91      6e-14  31%   95 aa  RS6_GEOSW RecName: Full=30S ribosomal protein S6;
    1::99      6e-14  30%  101 aa  RS6_DESVM RecName: Full=30S ribosomal protein S6;
    1::91      7e-14  32%   94 aa  RS6_CLOBM RecName: Full=30S ribosomal protein S6;
    1::91      7e-14  32%   94 aa  RS6_CLOBH RecName: Full=30S ribosomal protein S6;
    1::91      7e-14  32%   94 aa  RS6_CLOB1 RecName: Full=30S ribosomal protein S6;
    1::104     1e-13  34%  139 aa  RS6_NITWN RecName: Full=30S ribosomal protein S6;
    1::105     1e-13  29%  155 aa  RS6_DESAH RecName: Full=30S ribosomal protein S6;
    1::91      1e-13  32%   94 aa  RS6_CLOBL RecName: Full=30S ribosomal protein S6;
    1::91      1e-13  32%   94 aa  RS6_CLOBK RecName: Full=30S ribosomal protein S6;
    1::91      1e-13  32%   94 aa  RS6_CLOBJ RecName: Full=30S ribosomal protein S6;
    1::112     2e-13  34%  154 aa  RS6_GRABC RecName: Full=30S ribosomal protein S6;
    1::91      2e-13  33%   95 aa  RS6_CORJK RecName: Full=30S ribosomal protein S6;
    1::95      2e-13  30%   98 aa  RS6_MOOTA RecName: Full=30S ribosomal protein S6;
    1::95      2e-13  28%   95 aa  RS6_GEOKA RecName: Full=30S ribosomal protein S6;
    1::104     2e-13  35%  126 aa  RS6_CAUCR RecName: Full=30S ribosomal protein S6;
    1::104     2e-13  35%  126 aa  RS6_CAUCN RecName: Full=30S ribosomal protein S6;
    1::95      4e-13  28%   95 aa  RS6_PELTS RecName: Full=30S ribosomal protein S6;
    1::110     4e-13  31%  161 aa  RS6_GLUDA RecName: Full=30S ribosomal protein S6;
    1::104     4e-13  34%  126 aa  RS6_CAUSK RecName: Full=30S ribosomal protein S6;
    1::105     5e-13  30%  117 aa  RS6_SILST RecName: Full=30S ribosomal protein S6;
    1::87      5e-13  29%  115 aa  RS6_PELCD RecName: Full=30S ribosomal protein S6;
    1::95      5e-13  29%   95 aa  RS6_CLOPS RecName: Full=30S ribosomal protein S6;
    1::95      5e-13  29%   95 aa  RS6_CLOPE RecName: Full=30S ribosomal protein S6;
    1::95      5e-13  29%   95 aa  RS6_CLOP1 RecName: Full=30S ribosomal protein S6;
    1::91      5e-13  31%   94 aa  RS6_CLOB6 RecName: Full=30S ribosomal protein S6;
    4::93      8e-13  33%  114 aa  RS6_THEEB RecName: Full=30S ribosomal protein S6;
    1::110     8e-13  32%  121 aa  RS6_RICTY RecName: Full=30S ribosomal protein S6;
    1::105     8e-13  33%  131 aa  RS6_PARDP RecName: Full=30S ribosomal protein S6;
    1::91      1e-12  30%   95 aa  RS6_CLOB8 RecName: Full=30S ribosomal protein S6;
    1::95      1e-12  29%   95 aa  RS6_CLOAB RecName: Full=30S ribosomal protein S6;
    1::110     1e-12  32%  121 aa  RS6_RICPR RecName: Full=30S ribosomal protein S6;
    1::95      1e-12  28%   96 aa  RS6_HELMI RecName: Full=30S ribosomal protein S6;
    1::91      1e-12  27%   95 aa  RS6_BREBN RecName: Full=30S ribosomal protein S6;
    1::95      1e-12  28%   96 aa  RS6_BACWK RecName: Full=30S ribosomal protein S6;
    1::95      1e-12  28%   96 aa  RS6_BACHK RecName: Full=30S ribosomal protein S6;
    1::95      1e-12  28%   96 aa  RS6_BACCZ RecName: Full=30S ribosomal protein S6;
    1::95      1e-12  28%   96 aa  RS6_BACCR RecName: Full=30S ribosomal protein S6;
    1::95      1e-12  28%   96 aa  RS6_BACCQ RecName: Full=30S ribosomal protein S6;
    1::95      1e-12  28%   96 aa  RS6_BACC7 RecName: Full=30S ribosomal protein S6;
    1::95      1e-12  28%   96 aa  RS6_BACC4 RecName: Full=30S ribosomal protein S6;
    1::95      1e-12  28%   96 aa  RS6_BACC3 RecName: Full=30S ribosomal protein S6;
    1::95      1e-12  28%   96 aa  RS6_BACC1 RecName: Full=30S ribosomal protein S6;
    1::95      1e-12  28%   96 aa  RS6_BACC0 RecName: Full=30S ribosomal protein S6;
    1::95      1e-12  28%   96 aa  RS6_BACAN RecName: Full=30S ribosomal protein S6;
    1::95      1e-12  28%   96 aa  RS6_BACAC RecName: Full=30S ribosomal protein S6;
    1::95      1e-12  28%   96 aa  RS6_BACAA RecName: Full=30S ribosomal protein S6;
    1::105     2e-12  29%  117 aa  RS6_SILPO RecName: Full=30S ribosomal protein S6;
    1::97      2e-12  32%  185 aa  RS6_DESAA RecName: Full=30S ribosomal protein S6;
    1::91      2e-12  30%   95 aa  RS6_CLOK5 RecName: Full=30S ribosomal protein S6;
    1::91      2e-12  30%   95 aa  RS6_CLOK1 RecName: Full=30S ribosomal protein S6;
    1::95      2e-12  27%   95 aa  RS6_BACHD RecName: Full=30S ribosomal protein S6;
    1::95      2e-12  28%   96 aa  RS6_BACC2 RecName: Full=30S ribosomal protein S6;
    1::91      2e-12  27%   96 aa  RS6_STRCO RecName: Full=30S ribosomal protein S6;
    1::91      2e-12  32%   96 aa  RS6_PROAC RecName: Full=30S ribosomal protein S6;
    1::95      2e-12  32%  101 aa  RS6_MICLC RecName: Full=30S ribosomal protein S6;
    1::91      3e-12  28%   96 aa  RS6_STRGG RecName: Full=30S ribosomal protein S6;
    1::105     3e-12  30%  117 aa  RS6_ROSDO RecName: Full=30S ribosomal protein S6;
    1::111     3e-12  31%  128 aa  RS6_NITSB RecName: Full=30S ribosomal protein S6;
    1::104     4e-12  36%  122 aa  RS6_SPHAL RecName: Full=30S ribosomal protein S6;
    1::110     4e-12  31%  121 aa  RS6_RICCK RecName: Full=30S ribosomal protein S6;
    1::91      5e-12  27%   96 aa  RS6_STRAW RecName: Full=30S ribosomal protein S6;
    1::91      5e-12  31%   96 aa  RS6_SALAI RecName: Full=30S ribosomal protein S6;
    1::110     5e-12  31%  121 aa  RS6_RICRS RecName: Full=30S ribosomal protein S6;
    1::110     5e-12  31%  121 aa  RS6_RICPU RecName: Full=30S ribosomal protein S6;
    1::110     5e-12  31%  121 aa  RS6_RICFE RecName: Full=30S ribosomal protein S6;
    1::110     5e-12  31%  121 aa  RS6_RICCN RecName: Full=30S ribosomal protein S6;
    1::96      5e-12  32%   96 aa  RS6_NATTJ RecName: Full=30S ribosomal protein S6;
    1::105     5e-12  28%  117 aa  RS6_DINSH RecName: Full=30S ribosomal protein S6;
    1::91      5e-12  32%   94 aa  RS6_DESAP RecName: Full=30S ribosomal protein S6;
    1::95      5e-12  28%   95 aa  RS6_BACLD RecName: Full=30S ribosomal protein S6;
    1::95      5e-12  27%   95 aa  RS6_BACCN RecName: Full=30S ribosomal protein S6;
    1::90      5e-12  33%   94 aa  RS6_ALKOO RecName: Full=30S ribosomal protein S6;
    1::91      5e-12  27%   96 aa  RS6_ACIC1 RecName: Full=30S ribosomal protein S6;
    1::105     7e-12  28%  135 aa  RS6_RHOSK RecName: Full=30S ribosomal protein S6;
    1::105     7e-12  28%  132 aa  RS6_RHOS4 RecName: Full=30S ribosomal protein S6;
    1::105     7e-12  28%  135 aa  RS6_RHOS1 RecName: Full=30S ribosomal protein S6;
    1::91      7e-12  31%   95 aa  RS6_NOCFA RecName: Full=30S ribosomal protein S6;
    1::89      7e-12  28%   95 aa  RS6_EXISA RecName: Full=30S ribosomal protein S6;
    1::99      7e-12  28%  101 aa  RS6_DESVV RecName: Full=30S ribosomal protein S6;
    1::99      7e-12  28%  101 aa  RS6_DESVH RecName: Full=30S ribosomal protein S6;
    1::113     7e-12  31%  114 aa  RS6_BACFR RecName: Full=30S ribosomal protein S6;
    1::113     7e-12  31%  114 aa  RS6_BACFN RecName: Full=30S ribosomal protein S6;
    1::96      9e-12  32%   98 aa  RS6_STACT RecName: Full=30S ribosomal protein S6;
    1::91      9e-12  31%   96 aa  RS6_SALTO RecName: Full=30S ribosomal protein S6;
    1::87      9e-12  34%  129 aa  RS6_PELPD RecName: Full=30S ribosomal protein S6;
    1::113     9e-12  31%  114 aa  RS6_BACTN RecName: Full=30S ribosomal protein S6;
    1::105     1e-11  28%  132 aa  RS6_RHOS5 RecName: Full=30S ribosomal protein S6;
    1::97      1e-11  26%  102 aa  RS6_DESDA RecName: Full=30S ribosomal protein S6;
    3::92      1e-11  33%  176 aa  RS6_CYAP7 RecName: Full=30S ribosomal protein S6;
    1::91      1e-11  34%  145 aa  RS6_CAMHC RecName: Full=30S ribosomal protein S6;
    1::89      1e-11  34%  114 aa  RS6_BACV8 RecName: Full=30S ribosomal protein S6;
    1::95      1e-11  31%  101 aa  RS6_ARTCA RecName: Full=30S ribosomal protein S6;
    5::98      1e-11  30%  108 aa  RS6_ANAVT RecName: Full=30S ribosomal protein S6;
    5::98      1e-11  30%  108 aa  RS6_ANASP RecName: Full=30S ribosomal protein S6;
    5::96      2e-11  31%  153 aa  RS6_SOLUE RecName: Full=30S ribosomal protein S6;
    1::95      2e-11  27%  101 aa  RS6_KOCRD RecName: Full=30S ribosomal protein S6;
    1::91      2e-11  24%  102 aa  RS6_DESMR RecName: Full=30S ribosomal protein S6;
    1::105     2e-11  31%  144 aa  RS6_RHOCA RecName: Full=30S ribosomal protein S6;
    2::88      2e-11  33%  117 aa  RS6_GEOSL RecName: Full=30S ribosomal protein S6;
    1::90      2e-11  28%   92 aa  RS6_CLOD6 RecName: Full=30S ribosomal protein S6;
    1::89      3e-11  33%  117 aa  RS6_PORGI RecName: Full=30S ribosomal protein S6;
    1::89      3e-11  33%  117 aa  RS6_PORG3 RecName: Full=30S ribosomal protein S6;
    3::92      3e-11  31%  119 aa  RS6_CYAA5 RecName: Full=30S ribosomal protein S6;
    1::95      3e-11  30%  101 aa  RS6_ARTS2 RecName: Full=30S ribosomal protein S6;
    1::95      3e-11  30%  101 aa  RS6_ARTAT RecName: Full=30S ribosomal protein S6;
    7::103     3e-11  34%  110 aa  RS6_AQUAE RecName: Full=30S ribosomal protein S6;
    1::95      3e-11  27%   95 aa  RS6_OCEIH RecName: Full=30S ribosomal protein S6;
    1::105     3e-11  29%  117 aa  RS6_JANSC RecName: Full=30S ribosomal protein S6;
    1::110     5e-11  29%  120 aa  RS6_RICBR RecName: Full=30S ribosomal protein S6;
    1::110     5e-11  29%  120 aa  RS6_RICB8 RecName: Full=30S ribosomal protein S6;
    1::91      5e-11  29%  122 aa  RS6_GEOLS RecName: Full=30S ribosomal protein S6;
    1::91      6e-11  30%   95 aa  RS6_RHOSR RecName: Full=30S ribosomal protein S6;
    1::91      6e-11  30%   95 aa  RS6_RHOOB RecName: Full=30S ribosomal protein S6;
    5::88      6e-11  33%  134 aa  RS6_GEOBB RecName: Full=30S ribosomal protein S6;
    1::94      6e-11  29%   95 aa  RS6_FINM2 RecName: Full=30S ribosomal protein S6;
    1::93      8e-11  28%   96 aa  RS6_MYCTU RecName: Full=30S ribosomal protein S6;
    1::93      8e-11  28%   96 aa  RS6_MYCTA RecName: Full=30S ribosomal protein S6;
    1::93      8e-11  28%   96 aa  RS6_MYCBT RecName: Full=30S ribosomal protein S6;
    1::93      8e-11  28%   96 aa  RS6_MYCBP RecName: Full=30S ribosomal protein S6;
    1::93      8e-11  28%   96 aa  RS6_MYCBO RecName: Full=30S ribosomal protein S6;
    4::102     8e-11  26%  129 aa  RS6_MICAN RecName: Full=30S ribosomal protein S6;
    1::96      1e-10  30%  101 aa  RS6_STAS1 RecName: Full=30S ribosomal protein S6;
    5::88      1e-10  31%  134 aa  RS6_GEOSM RecName: Full=30S ribosomal protein S6;
    1::74      1e-10  30%   95 aa  RS6_CORU7 RecName: Full=30S ribosomal protein S6;
    1::91      1e-10  30%   96 aa  RS6_BEUC1 RecName: Full=30S ribosomal protein S6;
    1::91      1e-10  27%   95 aa  RS6_BACP2 RecName: Full=30S ribosomal protein S6;
    1::95      1e-10  27%   95 aa  RS6_BACA2 RecName: Full=30S ribosomal protein S6;
    1::101     1e-10  29%  158 aa  RS6_ACICJ RecName: Full=30S ribosomal protein S6;
    4::95      1e-10  33%   96 aa  RR6_GUITH RecName: Full=30S ribosomal protein S6, chloroplastic;
    1::95      1e-10  26%   95 aa  RS6_BACSU RecName: Full=30S ribosomal protein S6;AltName:
    1::91      2e-10  27%  147 aa  RS6_SYNFM RecName: Full=30S ribosomal protein S6;
    1::92      2e-10  30%   98 aa  RS6_STAES RecName: Full=30S ribosomal protein S6;
    1::92      2e-10  30%   98 aa  RS6_STAEQ RecName: Full=30S ribosomal protein S6;
    1::93      2e-10  28%   96 aa  RS6_MYCPA RecName: Full=30S ribosomal protein S6;
    1::89      2e-10  30%   95 aa  RS6_DESHY RecName: Full=30S ribosomal protein S6;
    1::89      2e-10  30%   95 aa  RS6_DESHD RecName: Full=30S ribosomal protein S6;
    1::91      2e-10  28%   96 aa  RS6_NOCSJ RecName: Full=30S ribosomal protein S6;
    5::96      2e-10  26%   96 aa  RS6_GLOVI RecName: Full=30S ribosomal protein S6;
    5::100     2e-10  27%  124 aa  RS6_CYAP8 RecName: Full=30S ribosomal protein S6;
    1::94      2e-10  29%   94 aa  RS6_ALKMQ RecName: Full=30S ribosomal protein S6;
    1::83      3e-10  30%  118 aa  RS6_SACEN RecName: Full=30S ribosomal protein S6;
    5::100     3e-10  28%  106 aa  RS6_CYAP4 RecName: Full=30S ribosomal protein S6;
    1::91      4e-10  29%   95 aa  RS6_RHOE4 RecName: Full=30S ribosomal protein S6;
    1::93      4e-10  28%   96 aa  RS6_MYCLE RecName: Full=30S ribosomal protein S6;
    1::91      4e-10  28%   94 aa  RS6_FUSNN RecName: Full=30S ribosomal protein S6;
    1::95      5e-10  31%  101 aa  RS6_THETH RecName: Full=30S ribosomal protein S6;AltName:
    1::95      5e-10  31%  101 aa  RS6_THET8 RecName: Full=30S ribosomal protein S6;AltName:
    1::95      5e-10  31%  101 aa  RS6_THET2 RecName: Full=30S ribosomal protein S6;
    1::91      5e-10  29%  125 aa  RS6_CAMJJ RecName: Full=30S ribosomal protein S6;
    1::91      5e-10  29%  125 aa  RS6_CAMJD RecName: Full=30S ribosomal protein S6;
    1::91      5e-10  29%  125 aa  RS6_CAMJ8 RecName: Full=30S ribosomal protein S6;
    1::92      7e-10  29%   98 aa  RS6_STAHJ RecName: Full=30S ribosomal protein S6;
    1::87      7e-10  30%  128 aa  RS6_GEOSF RecName: Full=30S ribosomal protein S6;
    1::99      7e-10  31%  113 aa  RS6_FLAPJ RecName: Full=30S ribosomal protein S6;
   18::108     7e-10  24%  109 aa  RS6_EHRCJ RecName: Full=30S ribosomal protein S6;
    1::91      9e-10  27%   96 aa  RS6_THEFY RecName: Full=30S ribosomal protein S6;
    1::91      9e-10  28%  128 aa  RS6_LEIXX RecName: Full=30S ribosomal protein S6;
    1::91      9e-10  30%  128 aa  RS6_CAMFF RecName: Full=30S ribosomal protein S6;
    1::90      9e-10  26%   95 aa  RS6_BACSK RecName: Full=30S ribosomal protein S6;
    6::103     1e-09  28%  154 aa  RS6_PROMP RecName: Full=30S ribosomal protein S6;
    5::102     1e-09  32%  134 aa  RS6_PELPB RecName: Full=30S ribosomal protein S6;
    1::90      1e-09  25%   95 aa  RS6_EXIS2 RecName: Full=30S ribosomal protein S6;
    1::95      1e-09  29%  168 aa  RS6_DESOH RecName: Full=30S ribosomal protein S6;
    1::116     1e-09  27%  124 aa  RS6_CAMLR RecName: Full=30S ribosomal protein S6;
    6::106     1e-09  27%  126 aa  RS6_SYNS9 RecName: Full=30S ribosomal protein S6;
    1::96      1e-09  28%   98 aa  RS6_STAAW RecName: Full=30S ribosomal protein S6;
    1::96      1e-09  28%   98 aa  RS6_STAAT RecName: Full=30S ribosomal protein S6;
    1::96      1e-09  28%   98 aa  RS6_STAAS RecName: Full=30S ribosomal protein S6;
    1::96      1e-09  28%   98 aa  RS6_STAAR RecName: Full=30S ribosomal protein S6;
    1::96      1e-09  28%   98 aa  RS6_STAAN RecName: Full=30S ribosomal protein S6;
    1::96      1e-09  28%   98 aa  RS6_STAAM RecName: Full=30S ribosomal protein S6;
    1::96      1e-09  28%   98 aa  RS6_STAAE RecName: Full=30S ribosomal protein S6;
    1::96      1e-09  28%   98 aa  RS6_STAAC RecName: Full=30S ribosomal protein S6;
    1::96      1e-09  28%   98 aa  RS6_STAAB RecName: Full=30S ribosomal protein S6;
    1::96      1e-09  28%   98 aa  RS6_STAA9 RecName: Full=30S ribosomal protein S6;
    1::96      1e-09  28%   98 aa  RS6_STAA8 RecName: Full=30S ribosomal protein S6;
    1::96      1e-09  28%   98 aa  RS6_STAA3 RecName: Full=30S ribosomal protein S6;
    1::96      1e-09  28%   98 aa  RS6_STAA2 RecName: Full=30S ribosomal protein S6;
    1::96      1e-09  28%   98 aa  RS6_STAA1 RecName: Full=30S ribosomal protein S6;
    1::93      1e-09  27%   96 aa  RS6_MYCA9 RecName: Full=30S ribosomal protein S6;
   14::108     1e-09  28%  109 aa  RS6_DEHE1 RecName: Full=30S ribosomal protein S6;
    1::95      2e-09  32%  121 aa  RS6_PELUB RecName: Full=30S ribosomal protein S6;
    4::92      2e-09  26%  116 aa  RS6_NOSP7 RecName: Full=30S ribosomal protein S6;
    2::61      2e-09  42%  118 aa  RS6_GEOMG RecName: Full=30S ribosomal protein S6;
   18::108     2e-09  24%  109 aa  RS6_EHRCR RecName: Full=30S ribosomal protein S6;
    1::99      2e-09  27%  101 aa  RS6_DESDG RecName: Full=30S ribosomal protein S6;
    5::102     2e-09  31%  133 aa  RS6_CHLPD RecName: Full=30S ribosomal protein S6;
    6::106     2e-09  27%  124 aa  RS6_SYNSC RecName: Full=30S ribosomal protein S6;
    5::94      2e-09  34%  133 aa  RS6_PROVI RecName: Full=30S ribosomal protein S6;
   14::108     2e-09  28%  109 aa  RS6_DEHSC RecName: Full=30S ribosomal protein S6;
    1::91      2e-09  28%  125 aa  RS6_CAMJR RecName: Full=30S ribosomal protein S6;
    3::96      2e-09  25%  141 aa  RS6_ACIC5 RecName: Full=30S ribosomal protein S6;
    1::95      3e-09  28%   95 aa  RS6_SYMTH RecName: Full=30S ribosomal protein S6;
    1::89      3e-09  31%  118 aa  RS6_PARD8 RecName: Full=30S ribosomal protein S6;
    3::93      3e-09  28%   97 aa  RS6_LISMO RecName: Full=30S ribosomal protein S6;
    3::93      3e-09  28%   97 aa  RS6_LISMH RecName: Full=30S ribosomal protein S6;
    3::93      3e-09  28%   97 aa  RS6_LISMF RecName: Full=30S ribosomal protein S6;
    3::93      3e-09  28%   97 aa  RS6_LISMC RecName: Full=30S ribosomal protein S6;
    1::73      3e-09  36%  112 aa  RS6_GRAFK RecName: Full=30S ribosomal protein S6;
   18::108     3e-09  23%  109 aa  RS6_EHRRW RecName: Full=30S ribosomal protein S6;
   18::108     3e-09  23%  109 aa  RS6_EHRRG RecName: Full=30S ribosomal protein S6;
    6::106     4e-09  26%  127 aa  RS6_SYNPX RecName: Full=30S ribosomal protein S6;
    3::93      4e-09  28%   97 aa  RS6_LISW6 RecName: Full=30S ribosomal protein S6;
    3::93      4e-09  28%   97 aa  RS6_LISIN RecName: Full=30S ribosomal protein S6;
    1::72      4e-09  38%   97 aa  RS6_DICTD RecName: Full=30S ribosomal protein S6;
    5::102     6e-09  31%  133 aa  RS6_PELLD RecName: Full=30S ribosomal protein S6;
    1::65      6e-09  38%  118 aa  RS6_ORITI RecName: Full=30S ribosomal protein S6;
    1::65      6e-09  38%  118 aa  RS6_ORITB RecName: Full=30S ribosomal protein S6;
    1::99      6e-09  29%  113 aa  RS6_FLAJ1 RecName: Full=30S ribosomal protein S6;
    6::93      7e-09  28%  113 aa  RS6_SYNY3 RecName: Full=30S ribosomal protein S6;
    6::94      7e-09  30%  172 aa  RS6_PROM4 RecName: Full=30S ribosomal protein S6;
    1::91      7e-09  31%  137 aa  RS6_HELHP RecName: Full=30S ribosomal protein S6;
    1::91      7e-09  27%  125 aa  RS6_CAMJE RecName: Full=30S ribosomal protein S6;
    6::106     9e-09  27%  123 aa  RS6_SYNPW RecName: Full=30S ribosomal protein S6;
    4::102     9e-09  29%  131 aa  RS6_CHLTE RecName: Full=30S ribosomal protein S6;
    1::91      9e-09  29%  142 aa  RS6_CAMC5 RecName: Full=30S ribosomal protein S6;
    6::105     1e-08  25%  121 aa  RS6_SYNS3 RecName: Full=30S ribosomal protein S6;
    1::110     1e-08  26%  112 aa  RS6_AZOPC RecName: Full=30S ribosomal protein S6;
    5::96      1e-08  26%  147 aa  RS6_ACIBL RecName: Full=30S ribosomal protein S6;
    1::92      2e-08  26%   96 aa  RS6_STRMU RecName: Full=30S ribosomal protein S6;
    6::110     2e-08  25%  152 aa  RS6_PROM9 RecName: Full=30S ribosomal protein S6;
    6::113     2e-08  24%  138 aa  RS6_PROM1 RecName: Full=30S ribosomal protein S6;
    5::102     2e-08  30%  134 aa  RS6_CHLPB RecName: Full=30S ribosomal protein S6;
    1::91      2e-08  29%  139 aa  RS6_CAMC1 RecName: Full=30S ribosomal protein S6;
    1::91      2e-08  30%  137 aa  RS6_WOLSU RecName: Full=30S ribosomal protein S6;
    5::93      2e-08  29%   96 aa  RS6_SYNJB RecName: Full=30S ribosomal protein S6;
    1::92      2e-08  26%   96 aa  RS6_STRSV RecName: Full=30S ribosomal protein S6;
    1::92      2e-08  26%   96 aa  RS6_STRGC RecName: Full=30S ribosomal protein S6;
    5::102     2e-08  31%  133 aa  RS6_CHLL2 RecName: Full=30S ribosomal protein S6;
    6::93      3e-08  24%  117 aa  RS6_TRIEI RecName: Full=30S ribosomal protein S6;
    6::94      3e-08  26%  135 aa  RS6_SYNR3 RecName: Full=30S ribosomal protein S6;
    4::92      3e-08  24%  115 aa  RS6_SYNP2 RecName: Full=30S ribosomal protein S6;
    5::101     3e-08  27%  107 aa  RS6_SYNE7 RecName: Full=30S ribosomal protein S6;
    6::94      3e-08  29%   98 aa  RS6_LACAC RecName: Full=30S ribosomal protein S6;
    1::112     3e-08  28%  142 aa  RS6_HELP2 RecName: Full=30S ribosomal protein S6;
    1::112     3e-08  27%  142 aa  RS6_HELAH RecName: Full=30S ribosomal protein S6;
    1::72      3e-08  35%   97 aa  RS6_DICT6 RecName: Full=30S ribosomal protein S6;
    1::92      4e-08  26%   96 aa  RS6_STRTD RecName: Full=30S ribosomal protein S6;
    1::92      4e-08  26%   96 aa  RS6_STRT2 RecName: Full=30S ribosomal protein S6;
    1::92      4e-08  26%   96 aa  RS6_STRT1 RecName: Full=30S ribosomal protein S6;
    6::98      4e-08  26%   98 aa  RS6_LACSS RecName: Full=30S ribosomal protein S6;
    6::98      4e-08  27%   98 aa  RS6_LACCB RecName: Full=30S ribosomal protein S6;
    6::98      4e-08  27%   98 aa  RS6_LACC3 RecName: Full=30S ribosomal protein S6;
    1::112     4e-08  28%  142 aa  RS6_HELPJ RecName: Full=30S ribosomal protein S6;
    1::92      5e-08  27%   96 aa  RS6_STRU0 RecName: Full=30S ribosomal protein S6;
    1::92      5e-08  27%   96 aa  RS6_STRS2 RecName: Full=30S ribosomal protein S6;
    1::92      5e-08  26%   95 aa  RS6_STRA5 RecName: Full=30S ribosomal protein S6;
    1::92      5e-08  26%   95 aa  RS6_STRA3 RecName: Full=30S ribosomal protein S6;
    1::92      5e-08  26%   95 aa  RS6_STRA1 RecName: Full=30S ribosomal protein S6;
    3::100     5e-08  30%  133 aa  RS6_CHLT3 RecName: Full=30S ribosomal protein S6;
   12::109     5e-08  30%  109 aa  RR6_PORYE RecName: Full=30S ribosomal protein S6, chloroplastic;
    1::92      6e-08  27%   96 aa  RS6_STRS7 RecName: Full=30S ribosomal protein S6;
    1::92      6e-08  26%   96 aa  RS6_STRPZ RecName: Full=30S ribosomal protein S6;
    1::92      6e-08  26%   96 aa  RS6_STRPM RecName: Full=30S ribosomal protein S6;
    1::92      6e-08  26%   96 aa  RS6_STRPG RecName: Full=30S ribosomal protein S6;
    1::92      6e-08  26%   96 aa  RS6_STRPD RecName: Full=30S ribosomal protein S6;
    1::92      6e-08  26%   96 aa  RS6_STRPC RecName: Full=30S ribosomal protein S6;
    1::92      6e-08  26%   96 aa  RS6_STRPB RecName: Full=30S ribosomal protein S6;
    1::92      6e-08  26%   96 aa  RS6_STRP8 RecName: Full=30S ribosomal protein S6;
    1::92      6e-08  26%   96 aa  RS6_STRP6 RecName: Full=30S ribosomal protein S6;
    1::92      6e-08  26%   96 aa  RS6_STRP3 RecName: Full=30S ribosomal protein S6;
    1::92      6e-08  26%   96 aa  RS6_STRP1 RecName: Full=30S ribosomal protein S6;
    1::92      6e-08  27%   96 aa  RS6_STRE4 RecName: Full=30S ribosomal protein S6;
    6::106     6e-08  23%  124 aa  RS6_PROMM RecName: Full=30S ribosomal protein S6;
    6::106     6e-08  23%  124 aa  RS6_PROM3 RecName: Full=30S ribosomal protein S6;
    1::93      6e-08  29%  146 aa  RS6_OENOB RecName: Full=30S ribosomal protein S6;
    1::87      6e-08  30%  144 aa  RS6_MAGSM RecName: Full=30S ribosomal protein S6;
    4::94      6e-08  26%   98 aa  RS6_LACRJ RecName: Full=30S ribosomal protein S6;
    4::94      6e-08  26%   98 aa  RS6_LACRD RecName: Full=30S ribosomal protein S6;
    5::99      6e-08  25%   99 aa  RS6_LACPL RecName: Full=30S ribosomal protein S6;
    1::112     6e-08  27%  142 aa  RS6_HELPY RecName: Full=30S ribosomal protein S6;
    1::60      6e-08  36%  128 aa  RS6_GEOUR RecName: Full=30S ribosomal protein S6;
    6::114     8e-08  26%  155 aa  RS6_PROM5 RecName: Full=30S ribosomal protein S6;
    1::93      8e-08  29%   97 aa  RS6_LACLA RecName: Full=30S ribosomal protein S6;
    1::112     8e-08  27%  142 aa  RS6_HELPH RecName: Full=30S ribosomal protein S6;
    1::112     8e-08  27%  142 aa  RS6_HELPG RecName: Full=30S ribosomal protein S6;
    1::92      1e-07  27%   96 aa  RS6_STREM RecName: Full=30S ribosomal protein S6;
    1::85      1e-07  33%  160 aa  RS6_MYCA5 RecName: Full=30S ribosomal protein S6;
    1::112     1e-07  27%  142 aa  RS6_HELPS RecName: Full=30S ribosomal protein S6;
    1::96      1e-07  27%   97 aa  RS6_SYNWW RecName: Full=30S ribosomal protein S6;
    5::101     1e-07  27%  107 aa  RS6_SYNP6 RecName: Full=30S ribosomal protein S6;
    1::92      1e-07  24%   96 aa  RS6_STRZT RecName: Full=30S ribosomal protein S6;
    1::92      1e-07  24%   96 aa  RS6_STRZP RecName: Full=30S ribosomal protein S6;
    1::92      1e-07  24%   96 aa  RS6_STRZJ RecName: Full=30S ribosomal protein S6;
    1::92      1e-07  24%   96 aa  RS6_STRR6 RecName: Full=30S ribosomal protein S6;
    1::92      1e-07  24%   96 aa  RS6_STRPS RecName: Full=30S ribosomal protein S6;
    1::92      1e-07  24%   96 aa  RS6_STRPN RecName: Full=30S ribosomal protein S6;
    1::92      1e-07  24%   96 aa  RS6_STRPJ RecName: Full=30S ribosomal protein S6;
    1::92      1e-07  24%   96 aa  RS6_STRPI RecName: Full=30S ribosomal protein S6;
    1::92      1e-07  24%   96 aa  RS6_STRP7 RecName: Full=30S ribosomal protein S6;
    1::92      1e-07  24%   96 aa  RS6_STRP2 RecName: Full=30S ribosomal protein S6;
   18::108     1e-07  24%  109 aa  RS6_ANAMM RecName: Full=30S ribosomal protein S6;
    1::112     2e-07  23%  137 aa  RS6_SULDN RecName: Full=30S ribosomal protein S6;
    6::94      2e-07  30%  210 aa  RS6_PROMA RecName: Full=30S ribosomal protein S6;
    1::93      2e-07  28%   97 aa  RS6_LACLS RecName: Full=30S ribosomal protein S6;
    1::93      2e-07  28%   97 aa  RS6_LACLM RecName: Full=30S ribosomal protein S6;
    6::94      2e-07  28%   98 aa  RS6_LACJO RecName: Full=30S ribosomal protein S6;
    7::96      2e-07  23%  100 aa  RS6_ENTFA RecName: Full=30S ribosomal protein S6;
    9::93      2e-07  30%  128 aa  RS6_THEMA RecName: Full=30S ribosomal protein S6;
    6::94      2e-07  26%  138 aa  RS6_PROMT RecName: Full=30S ribosomal protein S6;
    6::94      2e-07  26%   98 aa  RS6_LACGA RecName: Full=30S ribosomal protein S6;
    6::98      2e-07  24%   98 aa  RS6_LACBA RecName: Full=30S ribosomal protein S6;
    1::95      2e-07  22%   95 aa  RS6_ACHLI RecName: Full=30S ribosomal protein S6;
    9::93      3e-07  30%  128 aa  RS6_THEP1 RecName: Full=30S ribosomal protein S6;
    4::94      4e-07  25%   97 aa  RS6_LACF3 RecName: Full=30S ribosomal protein S6;
    4::120     4e-07  28%  131 aa  RS6_CHLP8 RecName: Full=30S ribosomal protein S6;
    1::93      5e-07  29%   93 aa  RS6_TREDE RecName: Full=30S ribosomal protein S6;
    6::94      5e-07  26%   98 aa  RS6_LACH4 RecName: Full=30S ribosomal protein S6;
    7::94      5e-07  24%   97 aa  RS6_BIFLO RecName: Full=30S ribosomal protein S6;
  162::257     7e-07  29%  260 aa  RS6_WOLTR RecName: Full=30S ribosomal protein S6;
    1::92      9e-07  23%   96 aa  RS6_STRP4 RecName: Full=30S ribosomal protein S6;
    1::91      9e-07  27%   94 aa  RS6_PHYMT RecName: Full=30S ribosomal protein S6;
   18::108     9e-07  22%  109 aa  RS6_ANAPZ RecName: Full=30S ribosomal protein S6;
   15::100     1e-06  29%  112 aa  RR6_PORPU RecName: Full=30S ribosomal protein S6, chloroplastic;
    1::95      2e-06  28%  104 aa  RS6_ELUMP RecName: Full=30S ribosomal protein S6;
    9::102     2e-06  27%  114 aa  RS6_PARUW RecName: Full=30S ribosomal protein S6;
   32::103     3e-06  29%  140 aa  RS6_RHOBA RecName: Full=30S ribosomal protein S6;
    1::88      3e-06  27%  119 aa  RS6_THEAB RecName: Full=30S ribosomal protein S6;
    2::107     3e-06  27%  290 aa  RS6_MESFL RecName: Full=30S ribosomal protein S6;
   33::93      4e-06  37%  128 aa  RS6_THESQ RecName: Full=30S ribosomal protein S6;
   33::93      4e-06  37%  127 aa  RS6_THENN RecName: Full=30S ribosomal protein S6;
    1::91      4e-06  26%   95 aa  RS6_CORGL RecName: Full=30S ribosomal protein S6;
    5::73      4e-06  41%  132 aa  RS6_CHLCH RecName: Full=30S ribosomal protein S6;
    1::91      6e-06  26%   95 aa  RS6_COREF RecName: Full=30S ribosomal protein S6;
    1::102     7e-06  29%  121 aa  RT06_CHICK RecName: Full=28S ribosomal protein S6, mitochondrial;  
    3::93      7e-06  23%  103 aa  RR6_GRATL RecName: Full=30S ribosomal protein S6, chloroplastic;
    2::88      1e-05  27%  208 aa  RS6_MYCGE RecName: Full=30S ribosomal protein S6;
    1::65      2e-05  28%  102 aa  RS6_DEIGD RecName: Full=30S ribosomal protein S6;
    1::85      2e-05  24%   94 aa  RS6_AKKM8 RecName: Full=30S ribosomal protein S6;
    1::91      3e-05  21%   93 aa  RS6_PHYAS RecName: Full=30S ribosomal protein S6;
    1::88      3e-05  24%  124 aa  RS6_FERNB RecName: Full=30S ribosomal protein S6;
   41::91      4e-05  25%  127 aa  RS6_SULNB RecName: Full=30S ribosomal protein S6;
    1::87      4e-05  27%   91 aa  RS6_LEPBP RecName: Full=30S ribosomal protein S6;
    1::87      4e-05  27%   91 aa  RS6_LEPBA RecName: Full=30S ribosomal protein S6;
   25::65      5e-05  37%   93 aa  RS6_TREPS RecName: Full=30S ribosomal protein S6;
   25::65      5e-05  37%   93 aa  RS6_TREPA RecName: Full=30S ribosomal protein S6;
    1::88      5e-05  26%  119 aa  RS6_THEM4 RecName: Full=30S ribosomal protein S6;
   35::96      6e-05  27%  112 aa  RS6_CHLPN RecName: Full=30S ribosomal protein S6;
   37::87      8e-05  37%   91 aa  RS6_LEPBL RecName: Full=30S ribosomal protein S6;
   37::87      8e-05  37%   91 aa  RS6_LEPBJ RecName: Full=30S ribosomal protein S6;
   17::61      8e-05  42%  105 aa  RS6_LAWIP RecName: Full=30S ribosomal protein S6;
    1::90      1e-04  28%  160 aa  RS6_UREU1 RecName: Full=30S ribosomal protein S6;
    1::66      1e-04  26%  102 aa  RS6_DEIRA RecName: Full=30S ribosomal protein S6;
    5::93      1e-04  25%   96 aa  RS6_SYNJA RecName: Full=30S ribosomal protein S6;
    1::86      1e-04  31%  145 aa  RS6_MYCAP RecName: Full=30S ribosomal protein S6;
   28::105     1e-04  28%  112 aa  RS6_CHLMU RecName: Full=30S ribosomal protein S6;
   11::103     1e-04  30%  103 aa  RR6_CYACA RecName: Full=30S ribosomal protein S6, chloroplastic;
    1::90      2e-04  29%  145 aa  RS6_MYCPE RecName: Full=30S ribosomal protein S6;
   37::87      2e-04  35%   91 aa  RS6_LEPIN RecName: Full=30S ribosomal protein S6;
   37::87      2e-04  35%   91 aa  RS6_LEPIC RecName: Full=30S ribosomal protein S6;
   28::105     2e-04  28%  112 aa  RS6_CHLTR RecName: Full=30S ribosomal protein S6;
   28::105     2e-04  28%  112 aa  RS6_CHLTB RecName: Full=30S ribosomal protein S6;
   28::105     2e-04  28%  112 aa  RS6_CHLTA RecName: Full=30S ribosomal protein S6;
   28::105     2e-04  28%  112 aa  RS6_CHLT2 RecName: Full=30S ribosomal protein S6;
   28::103     2e-04  30%  112 aa  RS6_CHLAB RecName: Full=30S ribosomal protein S6;
    1::108     2e-04  25%  147 aa  RT06_DROME RecName: Full=Probable 28S ribosomal protein S6,
    1::90      2e-04  27%  160 aa  RS6_UREPA RecName: Full=30S ribosomal protein S6;
    1::90      2e-04  27%  160 aa  RS6_UREP2 RecName: Full=30S ribosomal protein S6;
   41::88      2e-04  33%  215 aa  RS6_MYCPN RecName: Full=30S ribosomal protein S6;
   39::103     2e-04  31%  112 aa  RS6_CHLFF RecName: Full=30S ribosomal protein S6;
    1::66      3e-04  25%  102 aa  RS6_DEIDV RecName: Full=30S ribosomal protein S6;
   28::105     4e-04  31%  112 aa  RS6_CHLCV RecName: Full=30S ribosomal protein S6;
   12::97      4e-04  29%   99 aa  RR6_CYAME RecName: Full=30S ribosomal protein S6, chloroplastic;
   97::178     0.001  35%  801 aa  COG3_YEAST RecName: Full=Conserved oligomeric Golgi complex subunit
    1::111

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKHYEVVLMIHPDQSDQLDAMLGKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHYVLFNIECPTES
RS6_FRATW       MKHYEVVLMIHPDQSDQLDAMLGKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHYVLFNIECPTES
RS6_FRATT       MKHYEVVLMIHPDQSDQLDAMLGKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHYVLFNIECPTES
RS6_FRATN       MKHYEVVLMIHPDQSDQLDAMLGKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHYVLFNIECPTES
RS6_FRATM       MKHYEVVLMIHPDQSDQLDAMLGKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHYVLFNIECPTES
RS6_FRATH       MKHYEVVLMIHPDQSDQLDAMLGKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHYVLFNIECPTES
RS6_FRAT1       MKHYEVVLMIHPDQSDQLDAMLGKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHYVLFNIECPTES
RS6_FRAP2       MKHYEIVLMIHPDQSEQLDAMLSKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHYVLFNVECDVES
RS6_PSEHT       MRHYEIVFMVHPDQSEQVTGMIERYTGSITEAGGVIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPTEV
RS6_HAES2       MRHYEIVFMVHPDQSEQVPGMIERYTGSVKEAGGQIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_VIBCM       MRHYEIVFMVHPDQSEQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEADQAV
RS6_VIBCH       MRHYEIVFMVHPDQSEQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEADQAV
RS6_VIBC3       MRHYEIVFMVHPDQSEQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEADQAV
RS6_HALHL       MRHYEIVFMVHPDQSDQVPAMVERYRSIVESSGGTVHRLEDWGRRQLAYPINKLIKAHYVLMNVECGKDE
RS6_ALISL       MRHYEIVFMVHPDQSEQVAGMIERYTGSITEAGGTIHRLEDWGRRQMAYPINKLHKAHYVLMNVESEQAA
RS6_THICR       MRHYEVVFLVHPDQSEQVPAMIERYRGLIEENGGAIHRLEDWGRRQLAYLINKVHKAHYILMNIECDQET
RS6_MANSM       MRHYEIVFMVHPDQSEQVPGMIERYTGSVKEAGGQIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_ALHEH       MRHYEIVFMVHPDQSEQVPSMIERYTGIVESNGGKVHRLEDWGRRQLAYPINKLIKAHYVLMNVECGKDE
RS6_ACTSZ       MRHYEIVFMVHPDQSEQVPGMIERYTGSVKEAGGQIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_VIBFM       MRHYEIVFMVHPDQSEQVAGMIERYTGSITEAGGTIHRLEDWGRRQMAYPINKLHKAHYVLMNVESEQAV
RS6_VIBF1       MRHYEIVFMVHPDQSEQVAGMIERYTGSITEAGGTIHRLEDWGRRQMAYPINKLHKAHYVLMNVESEQAV
RS6_PASMU       MRHYEIVFMVHPDQSEQVPGMIERYTGSVKEAGGQVHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_HAES1       MRHYEIVFMVHPDQSEQVPGMIERYTSSIKEAGGQIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_BORPD       MRHYEVVFIVHPDQSEQVPAMVERYQTLVTGQGGAVHRLEDWGRRQLAYPIQKLVKAHYVCMNIECGQAT
RS6_HAEIN       MRHYEIVFMVHPDQSEQVPGMIERYTGSVKEAGGQVHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQQV
RS6_HAEIG       MRHYEIVFMVHPDQSEQVPGMIERYTGSVKEAGGQVHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQQV
RS6_HAEI8       MRHYEIVFMVHPDQSEQVPGMIERYTGSVKEAGGQVHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQQV
RS6_SHESR       MRHYEIVFMVHPDQSEQVPGMIERYTGVITEANGKIHRLEDWGRRQLAYPIQDLHKAHYVLMNVEAPAET
RS6_SHESM       MRHYEIVFMVHPDQSEQVPGMIERYTGVITEANGKIHRLEDWGRRQLAYPIQDLHKAHYVLMNVEAPAET
RS6_HAEIE       MRHYEIVFMVHPDQSEQVPGMIERYTGSVKEAGGQVHRLEDWGRRQLAYPINKLHKAHYVLMNVEVPQQV
RS6_VIBVY       MRHYEIVFMVHPDQSEQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEADQAV
RS6_VIBVU       MRHYEIVFMVHPDQSEQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEADQAV
RS6_METCA       MRHYEIVFMVHPDQSGQVPAMIERYRSIIEGAAGRIHRLEDWGRRQLAYPIAKLHKAHYVLMNIECDQAT
RS6_CHRSD       MRHYEIVFMVHPDQSEQVPAMVERYTGLVTENGGTVHRLEDWGRRHLAYPINKIHKAHYVLMNIECSGET
RS6_SHEON       MRHYEIVFMVHPDQSEQVPGMIERYTGAITEANGKIHRLEDWGRRQLAYPIQDLHKAHYVLMNVEAPAET
RS6_PSYWF       MRHYEVVLIVHPDQSDQVVGMVERYIKLVQDNNGMVHRLEDWGRRQLAYPINKIHKAHYVLFNIECDGAT
RS6_SHESA       MRHYEIVFMVHPDQSEQVPGMIERYTGAITEANGKIHRLEDWGRRQLAYPIQDLHKAHYVLMNVEAPAET
RS6_NITOC       MRHYEVVFLVHPDQSEQLSAMMDRYRQIIETDGGCIHRLEDWGRRQLAYPIQKLYKAHYVLMNIECTPRT
RS6_AZOSE       MRHYEVVFIVHPDQSEQVPAMIERYKAIVTARNGQIHRLEDWGRRQMAYPIQKVHKAHYVLMNIECDGEA
RS6_VIBHB       MRHYEIVFMVHPDQSEQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAGQEV
RS6_SHESW       MRHYEIVFMVHPDQSEQVPGMIERYTGVITEANGTIHRLEDWGRRQLAYPIQDLHKAHYVLMNVEAPAET
RS6_SHEPC       MRHYEIVFMVHPDQSEQVPGMIERYTGVITEANGTIHRLEDWGRRQLAYPIQDLHKAHYVLMNVEAPAET
RS6_HAEPS       MRHYEIVFMVHPDQSEQVPGMIERYTASVKEAGGQVHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQNV
RS6_POLSQ       MRHYEIVFIVHPDQSEQVPAMIDRYKATLAAAGGKIHRIEDWGRRQMAYMIDKLAKAHYVCMNIECDQKT
RS6_MARMS       MRHYEIVFLVHPDQSEQVPAMVERYTNLITEDGGQVHRLEDWGRRQLAYPINKIHKAHYVLMNIECSDSV
RS6_ACIF5       MRHYEIVFLVHPDQSEQVPQMIERYRGMIESDGGHFHRLEDWGRRQLAYPIKKAHKAHYVLMNIECSSVA
RS6_ACIF2       MRHYEIVFLVHPDQSEQVPQMIERYRGMIESDGGHFHRLEDWGRRQLAYPIKKAHKAHYVLMNIECSSVA
RS6_PHOPR       MRHYEIVFMVHPDQSEQVAGMIERYTGSIKDSGGQIHRLEDWGRRQMAYPINKLHKAHYVLMNIEAEQSV
RS6_AZOSB       MRHYEIVFIVHPDQSEQVPAMIDRYKSIVTARNGQIHRLEDWGRRQLAYPIQKVHKAHYVLMNIECDGEA
RS6_ACTPJ       MRHYEIVFMVHPDQSEQVPAMIERYTASVKEAGGQVHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQSV
RS6_ACTP7       MRHYEIVFMVHPDQSEQVPAMIERYTASVKEAGGQVHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQSV
RS6_ACTP2       MRHYEIVFMVHPDQSEQVPAMIERYTASVKEAGGQVHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQRV
RS6_NITEU       MRHYEIVFIVHPDQSEQVSAMTERYSNIVTGRSGKIHRLEDWGRRQLTYPIQKLHKAHYVLMNIECDQES
RS6_NITEC       MRHYEIIFIVHPDQSEQVSAMIERYSNMITERSGGIHRLEDWGRRQLTYPIQKLHKAHYILMNIECDQES
RS6_ALCBS       MRHYEVVFLVHPDQSEQVSAMVERYSAIVTDGKGTIHRVEDWGRRQLAYPINKIHKAHYVMLNIECDGET
RS6_VIBPA       MRHYEIVFMVHPDQSEQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEADQAV
RS6_VESOH       MRHYEITLIVHPDQSAQVGTMMDKYKEIINADGGKIHKEEDWGRKHLAYPIKKIYKAHYLMMNIECDQEM
RS6_IDILO       MRHYEIVFMVHPDQSEQVPGMIERYSETIKQGGGQIHRLEDWGRRQLAYPINKLHKAHYVLLNIEASAEV
RS6_SHEWM       MRHYEIVFLVHPDQSEQVPGMIERYTGILTQAGGQIHRLEDWGRRQLAYPIIELHKAHYVLMNVEATAES
RS6_POLNS       MRHYEIVFIVHPDQSEQVPAMIDRYKATLAAVGGKIHRMEDWGRRQMAYMIDKLAKAHYVCMNIECDQKT
RS6_SHEAM       MRHYEIVFMVHPDQSEQVAGMIERYTGVITDANGKIHRLEDWGRRQLAYPIQDLHKAHYVLMNVEATAES
RS6_LARHH       MRHYEIVFIVHPDQSEQVPAMVERYKGMVLGQNGKIHRLEDWGRRQLAYPIQKIHKAHYVMMNIECGKET
RS6_HAEDU       MRHYEIVFMVHPDQSEQVPAMIERYTASVTEAGGQVHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPKSV
RS6_SHELP       MRHYEIVFLVHPDQSEQVPGMIERYTGILTQAGGQIHRLEDWGRRQLAYPIIELHKAHYVLMNVEATAES
RS6_METFK       MRHYEIVFIVHPDQSEQVPAMIERYRTLVTSNGGTIHRLEDWGRRQLAYPIQKIHKAHYVLMNIEVSQEV
RS6_VIBSL       MRHYEIVFMVHPDQSEQVAGMIERYTGSITEAGGTIHRLEDWGRRQMAYPINKLHKAHYVLMNVEAGQEV
RS6_THISH       MRHYEIVFMVHPDQSEQVSAMIERYRGLIEGDGGKIHRLEDWGRRQLAYPINKIHKAHYVLMNVECGEAA
RS6_SHEPW       MRHYEIVFLVHPDQSEQVPGMIERYTGILTQAGGQIHRLEDWGRRQLAYPIIELHKAHYVLMNVETTAES
RS6_BORPE       MRHYEVVFIVHPDQSEQVPAMVERYQALVTGQSGTVHRLEDWGRRQLAYPIQKLVKAHYVCMNIECGQAT
RS6_BORPA       MRHYEVVFIVHPDQSEQVPAMVERYQALVTGQSGTVHRLEDWGRRQLAYPIQKLVKAHYVCMNIECGQAT
RS6_BORBR       MRHYEVVFIVHPDQSEQVPAMVERYQALVTGQSGTVHRLEDWGRRQLAYPIQKLVKAHYVCMNIECGQAT
RS6_CITK8       MRHYEIVFMVHPDQSEQVPGMIERYTGAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEV
RS6_SHEB9       MRHYEIVFMVHPDQSEQVPGMIERYTGVITEANGTIHRLEDWGRRQLAYPILDLHKAHYVLMNVEAKAET
RS6_SHEB8       MRHYEIVFMVHPDQSEQVPGMIERYTGVITEANGTIHRLEDWGRRQLAYPILDLHKAHYVLMNVEAKAET
RS6_SHEB5       MRHYEIVFMVHPDQSEQVPGMIERYTGVITEANGTIHRLEDWGRRQLAYPILDLHKAHYVLMNVEAKAET
RS6_SHEB2       MRHYEIVFMVHPDQSEQVPGMIERYTGVITEANGTIHRLEDWGRRQLAYPILDLHKAHYVLMNVEAKAET
RS6_RUTMC       MRHYEITLIVHPDQSAQVGTMMEKYKEIITTGGGKIHRKEDWGRKHLAYPIKKIYKAHYLMMNIECDQEV
RS6_PSEE4       MRHYEIIFLVHPDQSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHYVMLNVECTGKA
RS6_DICNV       MRHYEIVFLVHPDQSEQVSAMVERYRAQIEAAQGKVHRLEDWGRRVLAYPIQKLVKAHYILMNIECDRQT
RS6_SHEFN       MRHYEIVFMVHPDQSEQVPGMIERYTGVITAANGTVHRLEDWGRRQLAYPIQDLHKAHYVLLNVEASAES
RS6_SHEDO       MRHYEIVFMVHPDQSEQVPGMIERYSGVITAANGTIHRLEDWGRRQLAYPIQDLHKAHYVLMNVEATAES
RS6_METPP       MRHYEIVLLIHPDQSEQVPAMLERYKGLVTAAGGKVHRVEDWGRRQLAYLINKLAKAHYLCLNIECSKET
RS6_HAHCH       MRHYEIVIMVHPDQSEQVPAMVERYTSSVNAGGGKVHRLEDWGRRHMAYPINKIHKAHYVLMNIECSQEV
RS6_ENT38       MRHYEIVFMVHPDQSEQVPGMIERYTGAITAAEGTIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEA
RS6_THIDA       MRHYEIVFIVHPDQSEQVPAMIERYRANIAARGGNVHRLEDWGRRQMAYPIQKVHKAHYVLMNIECDQET
RS6_PSEU5       MRHYEIIFLVHPDQSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHYVMLNVECSGKA
RS6_PSEAE       MRHYEIVFLVHPDQSEQVGGMVERYTKAIEEDGGKIHRLEDWGRRQLAYAINNVHKAHYVLMNVECSAKA
RS6_PSEAB       MRHYEIVFLVHPDQSEQVGGMVERYTKAIEEDGGKIHRLEDWGRRQLAYAINNVHKAHYVLMNVECSAKA
RS6_PSEA8       MRHYEIVFLVHPDQSEQVGGMVERYTKAIEEDGGKIHRLEDWGRRQLAYAINNVHKAHYVLMNVECSAKA
RS6_PSEA7       MRHYEIVFLVHPDQSEQVGGMVERYTKAIEEDGGKIHRLEDWGRRQLAYAINNVHKAHYVLMNVECSAKA
RS6_PROMH       MRHYEIVFMVHPDQSEQVPGMIERYKTAITNANGQIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_NITMU       MRHYEIVFIVHPDQSEQVSAMIERYRNIVTARNGQVHRLEDWGRRQLAYLIQKVHKAHYVLMNIECDQET
RS6_ACIBY       MRHYEIVLLVHPDQSDQVVGMVERYISQIKEADGQIHRLEDWGRRQLAYPINKIHKAHYILMNVECGQST
RS6_ACIBT       MRHYEIVLLVHPDQSDQVVGMVERYISQIKEADGQIHRLEDWGRRQLAYPINKIHKAHYILMNVECGQST
RS6_ACIBS       MRHYEIVLLVHPDQSDQVVGMVERYISQIKEADGQIHRLEDWGRRQLAYPINKIHKAHYILMNVECGQST
RS6_ACIB5       MRHYEIVLLVHPDQSDQVVGMVERYISQIKEADGQIHRLEDWGRRQLAYPINKIHKAHYILMNVECGQST
RS6_ACIB3       MRHYEIVLLVHPDQSDQVVGMVERYISQIKEADGQIHRLEDWGRRQLAYPINKIHKAHYILMNVECGQST
RS6_TOLAT       MRHYEIVFMVHPDQSEQVPGMIERYTGAIKAAGGTIHRLEDWGRRQLAYPIDKLHKAHYVLMNVEAEQSV
RS6_SERP5       MRHYEIVFMVHPDQSEQVPGMIERYSATITNAAGQIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEA
RS6_COXB1       MRHYEIVILVHPDQSSQVPAMVERYQSMIKEKGGKVHRLEDWGRRQLAYSIDKVHKAHYLLMNIESDQGV
RS6_CHRVO       MRHYEIVFIVHPDQSEQVPAMIERYKGMVLAAEGKIHRLEDWGRRQLAYPIQKLHKAHYVLMNVECQAET
RS6_AZOVD       MRHYEIIFLVHPDQSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHYVLINVECSGKA
RS6_SHISS       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_SHIFL       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_SHIF8       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_SHIDS       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_SHIBS       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_SHIB3       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_SALTY       MRHYEIVFMVHPDQSEQVPGMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_SALTI       MRHYEIVFMVHPDQSEQVPGMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_SALSV       MRHYEIVFMVHPDQSEQVPGMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_SALPK       MRHYEIVFMVHPDQSEQVPGMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_SALPC       MRHYEIVFMVHPDQSEQVPGMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_SALPB       MRHYEIVFMVHPDQSEQVPGMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_SALPA       MRHYEIVFMVHPDQSEQVPGMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_SALNS       MRHYEIVFMVHPDQSEQVPGMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_SALHS       MRHYEIVFMVHPDQSEQVPGMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_SALG2       MRHYEIVFMVHPDQSEQVPGMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_SALEP       MRHYEIVFMVHPDQSEQVPGMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_SALDC       MRHYEIVFMVHPDQSEQVPCMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_SALCH       MRHYEIVFMVHPDQSEQVPGMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_SALA4       MRHYEIVFMVHPDQSEQVPGMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_PSEF5       MRHYEIIFLVHPDQSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHYVMLNVECTGKA
RS6_ESCF3       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_ENTS8       MRHYEIVFMVHPDQSEQVPGMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_ECOUT       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_ECOSM       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_ECOSE       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_ECOLU       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_ECOLI       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_ECOLC       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_ECOL6       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_ECOK1       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_ECOHS       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_ECODH       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_ECOBW       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_ECO8A       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_ECO81       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_ECO7I       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_ECO5E       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_ECO57       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_ECO55       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_ECO45       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_ECO27       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_ECO24       MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_YERPY       MRHYEIVFMVHPDQSEQVPGMIERYSATITNAAGTIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEA
RS6_YERPS       MRHYEIVFMVHPDQSEQVPGMIERYSATITNAAGTIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEA
RS6_YERPP       MRHYEIVFMVHPDQSEQVPGMIERYSATITNAAGTIHRLEDWGRRQLAYPISKLHKAHYVLLNVEAPQEA
RS6_YERPN       MRHYEIVFMVHPDQSEQVPGMIERYSATITNAAGTIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEA
RS6_YERPG       MRHYEIVFMVHPDQSEQVPGMIERYSATITNAAGTIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEA
RS6_YERPE       MRHYEIVFMVHPDQSEQVPGMIERYSATITNAAGTIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEA
RS6_YERPB       MRHYEIVFMVHPDQSEQVPGMIERYSATITNAAGTIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEA
RS6_YERPA       MRHYEIVFMVHPDQSEQVPGMIERYSATITNAAGTIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEA
RS6_YERP3       MRHYEIVFMVHPDQSEQVPGMIERYSATITNAAGTIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEA
RS6_YERE8       MRHYEIVFMVHPDQSEQVPGMIERYSATITNAAGTIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEA
RS6_SALAR       MRHYEIVFMVHPDQSEQVPGMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_RALEJ       MRHYEIVFIVHPDQSEQVPAMIERYKSLVTSQGGQVHRVEDWGRRQMAYMIQKLAKAHYVCVNIECGKET
RS6_PSEFS       MRHYEIIFLVHPDQSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHYVMLNVECTGKA
RS6_NEIGO       MRHYEIVFIVHPDQSEQVPAMVERYKTMITEANGKIHRLEDWGRRQLAYPINKIHKAHYVLMNIETTPEV
RS6_NEIG1       MRHYEIVFIVHPDQSEQVPAMVERYKTMITEANGKIHRLEDWGRRQLAYPINKIHKAHYVLMNIETTPEV
RS6_MARAV       MRHYEIVFMVHPDQSEQVPAMIERYTSVITEDGGKVHRLEDWGRRHLAYPINKIHKAHYVLMNIECSQAA
RS6_COLP3       MRHYEIVFMVHPDQSEQVSGMIQRYTDLINAAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNIEAPQVV
RS6_CELJU       MRHYEVVVLIHPDQSEQVPAMVERYTSTVKADGGQVHRFEDWGRRQLAYSINKVHKAHYVLLNVECSDAA
RS6_PSEU2       MRHYEIIFLVHPDQSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHYVMLNVECTGKA
RS6_PSESM       MRHYEIIFLVHPDQSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHYVMLNVECTGKA
RS6_PSEPW       MRHYEIIFLVHPDQSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHYVMLNVECTGKA
RS6_PSEPK       MRHYEIIFLVHPDQSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHYVMLNVECTGKA
RS6_PSEPG       MRHYEIIFLVHPDQSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHYVMLNVECTGKA
RS6_PSEPF       MRHYEIIFLVHPDQSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHYVMLNVECTGKA
RS6_PSEP1       MRHYEIIFLVHPDQSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHYVMLNVECTGKA
RS6_PSE14       MRHYEIIFLVHPDQSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHYVMLNVECTGKA
RS6_JANMA       MRHYEIVFIVHPDQSEQVPAMIERYKGIVTARGGVIHRVEDWGRRQMAYMIQKLAKAHYVCLNIECDGET
RS6_PSYCK       MRHYELVLLVHPDQSDQVVGMVERYIKLVQDNNGTIHRLEDWGRRQLAYPINKIHKAHYVLFNIETDGET
RS6_PSYA2       MRHYELVLLVHPDQSDQVVGMVERYIKLVQDNNGTIHRLEDWGRRQLAYPINKIHKAHYVLFNIETDGET
RS6_PSEMY       MRHYEIIFLVHPDQSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHYVMLNVECTGKA
RS6_EDWI9       MRHYEIVFMVHPDQSEQVPGMIERYTGAITGAEGKIHRLEDWGRRQLAYSINKLHKAHYVLMNVEASQEV
RS6_PHOLL       MRHYEIVFMVHPDQSEQVPGMIERYSATITNAQGQIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
RS6_HERAR       MRHYEIVFIVHPDQSEQVPAMIERYKGIVTARGGVVHRVEDWGRRQMAYLIQKLAKAHYVCLNIECDGET
RS6_HAMD5       MRHYEIVFMVHPDQSDQVPGMIQRYSTVITQSGGQIHRIEDWGRRQLAYAINKLHKAHYVLLNVEAPQNA
RS6_AERHH       MRHYEIVFMVHPDQSEQVPGMIERYTGAITTSGGTIHRLEDWGRRQLAYPIDKLHKAHYVLMNVEAEQAV
RS6_TERTT       MRHYEIVFLVHPDQSEQVPGMIERYTSAVKDSGGSVHRLEDWGRRQMAYSINKIHKAHYVLMNIECGDQA
RS6_ERWT9       MRHYEIVFMVHPDQSEQVPGMIERYSATITGAEGTIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEA
RS6_DECAR       MRHYEICFIVHPDQSEQVPGMVERYRAIVTAKGGSIHRLEDWGRRQLAYPIQKIHKAHYVLMNIECDGDT
RS6_BURXL       MRHYEIVFIVHPDQSEQVPAMIERYKSTITSHGGQIHRIEDWGRRQLAYMIEKLAKAHYVCMNIECDQTT
RS6_BURPP       MRHYEIVFIVHPDQSEQVPAMIERYKSTITSHGGQIHRIEDWGRRQLAYMIEKLAKAHYVCMNIECDQTT
RS6_BORA1       MRHYEVVFIVHPDQSEQVPAMVERYQSLVTGQNGAVHRLEDWGRRQLAYPIQKLVKAHYVCMNIECNQAT
RS6_SACD2       MRHYEIVFLVHPDQSEQVPGMVERYTAAVKDSGGAVHRLEDWGRRQMAYSINKIHKAHYILMNVECGEEV
RS6_COXBU       MRHYEIVILVHPDQSSQVPAMVERYQSMIKEKDGKVHRLEDWGRRQLAYSIDKVHKAHYLLMNIESDQGV
RS6_COXBR       MRHYEIVILVHPDQSSQVPAMVERYQSMIKEKDGKVHRLEDWGRRQLAYSIDKVHKAHYLLMNIESDQGV
RS6_COXB2       MRHYEIVILVHPDQSSQVPAMVERYQSMIKEKDGKVHRLEDWGRRQLAYSIDKVHKAHYLLMNIESDQGV
RS6_RALPJ       MRHYEIVFIVHPDQSEQVPAMIERYKSTVTSQGGQVHRVEDWGRRQLAYMIQKLAKAHYVCLNIECGKET
RS6_PECCP       MRHYEIVFMVHPDQSEQVPGMIERYTATITGAQGTIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEA
RS6_ERWCT       MRHYEIVFMVHPDQSEQVPGMIERYTATITGAQGTIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEA
RS6_ALTMD       MRHYEIVFMVHPDQSEQVPGMIERYTTILKQDGGQVHRLEDWGRRQLAYPIEKLHKAHYVLINAEATAEA
RS6_VEREI       MRHYEIILLIHPDQSEQVPAMLERYKGMIAAGGGKVHRVEDWGRRQLAYLINKLSKAHYLCVNIEADQAV
RS6_STRM5       -RHYEIVFMVHPDQSEQVPAMIERYKSLVENGNGTIHRLEDWGRRQLAYPIQNLVKAHYVLLNIEADQAV
RS6_RALSO       MRHYEIVFIVHPDQSEQVPAMIERYKSTVTSQGGQVHRVEDWGRRQLAYMIQKLAKAHYVCVNIECGKET
RS6_RALEH       MRHYEIVFIVHPDQSEQVPAMIERYKQLVTSQNGNVHRVEDWGRRQMAYMIQKLAKAHYVCLNIECGKET
RS6_CUPTR       MRHYEIVFIVHPDQSEQVPAMIERYKQLVTSQNGNVHRVEDWGRRQMAYMIQKLAKAHYVCLNIECGKET
RS6_SODGM       MRHYEIIFMVHPDQSEQVAGMIERYSALITGAEGQIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEV
RS6_RALME       MRHYEIVFIVHPDQSEQVPAMIERYKQLVTSQNGQIHRVEDWGRRQMAYMIQKLAKAHYVCLNIECGKDT
RS6_BURTA       MRHYEIVFIVHPDQSEQVPAMIERYKSTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTT
RS6_BURPS       MRHYEIVFIVHPDQSEQVPAMIERYKSTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTT
RS6_BURP6       MRHYEIVFIVHPDQSEQVPAMIERYKSTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTT
RS6_BURP1       MRHYEIVFIVHPDQSEQVPAMIERYKSTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTT
RS6_BURP0       MRHYEIVFIVHPDQSEQVPAMIERYKSTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTT
RS6_BURMS       MRHYEIVFIVHPDQSEQVPAMIERYKSTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTT
RS6_BURMA       MRHYEIVFIVHPDQSEQVPAMIERYKSTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTT
RS6_BURM9       MRHYEIVFIVHPDQSEQVPAMIERYKSTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTT
RS6_BURM7       MRHYEIVFIVHPDQSEQVPAMIERYKSTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTT
RS6_BURCJ       MRHYEIVFIVHPDQSEQVPAMIERYKSTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTT
RS6_BURCC       MRHYEIVFIVHPDQSEQVPAMIERYKSTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTT
RS6_DELAS       MRHYEIVLLIHPDQSEQVPAMLERYKGMITAGGGKVHREEDWGRRQLAYMINKLAKAHYLCLNIEADQAV
RS6_COXBN       MRHYEIVILVHPDQSSQVPAMVERYQSMIKEKDGKVHRLEDWGRRQLAYSIDKVHKAHYLLMNIESDQGV
RS6_BURP8       MRHYEIVFIVHPDQSEQVPAMIERYKTTITSHGGQIHRIEDWGRRQLAYMIEKLAKAHYVCMNIECDQAT
RS6_BAUCH       MRHYEIVLMVHPDQSEQVSRMIERYSTVITSAQGKIHRLEDWGRRQLSYPIKKLHKAHYVLINLEASQKV
RS6_POLNA       MRHYEIVLLIHPDQSEQVPAMLERYKGMITAGGGTVHRVEDWGRRQLVYLIQKLAKAHYLCINIEASQAV
RS6_BURS3       MRHYEIVFIVHPDQSEQVPAMIERYKTTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTT
RS6_BURM1       MRHYEIVFIVHPDQSEQVPAMIERYKTTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTT
RS6_RHOFD       MRHYEIILMIHPDQSEQVPAMLERYKGMITAGGGKVHRVEDWGRRQLVYMINKLAKAHYLCVNIEADQAV
RS6_KLEP7       MRHYEIVFMVHPDQSEQVPGMIERYXXXXXXXXXXXHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEA
RS6_KLEP3       MRHYEIVFMVHPDQSEQVPGMIERYXXXXXXXXXXXHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEA
RS6_BURVG       MRHYEIVFIVHPDQSEQVPAMIERYKTTITTHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTT
RS6_BURCM       MRHYEIVFIVHPDQSEQVPAMIERYKTTITTHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTT
RS6_BURCH       MRHYEIVFIVHPDQSEQVPAMIERYKTTITTHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTT
RS6_BURCA       MRHYEIVFIVHPDQSEQVPAMIERYKTTITTHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTT
RS6_BURA4       MRHYEIVFIVHPDQSEQVPAMIERYKTTITTHGGQIHRVEDWGRRQLAYMIEKLAKAHYVCMNIECDQTT
RS6_POLSJ       MRHYEIVLLIHPDQSEQVPAMLERYKGMITAGGGKVHRVEDWGRRQLVYLIQKLAKAHYLCINIEASQAV
RS6_LEGPL       MRHYEIMFLVHPDQSEQVPGMVERYEGIITKHNGKIHRKEDLGRRQLAYSINKVHKAHYILMNVECNLDA
RS6_LEGPH       MRHYEIMFLVHPDQSEQVPGMVERYEGIITKHNGKIHRKEDLGRRQLAYSINKVHKAHYILMNVECNLDA
RS6_LEGPC       MRHYEIMFLVHPDQSEQVPGMVERYEGIITKHNGKIHRKEDLGRRQLAYSINKVHKAHYILMNVECNLDA
RS6_LEGPA       MRHYEIMFLVHPDQSEQVPGMVERYEGIITKHNGKIHRKEDLGRRQLAYSINKVHKAHYILMNVECNLDA
RS6_XANC5       -RHYEVVFLVHPDQSEQVPAMIERYKSLIEGGNGTIHRLEDWGRRQLAYPIQNLVKAHYVLLNIEVDQAV
RS6_XANAC       -RHYEVVFLVHPDQSEQVPAMIERYKSLIEGGNGTIHRLEDWGRRQLAYPIQNLVKAHYVLLNIEVDQAV
RS6_NEIMB       MRHYEIVFIVHPDQSEQVPAMVERYKTMIAEANGKIHRLEDWGRRQLAYPINKIHKAHYVLMNIXXXXXX
RS6_ACIAC       MRHYEIILLIHPDQSEQVPAMLERYKGMITAGGGKIHRVEDWGRRQLAYMINKLAKAHYLCVNIEADQAV
RS6_VARPS       MRHYEIILLIHPDQSEQVPAMLERYKGLITAGGGKVHRVEDWGRRQLAYQINKLSKAHYLCVNIEAEQTV
RS6_PSYIN       MRHYEIVFMVHPDQSEQVNGMIERYTASITEAGGTVHRLEDWGRRQLAYPINKLHKAHYVLMNIEAGQNV
RS6_NEIMF       MRHYEIVFIVHPDQSEQVPAMVERYKTMIAEANGKIHRLEDWGRRQLAYPINKIHKAHYVLMNIXXXXXX
RS6_NEIMA       MRHYEIVFIVHPDQSEQVPAMVERYKTMIAEANGKIHRLEDWGRRQLAYPINKIHKAHYVLMNIXXXXXX
RS6_NEIM0       MRHYEIVFIVHPDQSEQVPAMVERYKTMIAEANGKIHRLEDWGRRQLAYPINKIHKAHYVLMNIXXXXXX
RS6_LEPCP       MRHYEIVLLVHPDQSEQVPAMLERYKTLVTAANGKVHRVEDWGRFQLAYMINKLAKAHYLCLNIECSKET
RS6_XANCP       -RHYEVVFLVHPDQSEQVPAMIERYKSLIEGGNGTIHRLEDWGRRQLAYPIQNLVKAHYVLLNIEVDQAV
RS6_XANCB       -RHYEVVFLVHPDQSEQVPAMIERYKSLIEGGNGTIHRLEDWGRRQLAYPIQNLVKAHYVLLNIEVDQAV
RS6_XANC8       -RHYEVVFLVHPDQSEQVPAMIERYKSLIEGGNGTIHRLEDWGRRQLAYPIQNLVKAHYVLLNIEVDQAV
RS6_XANOR       -RHYEVVFLVHPDQSEQVPAMIERYKSLIEGGNGTIHRLEDWGRRQLAYPIQNLVKAHYVLLNIEVDQAV
RS6_XANOP       -RHYEVVFLVHPDQSEQVPAMIERYKSLIEGGNGTIHRLEDWGRRQLAYPIQNLVKAHYVLLNIEVDQAV
RS6_XANOM       -RHYEVVFLVHPDQSEQVPAMIERYKSLIEGGNGTIHRLEDWGRRQLAYPIQNLVKAHYVLLNIEVDQAV
RS6_SHESH       MRHYEIVFLVHPDQSEQVPGMIERYTGILTQAGGQVHRLEDWGRRQLAYPIIELHKAHYVLMNXXXXXXX
RS6_XYLFM       -RHYEIVLLVHPDQSEQVQAMLERYKALIENGHGKIHRLEDWGRRQLAYPIQKLVKAHYLMMNIEVEQSV
RS6_ACIAD       MRHYEIVLLVHPDQSDQVVGMVERYISQIKEADGQIHRLEDWGRRQLAYPINKIHKAHYILMNVECGQTT
RS6_DIAST       MRHYEIILLIHPDQSEQVPAMLERYKGMIVAGGGQVHRVEDWGRRQLAYLINKLAKAHYLCLNIEADQAV
RS6_ACISJ       MRHYEIILLIHPDQSEQVPAMLERYKGMIVAGGGQVHRVEDWGRRQLAYLINKLAKAHYLCLNIEADQAV
RS6_XYLFT       -RHYEIVLLVHPDQSEQVQAMLERYKALIENGHGKIHRLEDWGRRQLAYPIQKLVKAHYLMMNIEVEQSV
RS6_XYLFA       -RHYEIVLLVHPDQSEQVQAMLERYKALIENGHGKIHRLEDWGRRQLAYPIQKLVKAHYLMMNIEVEQSV
RS6_XYLF2       -RHYEIVLLVHPDQSEQVQAMLERYKALIENGHGKIHRLEDWGRRQLAYPIQKLVKAHYLMMNIEVEQSV
RS6_BUCAP       MRHYEIIFMIHPDYSEKVSVIIEKYKKIIHHNSGIIHRLEDWGRRQLAYPINKLHKAHYILLNIETFPKT
RS6_SHEPA       MRHYEIVFLVHPDQSEQVPGMIERYTGILTQAGGQIHRLEDWGRRQLAYPIIELHKAHYVLMNXXXXXXX
RS6_SHEHH       MRHYEIVFLVHPDQSEQVPGMIERYTGILTQAGGQIHRLEDWGRRQLAYPIIELHKAHYVLLNXXXXXXX
RS6_AERS4       MRHYEIVFMVHPDQSEQVPGMIERYXXXXXXXXXXXHRMEDWGRRQLAYPIDKLHKAHYVLMNVEAEQAV
RS6_BUCBP       MRHYEIILLIHPDCSEKLPIMIEKFKKLVIGYKGRIHRLEDWGRRQLAYSINKLHKAHYFLMNIEVPSNC
RS6_BLOPB       MRYYEIVFMVHPDLSEQISSIINRYTTIVTNAQGKVHRIENWGRRQLAYPVNKLCKAYYVLLNIEVSQDT
RS6_BUCAT       MRHYEIIFMVHPDQSDKIPLLIEKYKKIINDNNGIIHRLEDWGRRQLSYSINKLQKAHYILMNIEVFPKT
RS6_BUCAI       MRHYEIIFMVHPDQSDKIPLLIEKYKKIINDNNGIIHRLEDWGRRQLSYSINKLQKAHYILMNIEVFPKT
RS6_BUCA5       MRHYEIIFMVHPDQSDKIPLLIEKYKKIINDNNGIIHRLEDWGRRQLSYSINKLQKAHYILMNIEVFPKT
RS6_WIGBR       MRHYEIVLMIHTDQSDQISNIIEHYTKMIKINKGSIHRLEDWGRRQLAYPIKKLNKAHYILMNIETSTKV
RS6_BLOFL       MRYYEIVLIIHPDSDNQIDNLVNYYSEIIINSTGKIHRLENWGRRQLAYAIXXXXXXXXXXXXIEISKNI
RS6_METNO       MALYEHVFLARQDTSQQVESMIDTYKGVIEANGGKVEKTEMWGVKSLAYRIKKNRKAHFTLLNIDAPPAA
RS6_RHISN       MALYEHVFLARQDITQQVDALVEQYKGVLEANGGKVGRVENWGLKSLTYRIKKNRKAHYVLMDIDAPAPA
RS6_AGRVS       MALYEHVFLARQDMSQQVDALVEQYKGVIEANGGKVGRVENWGLKSLTYRINKNRKAHYALMDIDAPAAA
RS6_RHILW       MALYEHVFLARQDISQQVDALVEQYKGVIEANGGKVGRIENWGLKSLTYRIKKNRKAHYALMDIDAPAAA
RS6_RHIL3       MALYEHVFLARQDISQQVDALVEQYKGVIEANGGKVGRIENWGLKSLTYRIKKNRKAHYALMDIDAPAAA
RS6_METRJ       MPLYEHVLLARQDTSQQVETMIDTYKGVIEQNGGRLEKIEMWGVKSLAYRIKKNRKAHFALLNIDAPPAA
RS6_RHIME       MALYEHVFLARQDITQQVDALVEQYKGVIEANGGKVGRVENWGLKSLTYRIKKNRKAHYVLMDIDAPAPA
RS6_RHIE6       MALYEHVFLARQDISQQVDALVEQYKGVIEANGGKVGRIENWGLKSLTYRIKKNRKAHYALMDIDAPAAA
RS6_BARBK       MALYEHVFLARQDIAQQVDELLKTYKNVIESHGGKVERTENWGLRSLAYRIRKNRKAHYVLINIDAPAAA
RS6_AGRRK       MALYEHVFLARQDISQQVDALVEQYKGVIEANGGKVGRIENWGLKSLTYRIKKNRKAHYALMDIDAPAAA
RS6_SINMW       MALYEHVFLARQDITQQVDGLVEQYKGVIEANGGKVGRVENWGLKSLTYRIKKNRKAHYVLMDIDAPAPA
RS6_RHIEC       MALYEHVFLARQDISQQVDALVEQYKGVIEANGGKVGRIENWGLKSLTYRIKKNRKAHYALMDIDAPPAA
RS6_AGRT5       MALYEHIFLARQDISQQVDALVEQYKGVIESFGGKVGRVENWGLKSLTYRIKKNRKAHYALMDIDAPAAA
RS6_METS4       MALYEHVFLARQDTSQQVESMIEAYKGVIESNGGKVEKTEMWGVKSLAYRIKKNRKAHFTLLNIDAPPAA
RS6_BART1       MALYEHMFLARQDVAQQVDELLSLYKGVIETHGGKVGRVENWGLRPLAYRIRKNRKAYYVLVNIDAPAAA
RS6_OCHA4       MALYEHVLLARQDISQQVDALVEQYKGVLEANGGKVGKVESWGLRPLTYRIKKNRKAYYTLVNIDAPAAA
RS6_BARHE       MALYEHMFLARQDIAQQVDELLNIYKGVIETYGGKVGRVENWGLRPLAYRIRKNRKAYYVLVNIDAPATA
RS6_METPB       MPLYEHVFLARQDTAQQVETMVETYKGVIETGGGTIEKIESWGVKSLAYRIKKNRKAHFTLLNISAPPAA
RS6_RHILO       MALYEHVFLARQDLSQQVDALVEQYKGVISANGGSVGRVENWGLKSLTYRVNKNRKAYYTLMDLNCPPAA
RS6_METEP       MPLYEHVFLARQDTAQQVETMVETYKGVIETGGGTIEKIESWGVKSLAYRIKKNRKAHFTLLNISAPPAA
RS6_METC4       MPLYEHVFLARQDTAQQVETMVETYKGVIETGGGTIEKIESWGVKSLAYRIKKNRKAHFTLLNISAPPAA
RS6_CARHZ       LRQYEVMYILHPEDAEKTESIIERFKGMIEQEGGEVTKIDRWGKRRFAYEIKKLREGYYVVMNFKAKAET
RS6_MESSB       MALYEHVFLARQDLSQQVDALVEQYKGVIESGGGKVGRIENWGVKSLAYRIKKNRKAYFTLMDLDAPAEA
RS6_BRUSU       MALYEHVLLARQDISQQVDALVEQFKGVLEANGGKFGKVENWGLRPLTYRIKKNRKAYYTLVNIDAPAAA
RS6_BRUSI       MALYEHVLLARQDISQQVDALVEQFKGVLEANGGKFGKVENWGLRPLTYRIKKNRKAYYTLVNIDAPAAA
RS6_BRUMB       MALYEHVLLARQDISQQVDALVEQFKGVLEANGGKFGKVENWGLRPLTYRIKKNRKAYYTLVNIDAPAAA
RS6_BRUC2       MALYEHVLLARQDISQQVDALVEQFKGVLEANGGKFGKVENWGLRPLTYRIKKNRKAYYTLVNIDAPAAA
RS6_BRUAB       MALYEHVLLARQDISQQVDALVEQFKGVLEANGGKFGKVENWGLRPLTYRIKKNRKAYYTLVNIDAPAAA
RS6_BRUA2       MALYEHVLLARQDISQQVDALVEQFKGVLEANGGKFGKVENWGLRPLTYRIKKNRKAYYTLVNIDAPAAA
RS6_BRUA1       MALYEHVLLARQDISQQVDALVEQFKGVLEANGGKFGKVENWGLRPLTYRIKKNRKAYYTLVNIDAPAAA
RS6_BUCCC       MRHYEIILMXXXXXXXXXXXXXXXXXXLIHMYKGIIHRFEDWGKRSLSYTIKNLKKAHYFLMNIEVSSEC
RS6_BARQU       MALYEHIFLARQDIAQQVDELLSLYKSVIEAHGGKVGRVENWGLRPLAYRIRKNRKAYYVLINIDAPATA
RS6_RHORT       MALYECVLIARQDISNQVDTMGDEVSAILSEGGGSVSKREYWGLRTLNFRIKKNRKGHYLLLNIDAPAPA
RS6_PARL1       MALYEHIFIARQDVSQQVEALTEQFSNIIKEQGGQVGKTEYWGLRNLAFKVKKNRKGHYTLVNIDAPHAA
RS6_CORA7       MRHYEVMIILDPNQDERVTPSLDKFLEAIRKDGGKVEKVDVWGKRRLAYPINKKEEGIYAVVELECESHS
RS6_AZOC5       MSLYEHVFLVRQDTAQQVEELAARFKGVIEANGGTVSKVEAWGVKSLTYRIKKNRKAHFTLFNIDAPAAA
RS6_BRUME       MALYEHVLLARQDISQQVDALVEQFKGVLEANGGKFGKVENWGLRPLTYRIKKNRKAYYTLVNIDAPAAA
RS6_THETN       MRSYETMYVLSPDNEEERKGLIERFKNLIVERGGEITNFDEWGKRKLAYPIQKKSEGYYVLMNFNSSPDV
RS6_MAGSA       MSLYECVFIARQDISTQVETLTEELSNIITQGGGSVSKKEYWGLRNIAYRVKKNRKGHYVLLNIDAPSAA
RS6_OLICO       MPYYEHVFLARQDASQQVEELTTQITGVIEGLGGKVTKTESWGVRSLTYRIQKNRKAHFVLLNIDGPATI
RS6_CLONN       MRNYETLFILNPSLDEEATAAIEKFKGVIEKEGGVVENVDEWGRRKLAYPINKVNEGYYTLINFKANPEL
RS6_MARMM       MALYEHIFIVRPDVSPQMESLLEETKALIEEKGGKTGKIEYWGLRNLSYRINKSRKGHYGLIDIDAEADV
RS6_METSB       MALYEHIYLARQDVSQQVETLTEQFRGIIESLGGKIEKVEYWGVKTLAYRIKKNRKAHFTLLNIDAPAAA
RS6_BRAJA       MALYEHVFLARQDASQQVEELTAQMTGIVEGLGGKVTKTENWGVRSLTYRMNKNRKAHFVLLNIDAPSAA
RS6_HYPNA       MALYEHVVITRPDISPQVESFIEEMTTFLKEKGATVGKTEYWGLRSLAYPIKKQRKGHYSLINIDGPADA
RS6_BRASO       MPLYEHVFLARQDASQQVEELTTQMTGIVEGLGGKVTKTENWGVRSLTYRMNKNRKAHFVLLNIDAPSAA
RS6_ZYMMO       MPLYEHVFLARQDLAQQVDGLAATATSIIEEKSGKVVKTEIWGLRNLAYRIQKNRKAYYIMLEIDAPADA
RS6_THEPX       MRSYETMYILSPDLSEERKGLIERFKNLIIENGGEITNFDEWGKRKLAYLIDKKPEGYYVLMNFNSDSKV
RS6_THEP3       MRSYETMYILSPDLSEERKGLIERFKNLIIENGGEITNFDEWGKRKLAYLIDKKPEGYYVLMNFNSDSKV
RS6_DESRM       MRNYEVMYIIKPEEEEKVTALMEKFKSVVEEKGAEVTKLDKWGKRRLAYEINKIKEGIYVLMQFKAEPAA
RS6_XANP2       MPLYEHVFLARQDTAQQVEELTTRFKGVIEANGGSVGKTEYWGVKSLTYRINKNRKAHFTLLNINAPAAA
RS6_BRASB       MPLYEHVFLARQDASQQVEELTTQMTGIVEGLGGKVTKTENWGVRSLTYRMNKNRKAHFVLLNIDAPSAA
RS6_RHOPT       MPLYEHVFLARQDASQQVEELTTQITGVIEGLGGKVTKTESWGLRSLTYRMNKNRKAHFVLLNIDGPAAV
RS6_RHOPA       MPLYEHVFLARQDASQQVEELTTQITGVIEGLGGKVTKTESWGLRSLTYRMNKNRKAHFVLLNIDGPAAV
RS6_RHOP2       MPLYEHVFLARQDASQQVEELTTQITGVIEGLGGKVTKTEAWGLRSLTYRMNKNRKAHFVLLNIDGPSAV
RS6_RHOPS       MPLYEHVFLARQDASQQVEELTTQITGVIEGLGGKVTKTEAWGLRSLTYRMNKNRKAHFVMLNIDGPSAV
RS6_CORK4       MRHYEIMIILDPAQDERTVASLDKYLDVVRKEKGNVDKVDIWGKRRLAYPIQKKEEGIYVVVDFTCESAT
RS6_RHOP5       MPLYEHVFLARQDASQQVEELTTQITGVIEGLGGKVVKMEAWGVRSLTYRMNKNRKAHFVLLNIDGPSAV
RS6_GLUOX       MPLYESVLIARNDVSQQVETLVETIETLLKDNGGSIQKREFWGLRSLAYRIKKNRKGHYVLLGLDCTPDT
RS6_BEII9       MALYEHVYLARQDISQQVEALTEQLKSVIESFQGKVTKVEYWGVKSLAYRIKKNRKAHFSLLNIEAPAAA
RS6_CORDI       MRHYEVMIILDPSQDERTVASLDKFLEIVRKENGTVEKVDIWGKRRLAYPIAKKEEGIYAVVNLTCESAT
RS6_RHOPB       MPLYEHVFLARQDASQQVEELTTQITSVIEGLGGKVVKMESWGVRSLTYRMHKNRKAHFVLLNIDGPSAV
RS6_NITHX       MPLYEHVFLARQDSSQQVEELTNQITGVITGLGGKVTKTENWGVRSLTYRMKKNRKAHFVLLNIDGPAAV
RS6_BDEBA       -KPYEVVVLMHPDASEEQKDLFKKNKATIESYKGSINSLETWGKRTLATPIGKLKKAIYFHSTFEADTQA
RS6_RHOCS       MALYETILIARQDTASQVEGLTETFTGILKENGGEVKKVEQWGLKTLTYRIKKNRKAHYVYIGHEAPAAA
RS6_NOVAD       ---------------------------IVESNEGKVTKTETWGLRSLAYKIQKNRKAHFVLLNIEASGAT
RS6_GEOSW       MRKYEIMYIIRPNLDDEAQAVVDRFNNILKENGAEITNVTDWGKRRLAYEIKKYRDGHYMILNVVSEPKA
RS6_DESVM       MRKFETLLLLSPEAADAREALLGTLTGVVEREQGKMVAADHWGMRDLAYPVQKHMRGYYVRLEYLAPGEA
RS6_CLOBM       MRKYETVFILNPALDEEYKANVEKFKGVIENSGGTVDNVDLWGKRKLAYEVKKVSEGYYTLMNFTADTEL
RS6_CLOBH       MRKYETVFILNPTLDEEYKANVEKFKGVIENAGGTVDNVDLWGKRKLAYEVKKVSEGYYTLMNFTADTEL
RS6_CLOB1       MRKYETVFILNPTLDEEYKANVEKFKGVIENAGGTVDNVDLWGKRKLAYEVKKVSEGYYTLMNFTADTEL
RS6_NITWN       MPLYEHVFLARQDSSQQVEELTTQITGVITGLGGKVTKTENWGVRSLTYRMKKNRKAHFVLLNIDGPATI
RS6_DESAH       MRMYETIFITDPDLQDEVNTLFDRFKGILEQEGGILANFDDWGNKKLAYEIAKKPRGHYVCMTYGGTGTL
RS6_CLOBL       MRKYETVFILNPALDEEYKANVEKFKGVIENAGGTVDNVDLWGKRKLAYEVKKVSEGYYTLMNFTADTEL
RS6_CLOBK       MRKYETVFILNPALDEEYKANVEKFKGVIENAGGTVDNVDLWGKRKLAYEVKKVSEGYYTLMNFTADTEL
RS6_CLOBJ       MRKYETVFILNPALDEEYKANVEKFKGVIENAGGTVDNVDLWGKRKLAYEVKKVSEGYYTLMNFTADTEL
RS6_GRABC       MPLYESVLIARNDVTQQVESVADHVASLIEAEGGAIKKREYWGLRTLAYRIKKNRKGHYMLLGLDAKPAT
RS6_CORJK       MRQYEMMIIIDPSQDERTVASLDKYLDIVRKENGSVEKVDIWGKRRLEYPINKKDEGIYVVLDLKCESAT
RS6_MOOTA       MRNYEVVFVIRPDEAEATTAVVEKFTQLITDQGGQVTRVDQWGKKRMAYEVRKYREGYYVLVEFKGTPAV
RS6_GEOKA       MRKYEIMYIIRPNMDDEAQALVERFNNVLKENGAEITNVTDWGKRRLAYEIQKYRDGYYMIVNVVSEPKA
RS6_CAUCR       MAFYEHVVIARQDISQQAEALNEQLKALIEENGGHIAKIEYWGLRNLTYRIKKNRKGHYSLLAIDAPAPA
RS6_CAUCN       MAFYEHVVIARQDISQQAEALNEQLKALIEENGGHIAKIEYWGLRNLTYRIKKNRKGHYSLLAIDAPAPA
RS6_PELTS       MRKYEVIFILRPDLEEEKNAVIEKFKNLIESHGGEIIKIDKWGKRRLAYEVKDFREGFYIVIQINAEPKL
RS6_GLUDA       MPLYETVFIARNDVSQQVEAVADGIAALLETDGGAVKKREYWGLRSLAYRIKKNRKGHYMLLGLDAKPET
RS6_CAUSK       MAFYEHVVIARQDISQQAEALNEQLKALLEENGGHIAKIEYWGLRNLTYRIKKNRKGHYSLLAIDAPAAA
RS6_SILST       MPLYEHVMIARQDLSNQAEGLIEHFGAVLSDNGGKLVDQEYWGVKTMAYKINKNRKGHYAFLRSDAPSSA
RS6_PELCD       MRTYENIMIVHPDKADEYNAVVEKFKGVLTDLNANLLKVDEWGVRKLAYPVKKQGRGSYVLTVFEADPTI
RS6_CLOPS       MRKYETIFVAHPSLDEEVKALIEKFKGVIENGNGTVDNVDFWGKRKLAYEIAKVNEGYYTLINFTANPEL
RS6_CLOPE       MRKYETIFVAHPSLDEEVKALIEKFKGVIENGNGTVDNVDFWGKRKLAYEIAKVNEGYYTLINFTANPEL
RS6_CLOP1       MRKYETIFVAHPSLDEEVKALIEKFKGVIENGNGTVDNVDFWGKRKLAYEIAKVNEGYYTLINFTANPEL
RS6_CLOB6       MRKYETVFILNPALDEEYKANVEKFKSVIENAGGTVDNVDLWGKRKLAYEVKKVSEGYYTLMNFTADTEL
RS6_THEEB       -RNYETLYIIRPDVGEQLEQTISQFRTFLEEQGATKLKVQNRGKRRFAYPIKKLREGYYILMTYTAPGTA
RS6_RICTY       MSFYESVFIIRQDVSNDIDKIVDDFTKIIKDNDGTIIKKEYWGLRTLAYKIGNNKKGHYYFLGIDITSNI
RS6_PARDP       MPLYEHVLIARQDLSNQAEGLIEHFSTVIADNGGKVVDNEYWGVRTLAYKINKNRKGHYAYLRSDAPSAA
RS6_CLOB8       MRKYETIFILNPSFDEEVKANIEKFKGVIENGGGTVENVDFWGKRKLAYEISKVSEGFYTLVNFTANPEL
RS6_CLOAB       MNKYETLFILNPSLDEEINTNVEKFKSVITNGGGEVENVDLWGKRKLAYEIDKVNEGIYVLVNFQSDAQL
RS6_RICPR       MSFYESVFIIRQDVSNDIDKIVDDFTKIIKDNNGTIIKKEYWGLRTLAYKIGNNKKGHYYFLGIDITSNV
RS6_HELMI       MREYEAVVLVRPNEEEALQGVIDKFVNLVPQQGGEVVKVDKWGKRRLQYEVKKFKEAFYFLLNFKGEPAV
RS6_BREBN       MRQYEVMYVLRPDEEEKVKSNVARYSDVVTNYGGEISKLQEMGKRRLAYEINKFREGYYVLMNFKANSDA
RS6_BACWK       MRKYEIMYIIRPGVEEEAQALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYMILNVNSNSEA
RS6_BACHK       MRKYEIMYIIRPGVEEEAQALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYMILNVNANAEA
RS6_BACCZ       MRKYEIMYIIRPGVEEEAQALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYMILNVNANAEA
RS6_BACCR       MRKYEIMYIIRPGVEEEAQALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYMILNVKSNAEA
RS6_BACCQ       MRKYEIMYIIRPGVEEEAQALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYMILNVNANAEA
RS6_BACC7       MRKYEIMYIIRPGVEEEAQALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYMILNVNANAEA
RS6_BACC4       MRKYEIMYIIRPGVEEEAQALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYMILNVKSNAEA
RS6_BACC3       MRKYEIMYIIRPGVEEEAQALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYMILNVNANAEA
RS6_BACC1       MRKYEIMYIIRPGVEEEAQALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYMILNVKSNAEA
RS6_BACC0       MRKYEIMYIIRPGVEEEAQALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYMILNVNANAEA
RS6_BACAN       MRKYEIMYIIRPGVEEEAQALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYMILNVNANAEA
RS6_BACAC       MRKYEIMYIIRPGVEEEAQALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYMILNVNANAEA
RS6_BACAA       MRKYEIMYIIRPGVEEEAQALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYMILNVNANAEA
RS6_SILPO       MPLYEHVMIARQDLSNQAEGLIEHFGAVLSDNGGSLVDHEYWGVKTMAYKINKNRKGHYAFLRTDAPASA
RS6_DESAA       MRRYETIFISDPDPEDNRATLFEKMQGLIAEHDGYIAFFDEWGARKLAYEVKKKKRGYYVLMDFCAEGSL
RS6_CLOK5       MGKYETIFILHPSLDEEYKANVEKFKGVIENGGGVIENVDIWGKRKLAYEIKKVNEGYYTLITFNADPTL
RS6_CLOK1       MGKYETIFILHPSLDEEYKANVEKFKGVIENGGGVIENVDIWGKRKLAYEIKKVNEGYYTLITFNADPTL
RS6_BACHD       MRKYEIMYIIAPNLEEAANKIIERFNGVLTNQGAEIEKVEEMGKRRLAYEINKFREGYYVLLNVKADADA
RS6_BACC2       MRKYEIMYIIRPGVEEEAQALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYMILNVNSNAEA
RS6_STRCO       MRHYEVMVILDPDLEERVSPLIENFLSVVRDGGGKVEKVDTWGRRRLSYEIKKKPEGIYSVIDLQAEPAV
RS6_PROAC       MRKYEVMIIIDPTVEEQVDSLMEKYLKVITDEKGTVDNVDVWGKRRLAYDIQKKSEGIYVVVNATCEPAT
RS6_MICLC       MRAYELMVLIDPEVDERVEPTLKKYLEVVTNAGGTVDNIDVWGRRKTAYEIQKKSEAIYVVVNFQSEPAA
RS6_STRGG       MRHYEVMVILDPDLEERVSPLIENFLSVVREGDGKVEKVDTWGRRRLAYEIKKKPEGIYSVIDLQAEPAV
RS6_ROSDO       MPLYEHVMIARQDLSNQAEGLIEHFGTVLSDNGGKLVDHEYWGVKTMAYKINKNRKGHYAFLRSDAPAPA
RS6_NITSB       MRHYETLFVLKPTLTDEESKAKFEFKEVIQNNGGEIVATEDLGVRKLAYPIQKFERGHYYIIYFTAPSHT
RS6_SPHAL       MPFYEHVFIARQDLSQQVDALAETVTGVIGEYKGQVHKTETWGLKQLAYKIQKNRKGHYVMLSAEVSGXX
RS6_RICCK       MSFYESVFIIRQDISNDIDKIVDDFAKIIKDNNGTIIKKEYWGLRTLAYKIGSNKKGHYYFLGLDITPNV
RS6_STRAW       MRHYEVMVILDPDLEERVSPLIENFLSVVREGNGKVEKVDTWGRRRLSYEIKKKPEGIYSVIDLQAEPAV
RS6_SALAI       MRHYEIMVILDSSLEERTVASLDTYLNVIRTAGGSVEKTDVWGRRRLAYEIDKKTEGIYAVIDLQATPAA
RS6_RICRS       MSFYESVFIIRQDVSNDIDKIVDDFAKIIKDNNGTIIKKEYWGLRTLAYKIGNNKKGHYYFLGLDITGNV
RS6_RICPU       MSFYESVFIIRQDVSNDIDKIVDDFAKIIKDNNGTIIKKEYWGLRTLAYKIGNNKKGHYYFLGLDITGNV
RS6_RICFE       MSFYESVFIIRQDVSNDIDKIVDDFAKIIKDNNGTIVKKEYWGLRTLAYKIGNNKKGHYYFLGLDITGNV
RS6_RICCN       MSFYESVFIIRQDVSNDIDKIVDDFAKIIKDNNGTIIKKEYWGLRTLAYKIGNNKKGHYYFLGLDITGNV
RS6_NATTJ       MRAYEVVYVLTPDEEEQVEEKHNEFKSVIERYGGAPGEIDVWGKRRLAYEIDDYQEGIYALRKFQGENQV
RS6_DINSH       MPLYEHVFISRQDLSNQAESLVEHFGSVLADNGGKVVDSEYWGLKTMAYKINKNRKGHYAFLKTDAPAPA
RS6_DESAP       MRQYEVMYILKPDLEDEESTQLEKFSKIITDRDGEITELNRWGKRRLAYEIKDYREGHYVVMKCRAEHAA
RS6_BACLD       MRKYEIMYIIRPDVDEESKAVVERFNNILTTNGAEITETKDWGKRRLAYEINDFRDGFYQILNVQAGAEA
RS6_BACCN       MKKYEIMYIIRPNMEEEAQALVERFANVLTNNGAEIINTKEWGKRRLAYEINDLRDGFYMILNVNSNPEA
RS6_ALKOO       MNKYELVYILKSNEEEKRNQLLDKFRGIIEADG-TIENVDEWGNRRLAYEINKINEGYYTLVNFSAAADV
RS6_ACIC1       MRHYELMVLLDPDVEERVEPSLDQFLNVVRQDGGTVQKIDVWGRRRLAYEIRKKSEGIYAVIDLIANPQT
RS6_RHOSK       MSLYEHVFIARQDLSNQAEGLIEHFSTVLADNGGKVVDREYWGVKTMAYKINKNRKGHYAFLKSDAPSAA
RS6_RHOS4       MSLYEHVFIARQDLSNQAEGLIEHFSTVLADNGGKVVDREYWGVKTMAYKINKNRKGHYAFLKSDAPSAA
RS6_RHOS1       MSLYEHVFIARQDLSNQAEGLIEHFSTVLADNGGKVVDREYWGVKTMAYKINKNRKGHYAFLKSDAPSAA
RS6_NOCFA       MRHYEVMVILDPSLDERVGPSLENMLGVVKTEGGKIDKVDIWGRRRLAYEIRKQAEGIYAVIDLTASPAT
RS6_EXISA       MRKYELLYIIRPSVDEEAKALIERFNNVITENGGTVEKTTDMGKRRFAYEINKMREGHYVLLNIVAEPKA
RS6_DESVV       MRKFETLLLLSPEAADAREALLTTLSGVVEREQGSMITADHWGMRDLAYPVRKQMRGYYVRLEYTAPGAT
RS6_DESVH       MRKFETLLLLSPEAADAREALLTTLSGVVEREQGSMITADHWGMRDLAYPVRKQMRGYYVRLEYTAPGAT
RS6_BACFR       MNQYETVFILTPVLSDQMKEAVEKFKGILQAEGAEIINEENWGLKKLAYPIQKKSTGFYQLIEFNAEPTV
RS6_BACFN       MNQYETVFILTPVLSDQMKEAVEKFKGILQAEGAEIINEENWGLKKLAYPIQKKSTGFYQLIEFNAEPTV
RS6_STACT       MRTYEIMYVVRPNIEDEAKALVERFNGILTNDGAEIIEEKDWGKRRLAYEIEDFKEGYYYIVRINTESEA
RS6_SALTO       MRHYEIMVILDSSLEERTVASLDTYLNVIRTAGGSVEKTDVWGRRRLAYEIDKKTEGIYAVIDLQATPAA
RS6_PELPD       MRKYETIYILQPDLSDDIKVVADKVQDVITSYKGDFQRLEDWGIRKLAYPINKCARGRYLYLRYDGGREM
RS6_BACTN       MNQYETVFILTPVLSDQMKEAVEKFKGILQAEGAEIINEENWGLKKLAYPIQKKSTGFYQLVEFNADPTV
RS6_RHOS5       MPLYEHVFISRQDLSNQAEGLIEHFSTVLADNGGKVVDREYWGVKTMAYKINKNRKGHYAFLKSDAPSAA
RS6_DESDA       MRKFETLLLLSPELSENREGVVSTFTGIIEREKGVMEEVDNWGMRDLAYPVRKLMRGYYVRLVYQGPAPL
RS6_CYAP7       -KSYEMVYILRPDLEEQVQQEINRYRDFLTENEAQEVQIKYWGKRRLAYPIKKLQDGFYVQMNYQGDGKQ
RS6_CAMHC       MKHYEVLFIVKPTQDDEVKTKVDFVKEVITKNGGEIAAVVEMGTRKLAYKIDKYERGVYFVIYFTAPTKL
RS6_BACV8       MNQYETVFILTPVLSDQMKEAVEKFKGILTAEGAEIINEENWGLKKLAYPIQKKSTGFYQLIEFKAEPQV
RS6_ARTCA       MRPYELMVIIDPEVEERVEPSLQKFLNVITNDGGTIEKVDIWGRRRLAYDIKKKSEGIYAVVNFTAKPET
RS6_ANAVT       ---YETLYILRPDLTDQVELAIAKYQNLLQEQGATDIEVQNRGKRRLAYEIKKQRDGFYVQFNYNAPGKA
RS6_ANASP       ---YETLYILRPDLTDQVELAIAKYQNLLQEQGATDLEVQNRGKRRLAYEIKKQRDGFYVQFNYNAPGKA
RS6_SOLUE       ---YEELFIVKPDASDEVDAFVETLRTQLTAAGATVDKIDKWGKRRLAYRVDKYREGTYVLFQFTSEPTG
RS6_KOCRD       MREYELMVILNPEVEERVEPTLKKFLEVVTKENGTVDKLDIWGRRRLAYEIQKKSEGIYAVVNFTAEPQT
RS6_DESMR       MRKYEALLLLSPEATDNRQEIVENLKGVLERQGTTMLSVDEWGMKDLAYPVQKKTRGHYTRFEFAAPATA
RS6_RHOCA       MPLYEHVLIARQDLSNQAEGLIEHFSTVIGDNGGKVLGTEYWGVKTMAYKINKNRKGHYGFLRTDAPSAA
RS6_GEOSL       VRMYETIVIVQPELGDELKGLTAKVTDIIGSFKGVLHRLEDWGVRKLAYPVKKSVRGRYYYVRFDGDAPL
RS6_CLOD6       MRNYELVYVVKPNSDEEVEAILNKVKEVVATDG-EIVKVDTWGTKKLAYPIAKFTEGFYVLVNFKSAVDV
RS6_PORGI       MNNYETVFILTPVLSDQMKEAVDKFTGLLKQEGAVIVNEENWGLRKLAYPIQKKSTGFYQLVEFQANPDV
RS6_PORG3       MNNYETVFILTPVLSDQMKEAVDKFTGLLKQEGAVIVNEENWGLRKLAYPIQKKSTGFYQLVEFQANPDV
RS6_CYAA5       -QHYEMIFILRPDLSEQVNQAVAKYQEFLTENNATDLQTKIWGKRRLAYPIQKKVDGIYVQFNYQADGSQ
RS6_ARTS2       MRPYELMVIIDPEVEERVEPSLQKFLNVITNDGGTIEKVDIWGRRRLAYEIKKKSEGIYAVVNFTAKPDT
RS6_ARTAT       MRPYELMVIIDPEVEERVESSLQKFLNVITTDGGTIEKVDIWGRRRLAYDIKKKSEGIYAVVNFTAAPAT
RS6_AQUAE       LRYYETVFAVKPTLSEEMKKKFEQVKEFIKQKGGEILYEEDWGMRQLAYPIQKFNNARYFLVQFKTENPQ
RS6_OCEIH       MRKYEIMYIIRPDIEEEAQALIERFNTILTDNGAEIDKVDEKGKRRLAYEINDYRDGYYVIINFRGSEEA
RS6_JANSC       MALYEHVMIARQDLSNQAEALNEHFGAVLADNGGTVVDTEYWGVKTMAYKINKNRKGHYSYLRTDAPSDA
RS6_RICBR       MSFYESVFIVRQDVSNDIDKIVDDFSKIIKDNNGAIVKKEYWGLRALAYKIGNHKKGHYYLLGLDTTPAV
RS6_RICB8       MSFYESVFIVRQDVSNDIDKIVDDFTKIIKDNNGAIVKKEYWGLRALAYKIGNHKKGHYYLLGLDTTPAV
RS6_GEOLS       MRKYETIFILQPDLADDVKSVTDKVQDVVASLKGDFHRLDDWGTRKLAYAIRKFPRGRYYYLRFDGGAQL
RS6_RHOSR       MRHYELMVILDPSLDERTVASLDTFLNVVRQDGGKIDKVDVWGKRRLAYEILKHSEGIYAVIDISATPAT
RS6_RHOOB       MRHYELMVILDPSLDERTVASLDTFLNVVRQDGGKIDKVDVWGKRRLAYEILKHSEGIYAVIDISATPAT
RS6_GEOBB       ---YETIYIVQPDLGDEIKALSTKVQDVIASMNGDFKRVEDWGTRKLAYPINKNPRGRYFYLRFDGDSGL
RS6_FINM2       MNKYELVLIFKPELSEERNTVFSRIQQVIDENG-KLEEVHDWGKRKLAYEINYIKEGYYYIVNFDLDPQF
RS6_MYCTU       MRPYEIMVILDPTLDERTVASLETFLNVVRKDGGKVEKVDIWGKRRLAYEIAKHAEGIYVVIDVKAAPAT
RS6_MYCTA       MRPYEIMVILDPTLDERTVASLETFLNVVRKDGGKVEKVDIWGKRRLAYEIAKHAEGIYVVIDVKAAPAT
RS6_MYCBT       MRPYEIMVILDPTLDERTVASLETFLNVVRKDGGKVEKVDIWGKRRLAYEIAKHAEGIYVVIDVKAAPAT
RS6_MYCBP       MRPYEIMVILDPTLDERTVASLETFLNVVRKDGGKVEKVDIWGKRRLAYEIAKHAEGIYVVIDVKAAPAT
RS6_MYCBO       MRPYEIMVILDPTLDERTVASLETFLNVVRKDGGKVEKVDIWGKRRLAYEIAKHAEGIYVVIDVKAAPAT
RS6_MICAN       --NYETLYILRPDLGEEVQQQVERYRTLITEHSATDIQVKVWGKKRLAYPIKKLNDGVYVQMNYQASGKQ
RS6_STAS1       MRTYEVMYIIRPNEEDAKKAVVERFNGILASHGSEVLEAKDWGKRRLAYEINDFSEGYYNIVRIQADNEA
RS6_GEOSM       ---YETIYIVQPDLGDEIKALSTKVQDVVAGMNGDFKRLEDWGTRKLAYPINKNPRGRYFYLRFDGDSGL
RS6_CORU7       MRQYEVMIIVDPSQDERTVASLDKYLNIVREEKGSVDKVDVWGKRRFEYPIQKKEEGVYIVLDLTCESDT
RS6_BEUC1       MRNYELMIILDPEVDERTVASLDKFLSVIKTGGGSVDNVDIWGKRRLAYEINKRAEGIYAVVNLTATPDL
RS6_BACP2       MRKYEVMYIIRPTVDDEAKAVIERFNNVLTSNGAEITGTKDWGKRRLAYEINDFREGFYQIVNVQSDAAA
RS6_BACA2       MKKYEVMYIIRPNDEESKKAVIERFNNVLTSNGAEITGTKDWGKRRLAYEINDFRDGFYQILNVQSEAAA
RS6_ACICJ       MPLYECVLIARSETQQQVDTIADAVTAQVESESGAVKKREYWGLRNLAYRIKKNRKGHYVLLGLDAEPAT
RR6_GUITH       LNSYETLYIVKPELTDSLAKLIESYQGLLLERGAKNIITQNRGRRTLKYMIKKYKDAHYVQMNYEGNGEV
RS6_BACSU       MRKYEVMYIIRPNDEESKKAVIERFNNVLTSNGAEITGTKDWGKRRLAYEINDFRDGFYQIVNVQSDAAA
RS6_SYNFM       MRKYETFFIIDPDLPDEVTAAVDKIKSVVGANGGDVVSYVPWGKKKLAYPVKKRSRGLYVLMEYAGDSRL
RS6_STAES       MRTYEIMYIVRPNEEDAKKALVERFNGILASEGSEVLEEKDWGKRRLAYEINDFKEGFYNIVRIKTDNKS
RS6_STAEQ       MRTYEIMYIVRPNEEDAKKALVERFNGILASEGSEVLEEKDWGKRRLAYEINDFKEGFYNIVRIKTDNKS
RS6_MYCPA       MRPYEIMVILDPTLDERTVASLETFLNVVRKDGGSVEKVDIWGRRRLAYEIAKHAEGIYVVIDLKAEPAT
RS6_DESHY       MKAYEVLYVIRPDLDDEVAATVDKLSEVVTNNGGADVAIDKWGKRRLAYEVNDYREGFYILMNFNGEART
RS6_DESHD       MKAYEVLYVIRPDLDDEVAATVDKLSEVVTNNGGADVAIDKWGKRRLAYEVNDYREGFYILMNFNGEART
RS6_NOCSJ       MRAYEVMVILDPSLEERVEPSLDKYLNVIRKDGGTVESVDVWGRRRLAYEVKKNAEGIYAVIKLNAEPAT
RS6_GLOVI       ---YETMYILRPDLTDEIDQTITRYQTLLAEQGAAPVETQHRGKRRLAYELKKFKEGIYVQMNYDAPTTA
RS6_CYAP8       ---YEMIYILRPSLSEQVNQEVNKYRDFLNEYNVKDLQVKIWGKRRLAYPIKRFIDGIYVQMNYQGEGNQ
RS6_ALKMQ       MNKYELTYILKSETDEEKRNQLAKFKGIIEADGA-VENVDEWGNRKLAYEIDKRNEGYYVLVNFASSIDV
RS6_SACEN       MRHYELMVILDPSLDERTVASLENFLNVIRNDGGSVEKVDVWGRRRLAYEIDKQAEGIYVVLDLNSEPAS
RS6_CYAP4       ---YETMYIIRPDLGEEVDQVINQYQSLLRDQGAEDVQTQHRGKRRLAYEIRKFREGIYVQMNYKAAGPL
RS6_RHOE4       MRHYELMVILDPSLDERTVASLDTFLNVVRQHGGTIDKVDVWGKRRLAYEILKHAEGIYAVIDINATPAT
RS6_MYCLE       MRPYEIMVILDPTLDETVGPSLETFLNVVRKDGGAIDKVDIWGRRRLAYEISKHAEGIYVVIDLKAAPAT
RS6_FUSNN       MRKYEIMYIINPTVLEEREELVNQVNALLTSNGATIAKTEKWGERKLAYPIDKKKSGFYVLTTFEIDGTK
RS6_THETH       MRRYEVNIVLNPNL-DQSQLALEKIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDR
RS6_THET8       MRRYEVNIVLNPNL-DQSQLALEKIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDR
RS6_THET2       MRRYEVNIVLNPNL-DQSQLALEKIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDR
RS6_CAMJJ       MKHYEVLFILKPTLTEEVNAKLEFVKEVLTKNGAEIETVVPMGTRKLAYKIKKYERGTYFVIYFKAPTNL
RS6_CAMJD       MKHYEVLFILKPTLTEEVNAKLEFVKEVLTKNGAEIETVVPMGTRKLAYKIKKYERGTYFVIYFKAPTNL
RS6_CAMJ8       MKHYEVLFILKPTLTEEVNAKLEFVKEVLTKNGAEIETVVPMGTRKLAYKIKKYERGTYFVIYFKAPTNL
RS6_STAHJ       MRTYEIMYVVRPNEEDAKKAVVERFNGILASEGSEVLEEKDWGKRRLAYEIEDFKEGFYNIVRIKTDNRA
RS6_GEOSF       MRMYETIFIVQPDLGEELKGISARVQEVIVSMKGELKRLEDWGARKLAYPIEKFNRGRYYYLRFDGDXXX
RS6_FLAPJ       MNHYETVFILNPVLSEQVKETVSKFEDYLTSKGATMVSKEDWGLKKMAYEIQNKKSGFYHLFEFTVPGEV
RS6_EHRCJ       ----------------ELEGLVKGLSSLLTKNGAELLKYEYWGLLDFAYTIDKMNKGHYCMIYIKATPSS
RS6_THEFY       MRRYEVMIILDPTLDERTVASLEQFLSVVRNEGGSVEKVDVWGKRRLAYDIGKNSEGIYAVIDLTAKPST
RS6_LEIXX       MHQYELMVILDPEIDERTVASLDKFLNVVRNDGGTIDNVDIWGRRRLAYEINKKSEGIYAVVQLTATGDT
RS6_CAMFF       MKHYELLFILKPTLTDEAKVKVDFIKEVITKNGGEIASVIEMGTRKLAYKIDKYERGTYVVIYFMAPTQL
RS6_BACSK       MRKYEIMYIIAPNLEESANKIIERYNKVLTDNGAEILKVDEIGKKRLAYEINDFKDGFYVLLSVQANTEA
RS6_PROMP       --YYETMYILRPDAEDEVTNHIDKYNKLLEESGGKILDSQMRGKRRLAYQIAKHREGIYVQLSHQGDGQH
RS6_PELPB       -KLYECTLIIDGGLQDEIAAAMALVQRVITEKGGSISSVLEIGRRKTAYPIKKKTIGYYAHIEFTAATSV
RS6_EXIS2       MRKYEVLYIIRPEVDEEAKALVERFNKVLTDNGGTVEKTTEMGKRRFAYEINDMREGFYVLLNVTAEPAA
RS6_DESOH       MRRYETIFIADPDLSPENQAQLEKATTLIDANSGVLVEFDEWGTRRLAYEIRKKPRGHYVRLDFCGDGAT
RS6_CAMLR       MRHYEVLFILKPTLTEEVSAKLEFVKEVLTKNGAEIESVVPMGTRKLAYKIKKYERGTYFVIYFKAPTNL
RS6_SYNS9       --YYETMYILRPDPEEEVESHVTKYRDMIVEAGAEVLDNQMRGKRRLAYPIAKHKEGIYVQLSHNGDGQQ
RS6_STAAW       MRTYEVMYIVRPNEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAYEINDFKDGFYNIVRVKSDNKA
RS6_STAAT       MRTYEVMYIVRPNEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAYEINDFKDGFYNIVRVKSDNKA
RS6_STAAS       MRTYEVMYIVRPNEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAYEINDFKDGFYNIVRVKSDNKA
RS6_STAAR       MRTYEVMYIVRPNEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAYEINDFKDGFYNIVRVKSDNKA
RS6_STAAN       MRTYEVMYIVRPNEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAYEINDFKDGFYNIVRVKSDNKA
RS6_STAAM       MRTYEVMYIVRPNEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAYEINDFKDGFYNIVRVKSDNKA
RS6_STAAE       MRTYEVMYIVRPNEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAYEINDFKDGFYNIVRVKSDNKA
RS6_STAAC       MRTYEVMYIVRPNEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAYEINDFKDGFYNIVRVKSDNKA
RS6_STAAB       MRTYEVMYIVRPNEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAYEINDFKDGFYNIVRVKSDNKA
RS6_STAA9       MRTYEVMYIVRPNEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAYEINDFKDGFYNIVRVKSDNKA
RS6_STAA8       MRTYEVMYIVRPNEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAYEINDFKDGFYNIVRVKSDNKA
RS6_STAA3       MRTYEVMYIVRPNEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAYEINDFKDGFYNIVRVKSDNKA
RS6_STAA2       MRTYEVMYIVRPNEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAYEINDFKDGFYNIVRVKSDNKA
RS6_STAA1       MRTYEVMYIVRPNEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAYEINDFKDGFYNIVRVKSDNKA
RS6_MYCA9       MRQYEIMVILDPTLDERTVASLDTFLNVVRGDGGTVSKVEVWGKRRLAYEIAKHTEGIYAVIDVVAAPAT
RS6_DEHE1       LRDYELVVILTTDTKEKVEAILEGISKTIAEKDGSFTEVNHWGKRKLAYLIGRYGEGYYVFIKMKAKPSS
RS6_PELUB       MNLYEHTIVARQDTSPQVKQLTEKYSKIVEKNEGEIVQTEDWGLLNLAYIIKKNKKGIYMHFKIKGPGKI
RS6_NOSP7       --NYETMYILRPDLGDQAEQAITKYQNLLRDQGAEDIQIQNRGKRRLAYEIKKHRDGIYIQLNYTAPATA
RS6_GEOMG       VRKYETVVIVQPDLGDELKGLNAKVTDIIATMKGDLHRLEDWGVRKLAYPINKSARGRY-----------
RS6_EHRCR       ----------------ELEGLVKGLSSLLTKNGAELLKYEYWGLLDFAYTIDKMNKGHYCMIYIKATPSS
RS6_DESDG       MRKFETLLLLSPELGSQREDLLAVLTGVIEREQGSVLAVDHWGMRDLAYPVRKHMRGYYVRLEYAVAGPS
RS6_CHLPD       -KLYECTVIIDGGLQDEIAAAMEMVQKVIADKGGSISSVLEVGRRKTAYPINKKTIGYYAHIEFTAGTSV
RS6_SYNSC       --YYETMYILRPDPEEEVESHLTKYRDMLVEAGAEVLDNQMRGKRRLAYPIAKHKEGIYVQLSHNGDGQH
RS6_PROVI       -KLYECTVIIDGGLQDEIAEAMAMVQKVITEKGGSIKSVLDIGRRKTAYPINKKTIGYYAHIEFTADTPV
RS6_DEHSC       LRDYELVVILTTDTKEKVEAILEGISKTIAEKEGSFTEVNHWGKRKLAYLIGRYVEGYYVFIKMKAKPSS
RS6_CAMJR       MKHYEVLFILKPTLTEEVNAKLEFVKEVLTKNSAEIETVVPMGTRKLAYKIKKYERGTYFVIYFKAPTNL
RS6_ACIC5       -RFYEVMFIVRPDLAEEVDKIIASLEQTVTNGGGTIRSTEKMGRRKLAYLVRKFSEGNYILLTVDADGPL
RS6_SYMTH       MRKYEMMVIARPDLDEALQALSDKIAELITSNGGTVESQDAWKKQRLAYEIKHLREGFYSVFNFTGEPRT
RS6_PARD8       MNNYETVFILTPVLSDQMKEAVEKFTNLLKAQGAEIVNEENWGLRKLAYPIDKKTTGFYQLVEFKADPSV
RS6_LISMO       -RKYEIMYIIRPNEEDEKKAVVERFDGILTENGAEIIESKEWGKRRLAYEINDYRDGFYHIVKLNAKADS
RS6_LISMH       -RKYEIMYIIRPNEEDEKKAVVERFDGILTENGAEIIESKEWGKRRLAYEINDYRDGFYHIVKLNAKADS
RS6_LISMF       -RKYEIMYIIRPNEEDEKKAVVERFDGILTENGAEIIESKEWGKRRLAYEINDYRDGFYHIVKLNAKADS
RS6_LISMC       -RKYEIMYIIRPNEEDEKKAVVERFDGILTENGAEIIESKEWGKRRLAYEINDYRDGFYHIVKLNAKADS
RS6_GRAFK       MNNYETVFILNPVLSDQIKETVKKYEDFLVSKGAEMVAKEDWGLRKLAYAIQHKKSGFYHLFEYKAPGDA
RS6_EHRRW       ----------------ELEGLVKGLSSLLTKNGAELLKYEYWGLLDFAYAIDKMNKGHYCMMYIRSSSTS
RS6_EHRRG       ----------------ELEGLVKGLSSLLTKNGAELLKYEYWGLLDFAYAIDKMNKGHYCMMYIRSSSTS
RS6_SYNPX       --YYETMYILRPDPEEEVESHLTKYRDMLVEAGADVLDNQMRGKRRLAYPIDKHKEGIYVQLSHNGDGQQ
RS6_LISW6       -RKYEIMYIIRPNEEDEKKAVVERFDGILTENGAEIIESKEWGKRRLAYEINDYRDGFYHIVKLNAKADS
RS6_LISIN       -RKYEIMYIIRPNEEDEKKAVVERFDGILTENGAEIIESKEWGKRRLAYEINDYRDGFYHIVKLNAKADS
RS6_DICTD       MRKYEIMCLISPELSEEDFKTL--YEGIIQNLGGEVQNVDVWGKRTLAYPVKKFTEGYYVVMNFLFPQTQ
RS6_PELLD       -KLYECTVIIDGGLQDEIAAAMEMVQKVITEKGGSISSVLDIGRRKTAYPIKKKTIGSYAHIEFTAATPV
RS6_ORITI       MRLYELVLIVRPESSTEIDKLTDELTSIISNYEGKLVKHEYWGMRSLAYKINRNQRAHYIMLAI------
RS6_ORITB       MRLYELVLIVRPESSTEIDKLTDELTSIISNYEGKLVKHEYWGMRSLAYKINRNQRAHYIMLAI------
RS6_FLAJ1       MNHYETVFILNPVLSEQVKETVTKFEEFLTSRGAEMVSKEDWGLKKMAYEIQNKKSGFYHLFEFKVAGEV
RS6_SYNY3       ---YELMVILRPDLNEEVSQEVTKYQEFLTNNAAEEVSVKVWGKRRLAYQIRRFNDGIYVLFNFNGEGQQ
RS6_PROM4       --YYETMYILRPTPEDEVDSHLKKYTEILESAGGEVLDSQMRGKRRLAYPIGKHKEGIYVQLSHQGDGQH
RS6_HELHP       MKFYETMFILKPTLVEEIKARLDFFKEVIIKNGGEIETCLDMGMRNLAYEIKKNKRGYYFVIYFKAQPSL
RS6_CAMJE       MKHYEVLFILKPTLTEEVNTKLEFVKEVLTKNSAEIETVVPMGTRKLAYKIKKYERGTYFVIYFKAPTNL
RS6_SYNPW       --YYETMYILRPDPEEEVESHLTKYRDILVEAGADVLDNQMRGKRRLAYPIAKHKEGIYVQLSHNGDGQQ
RS6_CHLTE       LKQYECTVIIDGGQDDAIAAVMELVKKTVTDKGGVINNVLEVGRRKMAYLIRKTSIGYYAHIEFDAVPSV
RS6_CAMC5       MKHYELLFILKPTLTEEVKAKVDFVKEVITKNGGEIATVVEMGTRKLAYTIKKYERGTYFVIYYKAPPTL
RS6_SYNS3       --YYETMYILRPDPEEEVESHVTKYRDILTEAGAEVLDNQMRGKRRLAYPIAKHKEGIYVQLSHNGDGQQ
RS6_AZOPC       MNNYEAVFILTPVLSDQVKETVNKFKDILXXXXXXXXXXXXWGLRKLSYPIQRKTTGFYFLLEFKSDSTI
RS6_ACIBL       ---YEVMFIVRPDLTDELDKLVSTLETQVGTAGGTIKSVDKMGKRRLAYEVSTFTDGMYILFTIEGEGAL
RS6_STRMU       MAKYEILYIIRPNEEEAKNALVARFDAVLTDNGATIVESKDWEKRRLAYEIQDFREGLYHVINVETDAHA
RS6_PROM9       --YYETMYILRPDAEDEVTNHIDKYNKLLEEFGGTILDSQMRGKRRLAYQIAKHREGIYVQLSHQGDGQH
RS6_PROM1       --YYETMYILRPDPEEEVDSHLKKYSAILEKSETEVLDSQMRGKRRLAYPIAKHKEGIYVQLSHKGNGQQ
RS6_CHLPB       -KLYECTVIINGGEDDAIAATMDEVRNVIAKNGGDIENVLEVGRRTMAYPIGKQTIGSYAHIEFRGEPSG
RS6_CAMC1       MKHYELLFILKPTLTEEVKAKVDFVKEVITKNGGEIATVIEMGTRKLAYTIKKYERGTYFVIYYKAPPAL
RS6_WOLSU       MRHYETMFIVKPTLTEEIVEKINFYKEAIIKNGGEICATQDMGMRNLAYEINKNKRGYYFVVYFKSAPSL
RS6_SYNJB       ---YETMLIVRPDLSDELEQLLSSQEAILRENGVTHVEITNRGKRRFAFEMKKFKEGLYIQFNYEAEPNA
RS6_STRSV       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEIQDFREGLYHIVNVEANDDA
RS6_STRGC       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEIQDFREGLYHIVNVEANDDA
RS6_CHLL2       -KLYECTVIIDGGLQDEIAAAMEMVQKVITEKGGSISSVLEVGRRKTAYPINKKTIGYYAHIEFTAAAPV
RS6_TRIEI       ---YETMYILRPDMTEEVEQAITKYKSMLEEQGAYDIKIQHRGKLRLAYEINNQREGIYIQMNYQGPPTQ
RS6_SYNR3       --NYETMYILRPDAEEEVESHANKYRDLVVEAGGEVIDSQMRGKRRLAYNIGKHREGIYIQLNYSGDGKQ
RS6_SYNP2       --NYEMMYILRPDLSEQVQEVSSKYKTMLQDSGASDLQVQVRGKRHLAYPIQNFNDGIYIQVNYKADGSQ
RS6_SYNE7       --YYETMYILRADLTEQVEQAIAKYQTLLTEAGAEVQDTQHRGKRRLAYLINKQREGIYVQINYTGDGSQ
RS6_LACAC       ---YEVTYIIKPDDEDNKKALVENYDKVIADNGGTMVESKDWGKRRFAYEIDKYREGTYHIMTFTADADA
RS6_HELP2       MRHYETMFILKPTLEEEIKSKIEFYREVITKHHGVIETSLDMGMRNLAYEIKKHKRGYYYVAYFKAEPSM
RS6_HELAH       MRHYETMFILKPTLEEEIKSKIEFYKEVITKHNGVIETSLDMGMRNLAYEIKKHKRGYYYVMYFKAEPSM
RS6_DICT6       MRKYEIMCLMSPELSEEEFKTL--YESIIQSLGGEVQNVDVWGKRTLAYPVKKFTEGYYVVMNFLFPQNQ
RS6_STRTD       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEIQDFREGIYHVVNVEADATA
RS6_STRT2       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEIQDFREGLYHVVNVEADATA
RS6_STRT1       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEIQDFREGLYHVVNVEADATA
RS6_LACSS       ---YEVTYIISTTLDEESKALVNRFDGILKDNGAEVVDSKDWSKRRLAYEINNQHEGIYHIVNVLADNEA
RS6_LACCB       ---YEVTYIIRPDLDDAAKTLVERFDNILKENGANIIDSKDWQKRKLAYEINKYNEGLYHIVNLSAEDDA
RS6_LACC3       ---YEVTYIIRPDLDDAAKTLVERFDNILKENGANIIDSKDWQKRKLAYEINKYNEGLYHIVNLSAEDDA
RS6_HELPJ       MRHYETMFILKPTLEEEIKSKIEFYREVITKHHGVIETSLDMGMRNLAYEIKKHKRGYYYVAYFKADPSM
RS6_STRU0       MAKYEILYIIRPNEEEAKNALVSRFDSILTDNGATIVESKDWEKRRLAYEINDFREGLYHIVNVESDAVA
RS6_STRS2       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATIVESKAWEKRRLAYEIKDFREGLYHIVNVEANNEA
RS6_STRA5       MAKYEILYIIRPNEEEAKNALVARFDSILSDNGATVVESKDWEKRRLAYEIQDFTEGLYHIVNVEADAVA
RS6_STRA3       MAKYEILYIIRPNEEEAKNALVARFDSILSDNGATVVESKDWEKRRLAYEIQDFTEGLYHIVNVEADAVA
RS6_STRA1       MAKYEILYIIRPNEEEAKNALVARFDSILSDNGATVVESKDWEKRRLAYEIQDFTEGLYHIVNVEADAVA
RS6_CHLT3       -KLYETTIVVDGGLDESIAATVEKVTGLITSLGCEVKTVLDVGRKNLAYPIGKATIGYYVHIEFESDGTA
RR6_PORYE       ---YETVYILKSDNEDKTLSIINDYKSMLTNGGAKNIVLQHRGRRHLSYTINDYHDGIYVQVNYEGNGQL
RS6_STRS7       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATIVESKDWEKRRLAYEINDFREGLYHIVNLEADAVA
RS6_STRPZ       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEINDFREGLYHIVNLEADAAA
RS6_STRPM       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEINDFREGLYHIVNLEADAAA
RS6_STRPG       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEINDFREGLYHIVNLEADAAA
RS6_STRPD       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEINDFREGLYHIVNLEADAAA
RS6_STRPC       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEINDFREGLYHIVNLEADAAA
RS6_STRPB       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEINDFREGLYHIVNLEADAAA
RS6_STRP8       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEINDFREGLYHIVNLEADAAA
RS6_STRP6       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEINDFREGLYHIVNLEADAAA
RS6_STRP3       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEINDFREGLYHIVNLEADAAA
RS6_STRP1       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEINDFREGLYHIVNLEADAAA
RS6_STRE4       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATIVESKDWEKRRLAYEINDFREGLYHIVNLEADAVA
RS6_PROMM       --YYETMYILRPDPEEEVETHVTKYREMVTEAGAEVLDNQMRGKRRLAYPISNHKEGIYVQLSHNGNGQQ
RS6_PROM3       --YYETMYILRPDPEEEVETHVTKYREMVTEAGAEVLDNQMRGKRRLAYPISNHKEGIYVQLSHNGNGQQ
RS6_OENOB       MANYELTYIVRPDDKDAKAALVTRFDSILSDNGAKIDKSEDWDTRRFAYEINNYRQGHIVTFSSE-DEKA
RS6_MAGSM       MAFYESIYILRADTTEQVELVNKRFSDNVAATGGKVVRTELWGRRQLAYLVKKNVKGFYVFHILEGEGSM
RS6_LACRJ       -RKYEITYIIRPDIEESAKSLVDRFDKILADNGATIADSKDWSTRRFAYPIAKYTEGTYHVVNLTTDSQA
RS6_LACRD       -RKYEITYIIRPDIEESAKSLVDRFDKILADNGATIADSKDWSTRRFAYPIAKYTEGTYHVVNLTTDSQA
RS6_LACPL       -KKYEITYIVRPDIDDAAKALVDRFDKILTDNGAQVIDSKDWSKRRFAYEIGGFNEGTYHIVNLTATDDA
RS6_HELPY       MRHYETMFILKPTLEEEIKSKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKRGYYYVAYFKAEPSM
RS6_GEOUR       MRMYETIFIVQPDLGEEMKGISTKVQDVIASMKGDFKRLEDWGPRKLAYPINKFARGRY-----------
RS6_PROM5       --YYETMYILRPDAEEEVKNHIDKYNKLLEEFGATILDSQMRGKRRLAYQIAKHREGIYVQLSHQGDGQH
RS6_LACLA       MTKYEILYIIRPNIDEEAKAALERFDGILTDNGAANLESKDWEKRKLAYEINDFREGHIATFEAETTSEA
RS6_HELPH       MRHYETMFILKPTLEEEIKSKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKRGYYYVAYFKAEPSM
RS6_HELPG       MRHYETMFILKPTLEEEIKSKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKRGYYYVAYFKAEPSM
RS6_STREM       MAKYEILYIIRPNEEEAKNALVARFDSILTNNGATIVESKDWEKRRLAYEINDFREGLYHIVNLEADAVA
RS6_MYCA5       MSNYEIMILANPDSTEQVSELLFS---VLKKSDTKIEKLE---RSELAYPIHKLTRATYYLVTVKSDPQL
RS6_HELPS       MRHYETMFILKPTLEEEIKSKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKRGYYYVAYFKANPSM
RS6_SYNWW       MRTYEMMFVLRPDEEEQVLETKERLQKIIADFGGEINAADGWGKKRLAYAIDDYVEGIYSLWYFKGKPET
RS6_SYNP6       --YYETTYILRADLTEQVEQAIAKYQTPLTEAGAEVQDTQHRGKRRLAYLINKQREGIYVQINYTGDGSQ
RS6_STRZT       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKTWEKRRLAYEIQDFREGLYHIVNVEANDDA
RS6_STRZP       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKTWEKRRLAYEIQDFREGLYHIVNVEANDDA
RS6_STRZJ       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKTWEKRRLAYEIQDFREGLYHIVNVEANDDA
RS6_STRR6       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKTWEKRRLAYEIQDFREGLYHIVNVEANDDA
RS6_STRPS       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKTWEKRRLAYEIQDFREGLYHIVNVEANDDA
RS6_STRPN       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKTWEKRRLAYEIQDFREGLYHIVNVEANDDA
RS6_STRPJ       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKTWEKRRLAYEIQDFREGLYHIVNVEANDDA
RS6_STRPI       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKTWEKRRLAYEIQDFREGLYHIVNVEANDDA
RS6_STRP7       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKTWEKRRLAYEIQDFREGLYHIVNVEANDDA
RS6_STRP2       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKTWEKRRLAYEIQDFREGLYHIVNVEANDDA
RS6_ANAMM       ----------------ELEGLSKGLSALLVKIGAELVKYEYWGLLDFAYSIAKNNKGHYCMMYIRAEPAA
RS6_SULDN       MRNYENLVIVKPTTAEEIQANISAIEEIITSNGGEIAARDAMGMRKLAYPLGKNERGYFHVIYYSVDPSA
RS6_PROMA       --YYETMYILRPDPEDEVEGHLKKYSEVLEKAKAKIIDNQMRGKRRLAYTIGKHKEGIYVQLSHTGNGKH
RS6_LACLS       MTKYEILYIIRPNIDEEAKALVERFDAILTENGAANLESKDWEKRKLAYEINDFREGHIATFEAETTSEA
RS6_LACLM       MTKYEILYIIRPNIDEEAKALVERFDAILTENGAANLESKDWEKRKLAYEINDFREGHIATFEAETTSEA
RS6_LACJO       ---YEVTYIIKPDDEDSKKALIDRFDKVVTDNGAEELESKDWGKRRFAYEIEKYREGTYIMTFVAENSEP
RS6_ENTFA       ---YEIMYIIRPNIDEEAKALVERFDTILKDNGAEVIESKDWEKRRLAYEMNGFREGIYHIVNVTSPSTA
RS6_THEMA       ---YESMFIIAPNPEEERENLVERVKKIIEERKGKIDKVERMGMRKFAYEIKKFNEGDYTVIYFRCDGQN
RS6_PROMT       --YYETMYILRPDPEEEVDSHLKKYSEILEKSETEVLDSQMRGKRRLAYPIAKHKEGIYVQLSHKGNGQQ
RS6_LACGA       ---YEVTYIIKPDDEDSKKALIDRFDKVVTDNGAEELESKDWGKRRFAYEIEKYREGTYIMTFVAENSEP
RS6_LACBA       ---YEITYIIRPDLDDAAKALVERFDKILTDNGAELINSKDWSKRRFAYEIGGFNEGIYHVITLNATDDG
RS6_ACHLI       MRKYELMYIANPQDPEKLKGLVANLSNVITSNGGSVLSLKEIGLKDLAYEINKHRKGYYVWMLVEASPEA
RS6_THEP1       ---YESMFIIAPNPEEERENLVERVKKIIEERKGKIEKVERMGMRKFAYEIKKFSEGDYTVIYFRCDGQN
RS6_LACF3       -RKYEITYIIRPDIEESAKSLVARFDKILADNGATVVDSADWDTRRFAYQIGKYTEGTYHIVNVTADSDS
RS6_CHLP8       LKQYECTVIIDGGQDDAIAAAMELVKKTITDQGSVINNVLEVGRRKMAYLIGKSSVGYYAHIEFDAAPSA
RS6_TREDE       MRNYEL-MTVFPVEEDLYKPGIDALHSILADFGVQIKSEEPFGDRDLAYEIKKKTKGRYVLFNIEADPAK
RS6_LACH4       ---YEVTYIIKPDVDEESKALVENYDKVIADNGGTMVESKDWGKRRFAYEIDKYREGTYHIMTFTADADA
RS6_BIFLO       ---YELMFIADPELDERLKKLTEQYLELVTKEGGSFDEPDYWGRRKLAYEIAGKTEGNYVVVKYTAEPAT
RS6_WOLTR       --------MAEPNQSNKTLEML---LDNIEASG--LIKYEYWGLLDFAYPINKMKSGHYCIMCISSTSNI
RS6_STRP4       MAKYEILYIIRPNEEEAKNALVARFDSILTDNGATVVESKTWEKRRLAYEIQDFREGLYHIVXVEANDDA
RS6_PHYMT       MKKYEILYIMRPNIGDEIKKNVETINKIFYNNENKIIQSKELGLKDLAYCIDKHYKGYYVSMFLNAMPQM
RS6_ANAPZ       ----------------ELEGLSKGLTALLVKMGAELVKYEYWGLLDFVYSIAKNNKGHYCMMYIRAEPAA
RR6_PORPU       ---YETVYLIKSDNEDRTLCIINEYKSMLTNGGAKNIILQHRGRRHLSYSIKDYRDGIYVQVNYEGNGKL
RS6_ELUMP       MRTYETVTILKPQLSDEVAEFLNSAKEFITKAGGEIVSEEKLGRRRFTHEIDHVRDGFYVYLKFRALPAF
RS6_PARUW       ---YEGMYVISATLSDDAHKALDRIQTGITGHGGEIKKLHEQGRRRLAYEIDGHREGYYYLVYFTAPSSA
RS6_RHOBA       ---------------------------LIAENGGEVQVSRMWMEQKLAYPIDKHQKGTYYLIYFSMEGPN
RS6_THEAB       MRIYETMFIIKPDIAEEEREKIGVVEFLKEKLNAQIDNVDRWGIRKTAYPLKKYNEADYTVVYFRATGEN
RS6_MESFL       LRKYEAMFILDQDTQD-VNALSSRMIEIIS-KDGKVIEKNDLGLIEFAYKINHKKKGHYFVVIVEATAEA
RS6_THESQ       --------------------------GIIEERKGKIDKVERMGMRKFAYEIKKFSEGDYTVIYFRCDGQH
RS6_THENN       --------------------------GIIEERKGKIDKVERMGMRKFAYEIKKFSEGDYTVIYFRCDGQH
RS6_CORGL       MRQYELMIILDPSQDERTVASLDKFLEXXXXXXXXXXXXXXXXXXXLAYPIDKKEEGVYAVVDLKCESAT
RS6_CHLCH       -KLYECTAIIDGGLQDEVAATLAMVQRVITEKGGTINSVLDLGRRKTAYPIKKKSMGYYVEFNAAAP---
RS6_COREF       MRQYELMIILDPSQDERTVASLDKFLEXXXXXXXXXXXXXXXXXXXLAYPINKKEEGIYAVIDLKCESAT
RT06_CHICK      MPRYELALILKAMQRPETAAVLKRTVEALMERGAIVRNLENLGERALPYKISKHNHRHYFLVDLEGPPSI
RR6_GRATL       LNKYETIYILQPNITESENLILNEYKALIKKYGGNNIVVQHKGRRHLNYNIKSYYDGIYVQINYTASSNL
RS6_MYCGE       --HYNIILLVDGTLSEQANQVEQKHQKLLEK--ATEFKSEYLGLKELAYPIKKQLSAHYYRWSFHGESNC
RS6_DEIGD       MNQYDLNLILNPNLSEQLQIEKDYIETTLRNNGAEVTKLDDVGNRRMAYPIAKDREGYYLMYTI------
RS6_AKKM8       MRNYEALIVFNMKGTETVEELISTVAAAMKEEGADITATENAGRREFAYESNHLSAGQYVTYTFSAEPSA
RS6_PHYAS       MKKYEIMYILRPNDNNEVKKINDHLESVFSKKPSTILEKKEIGLKDLAYPINNHKKGYYYWFITQTDNEA
RS6_FERNB       MRIYETMFIIKPDVSEERNKLVENVKKFLEERKAQVETVDRWGIRKLAYKIGKYFEGDYTVMYFRSNGQG
RS6_SULNB       ---------------------------------------DDMGMRKLAYPVQKNDRGYYTVLFYKANGEA
RS6_LEPBP       MRNYEITNILREGNVEETKSLLSKYNFTIQGE-------EDWGSKRLWHPVGQDEQGHFTLIKCSGSPTE
RS6_LEPBA       MRNYEITNILREGNVEETKSLLSKYNFTIQGE-------EDWGSKRLWHPVGQDEQGHFTLIKCSGSPTE
RS6_TREPS       -------------------------RALLQENDAVIAREDHIGERELAYPLKKQKRGRYLLFIVQC----
RS6_TREPA       -------------------------RALLQENDAVIAREDHIGERELAYPLKKQKRGRYLLFIVQC----
RS6_THEM4       MRIYETMFIIKPDIAEEEREKIAQ--GVVEKLGAHVDNVDRWGIRKTAYPLKKYNEADYTIVYFRGEGLD
RS6_CHLPN       ----------------------------ITNYGGEIHKIHDQGRKKLAYTIRGAREGYYYFIYFSVSPGA
RS6_LEPBL       ---------------------------------------EDWGQRKLWHPIK--HEEQGIFHHYKCSAEA
RS6_LEPBJ       ---------------------------------------EDWGQRKLWHPIK--HEEQGIFHHYKCSAEA
RS6_LAWIP       ---------------DAREALLVKLVSIIEKNKGQF-TVNHWGMRDLAYPVQKHMRGYYVL---------
RS6_UREU1       MAKYEIMLVVRGDDQEQANKVANELKATLKNTEVKENNYE--GVQQLAYEINKLKTAYRYVYNFETTDVS
RS6_DEIRA       MNQYDLNLILNPNISEQVQTEKDYIENAVRNAGAEISNLDDLGNRRLAYQVGKDREGYYLMYTIK-----
RS6_SYNJA       ---YETMLIVRPDLSDEPXXXXXXXXXXXXXXNGATGEITNRGKRRFAFEMKKFKEGLYIQFNYEAEPRT
RS6_MYCAP       MNKYEIMLIIDP----AIDMAMANVESVFDKKNNKVVKLEN---STLAYPINKSSKAQYVVYTLEAKSEL
RS6_CHLMU       ---------------------LEKVTSGITNYGGEVLKIHDQGRKKLAYTIRGAREGYYYFIYFTVAPEA
RR6_CYACA       LTQYEIMLIMRPDLPEE---KFLKFLSEIKEHAKRNLALENRGRRKLAYAMRKFQDGIYIQFNFLGSGYI
RS6_MYCPE       MPKYEIMLVVDGSEESKATAVANDLKSILKKSTDL--KLEKMGLKDLAYPINKKSRGYYYLFNFEDPA-S
RS6_LEPIN       ---------------------------------------EDWGQRKLWHPIK--HEEQGIFHHYKCSADA
RS6_LEPIC       ---------------------------------------EDWGQRKLWHPIK--HEEQGIFHHYKCSADA
RS6_CHLTR       ---------------------LEKVTSGITNYGGEVLKIHDQGRKKLAYTIRGAREGYYYFIYFTVAPEA
RS6_CHLTB       ---------------------LEKVTSGITNYGGEVLKIHDQGRKKLAYTIRGAREGYYYFIYFTVAPEA
RS6_CHLTA       ---------------------LEKVTSGITNYGGEVLKIHDQGRKKLAYTIRGAREGYYYFIYFTVAPEA
RS6_CHLT2       ---------------------LEKVTSGITNYGGEVLKIHDQGRKKLAYTIRGAREGYYYFIYFTVAPEA
RS6_CHLAB       ---------------------LEKVTSGITNYGGEILKIHDQGRKKLAYTIRGAREGYYYLIYFTVVPGV
RT06_DROME      MPSYELALVLRQLPRPELISVIRRTAESILDKGGIIRKLENLGSRALPHKVSEVHRTHFTIAFDTAPTK-
RS6_UREPA       MAKYEIMLVVRGDDQEQANKVANELKATLKNTEVKENNYD--GVQQLAYEINKLKTAYRYVYNFETTDVS
RS6_UREP2       MAKYEIMLVVRGDDQEQANKVANELKATLKNTEVKENNYD--GVQQLAYEINKLKTAYRYVYNFETTDVS
RS6_MYCPN       ------------------------------------------GLKELAYPIKKQLSAHYYRWKFSGDNQS
RS6_CHLFF       --------------------------------GGEILKIHDQGRKKLAYTIRGAREGYYYLIYFSVVPGV
RS6_DEIDV       MNQYDLNLILNPNLSEQVQIEKDYIETALKNVGAEVSNLDDLGNRRLAYQVGKDREGYYLMYTIK-----
RS6_CHLCV       ---------------------LEKVTSGITNYGGEILKIHDQGRKKLAYTIRGAREGYYYLIYFTVVPGV
RR6_CYAME       ---YELMWLIRPDNQEEIKKEIEAVMKVLEES----RRVQLNGKRKLAYKIGKYEEGHYVQMEFDGYGRI
COG3_YEAST      ---YKVVLDQTRQVNDQLDSSIKKFRKISQDTGAFIEE------------TKTIYEKQSKLSNL---TES


                         .         .         *         .         .         .         .:140
query           LEKLQESLRYNDAILRRLVIATKEAITEPSVMMESNEKEVI
RS6_FRATW       LEKLQESLRYNDAILRRLVIATKEAITEPSVMMESNEKEVI
RS6_FRATT       LEKLQESLRYNDAILRRLVIATKEAITEPSVMMESNEKEVI
RS6_FRATN       LEKLQESLRYNDAILRRLVIATKEAITEPSVMMESNEKEVI
RS6_FRATM       LEKLQESLRYNDAILRRLVIATKEAITEPSVMMESNEKEVI
RS6_FRATH       LEKLQESLRYNDAILRRLVIATKEAITEPSVMMESNEKEVI
RS6_FRAT1       LEKLQESLRYNDAILRRLVIATKEAITEPSVMMESNEKEVI
RS6_FRAP2       LEKLQENLKYNDAVLRRLVISKKEAVTEPSIMMETNEKEVI
RS6_PSEHT       ISELETTFRYNDAVLRNLVMRTKNAVTEASPLVREEKKE--
RS6_HAES2       IDELETTFRYNDAVLRNVIIRTKHAVTEASPMVKAREE---
RS6_VIBCM       VDELETAFRFNDAVLRNMIMRTKAAITEPSIMLKAREERV-
RS6_VIBCH       VDELETAFRFNDAVLRNMIMRTKAAITEPSIMLKAREERV-
RS6_VIBC3       VDELETAFRFNDAVLRNMIMRTKAAITEPSIMLKAREERV-
RS6_HALHL       LDELTSAFRFNDAVIRNMVLSRDEAVTEPSPLAKGNEK---
RS6_ALISL       IDELETAFRYNDAVLRNMIMRTKAAITEPSVMMKAKEE---
RS6_THICR       LKELENLFYYNDAVLRDMFIKRNEAVTEPSVMASQKE----
RS6_MANSM       IDELETTFRYNDAVLRNVIIRTKHAVTEASPMVKAKDE---
RS6_ALHEH       LDELESLFRFNDAVIRNMVLGRDEAVTEPSPLARSQEKD--
RS6_ACTSZ       IDELETTFRYNDAVLRNVIIRTKHAVTEASPMAKAKDERKV
RS6_VIBFM       IDELETAFRYNDAVLRNMIMRTKAAITEPSVMMKAKEE---
RS6_VIBF1       IDELETAFRYNDAVLRNMIMRTKAAITEPSVMMKAKEE---
RS6_PASMU       IDELETTFRYNDAVLRNVIIRTKHAVTEASPMVKAKD----
RS6_HAES1       IDELETTFRYNDAVLRNVIIRTKHAVTEASPMVKAREE---
RS6_BORPD       LDELEHSFRYNDAVLRHLVIKTKKAQTSPSIMMKSVERE--
RS6_HAEIN       IDELETTFRYNDAVLRSLVIHTKHAVTEASPMKAAKEE---
RS6_HAEIG       IDELETTFRYNDAVLRSLVIHTKHAVTEASPMKAAKEE---
RS6_HAEI8       IDELETTFRYNDAVLRSLVIHTKHAVTEASPMKAAKEE---
RS6_SHESR       IEELETAFRFNDAVLRNMVMRTKVAVTEASPMAKAKDE---
RS6_SHESM       IEELETAFRFNDAVLRNMVMRTKVAVTEASPMAKAKDE---
RS6_HAEIE       IDELETTFRYNDAVLRSLVIHTKHAVTEASPMKAAKEE---
RS6_VIBVY       IDELETAFRYNDAVLRNMIMRTKAAITEPSIML--------
RS6_VIBVU       IDELETAFRYNDAVLRNMIMRTKAAITEPSIML--------
RS6_METCA       LEELESGFRFNDAVLRSLTIRRDEAVTEPSALARS------
RS6_CHRSD       LDEIENIFRFNDAIIRSLVVRCKEAITEASPMM--------
RS6_SHEON       IEELETAFRFNDAVLRNMVMRTKGAITEASPMAKAKDE---
RS6_PSYWF       LEELEELFRYNDAIIRSLVVRRDDAITEPSQLAKSADEK--
RS6_SHESA       IEELETAFRFNDAVLRNMVMRTKVAVTEASPMAKAKDE---
RS6_NITOC       IEELTSAFRFNDAVLRDMVIRREEAITETSPLAKGEE----
RS6_AZOSE       LGELEHAFKFNDAVLRHLVVKTKAAVTTPSPMMKEEK----
RS6_VIBHB       IDELETAFRFNDAVLRNMIMRTKAAITEQSIMLK-------
RS6_SHESW       IEELETAFRFNDAVLRNMVMRTKVAVTEASPMARARDE---
RS6_SHEPC       IEELETAFRFNDAVLRNMVMRTKVAVTEASPMARARDE---
RS6_HAEPS       IDELETNFRYNDAVLRSLVLHTKAAVTEASPMLKAKDE---
RS6_POLSQ       LEELEHAFKFNDAVLRHLIIKTKKAETEPSIMMKEVQRE--
RS6_MARMS       LSELNDTFRYNDAIIRNLVIRRKEAVTDVSPIKASEGRE--
RS6_ACIF5       LAELEDAFRFNDAVLRHLILARDEAVTSPSFL---------
RS6_ACIF2       LAELEDAFRFNDAVLRHLILARDEAVTSPSFL---------
RS6_PHOPR       VDELESTFRFNDAVIRNMIMRAKNAVTEPSPMMKAKEE---
RS6_AZOSB       LGELEHAFKFNDAVLRHLTIKMKKAVTTPSPMMKEEK----
RS6_ACTPJ       IDELETNFRYNDAVLRNLIVHTKAAVTEASPM---------
RS6_ACTP7       IDELETNFRYNDAVLRNLIVHTKAAVTEASPM---------
RS6_ACTP2       IDELETNFRYNDAVLRNLIVHTKAAVTEASPM---------
RS6_NITEU       LNELEHSFKFNDAILRHLVIRMNGPITTPSPMMQEGK----
RS6_NITEC       LNELEHSFKFNDAILRHLVIRMNGPVTTPSPMMQDDKSK--
RS6_ALCBS       LGELENTFRFNDAVIRHLVIRRDNAITEPSPLAKHDEKE--
RS6_VIBPA       IDELETAFRFNDAVLRNMIMRTKAAITEQSIMLK-------
RS6_VESOH       LDKLNYNFRFNDAILRSLIISKNKAITTPSIMMVNKDKE--
RS6_IDILO       VEELETAFRYNDAVLRNMIMRKKESITEPSPLTKPKE----
RS6_SHEWM       VEELETAFRFNDAVLRNMVMRTKAAITEASPMAKAKD----
RS6_POLNS       LEELEHAFKFNDAVLRHLIIKTKKAETEPSIMMKEVQHE--
RS6_SHEAM       VEELETAFRFNDAVLRSMVMRTKGAITEASPM---------
RS6_LARHH       LEEIEHAFKFNDAVLRHLTIKMDRAVTEASPMMKEEK----
RS6_HAEDU       IDELETNFRYNDAVLRNLIVHTKAAVKEASLMAKA------
RS6_SHELP       VEELETAFRFNDAVLRSMVMRTKGAITEASPMAKAKD----
RS6_METFK       LNELEHAFKFNDAVLRHLTLNTDEAVTAPSPMMKEEKSK--
RS6_VIBSL       MDELETAFRFNDAVLRNMIMRTKGAVTEQSIMLK-------
RS6_THISH       LAELVSAFRFNDAVIRHMVMLMERAFTEAS-----------
RS6_SHEPW       VEELETAFRFNDAVLRSMVMRTKAAITEASPMAKA------
RS6_BORPE       LDELEHSFRYNDAVLRHLVIKTKKAPAAPSIMMKS------
RS6_BORPA       LDELEHSFRYNDAVLRHLVIKTKKAPAAPSIMMKS------
RS6_BORBR       LDELEHSFRYNDAVLRHLVIKTKKAPAAPSIMMKS------
RS6_CITK8       IDELETNFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_SHEB9       IEELETAFRFNDAVLRNMVMRTKVAVTEASPMAKARDE---
RS6_SHEB8       IEELETAFRFNDAVLRNMVMRTKVAVTEASPMAKARDE---
RS6_SHEB5       IEELETAFRFNDAVLRNMVMRTKVAVTEASPMAKARDE---
RS6_SHEB2       IEELETAFRFNDAVLRNMVMRTKVAVTEASPMAKARDE---
RS6_RUTMC       LDKLNYNFRFNDAILRNLIISEDGVITTPSIMMANKDKE--
RS6_PSEE4       LAELEDNFRYNDAVIRNLVIRRDEAVTGPSEMLKA------
RS6_DICNV       LAELESNFRFNDAILRHMIIRRDEAVTEASMMMQEVKK---
RS6_SHEFN       IEELETAFRFNDAVLRNMVMRTKAAVTEASPMAKA------
RS6_SHEDO       IEELETAFRFNDAVLRNMVMRTKVAVTEASPMAKA------
RS6_METPP       LLELETGFKFNDAVLRHLTVVKSKAETAPSIMMKAVERE--
RS6_HAHCH       IDELMHNFRFNDAILRDLVIRRKDAVTEVSPIKAAESRE--
RS6_ENT38       IDELETNFRFNDAVIRSMVMRTKNAVTEASPMVKA------
RS6_THIDA       LEELEHGFKFNDAVLRHLTIKRDAAVTAASPMMKEEK----
RS6_PSEU5       LAELEDNFRYNDAVIRNLIIRRDEAVTEQSEMLKA------
RS6_PSEAE       LAELEDNFRYNDAVIRNLVMRRDEAVTEQSEMLKA------
RS6_PSEAB       LAELEDNFRYNDAVIRNLVMRRDEAVTEQSEMLKA------
RS6_PSEA8       LAELEDNFRYNDAVIRNLVMRRDEAVTEQSEMLKA------
RS6_PSEA7       LAELEDNFRYNDAVIRNLVMRRDEAVTEQSEMLKA------
RS6_PROMH       IDELETTFRFNDAVLRNMIMRTKHAVTEASPMVKA------
RS6_NITMU       LDELEHAFKFNDAILRHLTLKMDEPVTAPSPMMREEK----
RS6_ACIBY       LDELEELFRYNDAIIRNLIIRREHAITEESLL---------
RS6_ACIBT       LDELEELFRYNDAIIRNLIIRREHAITEESLL---------
RS6_ACIBS       LDELEELFRYNDAIIRNLIIRREHAITEESLL---------
RS6_ACIB5       LDELEELFRYNDAIIRNLIIRREHAITEESLL---------
RS6_ACIB3       LDELEELFRYNDAIIRNLIIRREHAITEESLL---------
RS6_TOLAT       IDELENNFRFNDAVIRNMIMRTKHAVTEASPMLK-------
RS6_SERP5       IDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDE---
RS6_COXB1       ISELENAFRYNDAVIRSLILKRDHAITQSSLIMQGAEK---
RS6_CHRVO       LAEIEHAFKFNDAVLRHLTIKMDRAISDASPMMKDEK----
RS6_AZOVD       LSELEDNFRYNDAVIRNLVIRRDEAITGQSEMLKA------
RS6_SHISS       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_SHIFL       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_SHIF8       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_SHIDS       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_SHIBS       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_SHIB3       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_SALTY       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_SALTI       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_SALSV       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_SALPK       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_SALPC       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_SALPB       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_SALPA       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_SALNS       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_SALHS       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_SALG2       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_SALEP       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_SALDC       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_SALCH       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_SALA4       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_PSEF5       LAELEDNFRYNDAVIRNLVIRREEAITGQSEMLKA------
RS6_ESCF3       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_ENTS8       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_ECOUT       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_ECOSM       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_ECOSE       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_ECOLU       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_ECOLI       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_ECOLC       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_ECOL6       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_ECOK1       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_ECOHS       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_ECODH       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_ECOBW       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_ECO8A       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_ECO81       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_ECO7I       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_ECO5E       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_ECO57       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_ECO55       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_ECO45       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_ECO27       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_ECO24       IDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA------
RS6_YERPY       IDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDE---
RS6_YERPS       IDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDE---
RS6_YERPP       IDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDE---
RS6_YERPN       IDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDE---
RS6_YERPG       IDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDE---
RS6_YERPE       IDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDE---
RS6_YERPB       IDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDE---
RS6_YERPA       IDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDE---
RS6_YERP3       IDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDE---
RS6_YERE8       IDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDE---
RS6_SALAR       IDELETTFRFNDAVIRSMIMRTKHAVTEASPMVKA------
RS6_RALEJ       LAELEHAFKFNDAVLRHLIVQTKKAETAPSPMMKEVQRE--
RS6_PSEFS       LAELEDNFRYNDAVIRNLVIRREEAVTGQSEMLKA------
RS6_NEIGO       VGELETAFRFNDAVLRHLTIKTKHAVTEASPML--------
RS6_NEIG1       VGELETAFRFNDAVLRHLTIKTKHAVTEASPML--------
RS6_MARAV       MDELTHNFRFNDAIIRDLILRRDEAVTDLSPM---------
RS6_COLP3       IDELETAFRYNDVVIRNMIMRTKDAVTEASPM---------
RS6_CELJU       LEELTTNFRYNDAVLRSLVIREDAAITEESFIL--------
RS6_PSEU2       LAELEDNFRYNDAVIRNLVIRRDEAVTGQSEMLKA------
RS6_PSESM       LAELEDNFRYNDAVIRNLVIRRDEAVTGQSEMLKA------
RS6_PSEPW       LAELEDNFRYNDAVIRNLVIRRDEAVTGQSEMLKA------
RS6_PSEPK       LAELEDNFRYNDAVIRNLVIRRDEAVTGQSEMLKA------
RS6_PSEPG       LAELEDNFRYNDAVIRNLVIRRDEAVTGQSEMLKA------
RS6_PSEPF       LAELEDNFRYNDAVIRNLVIRRDEAVTGQSEMLKA------
RS6_PSEP1       LAELEDNFRYNDAVIRNLVIRRDEAVTGQSEMLKA------
RS6_PSE14       LAELEDNFRYNDAVIRNLVIRRDEAVTGQSEMLKA------
RS6_JANMA       LAEIETGFKFNDAVLRHLTVKMKKAETAPSPMMKAVQKE--
RS6_PSYCK       LAELEELFRYNDAIIRSLVMRRDDAVTEESQLAKNADEK--
RS6_PSYA2       LAELEELFRYNDAIIRSLVMRRDDAVTEESQLAKNADEK--
RS6_PSEMY       LAELEDNFRYNDAVIRNLVIRRDEAVTGQSEMLK-------
RS6_EDWI9       IDELETNFRYNDAVIRSMVMRTKHAVTEASPMVKAKD----
RS6_PHOLL       IDELETNFRFNDAVIRSMIMRVKHAVTEASPMVKAKDE---
RS6_HERAR       LTEIETGFKFNDAVLRHLTVKMKKAETAPSPMMKAVQKE--
RS6_HAMD5       INELETNFRFNDAVMRNLIKRMNHAVTEPIIKMKDERREVV
RS6_AERHH       IDELETNFRFNDAVIRNMIMRTKHAVTEVSPMAKA------
RS6_TERTT       LEELTTNFRYNDAILRNMVIRCDEAVTEES-----------
RS6_ERWT9       IDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKD----
RS6_DECAR       LNELEHSFKFNDAVLRHLTVKMKAAVT--------------
RS6_BURXL       LDELEHAFKFNDAVLRHLIVKMKKAETGPSPMMKEVQRE--
RS6_BURPP       LDELEHAFKFNDAVLRHLIVKMKKAETGPSPMMKEVQRE--
RS6_BORA1       LDELEHSFRYNDAVLRHLVIKTKKAPVGASIMMK-------
RS6_SACD2       LEELTTNFRYNDAVLRNMIIRCDEAVTEESPIMK-------
RS6_COXBU       ISELENAFRYNDAVIRSLILKRDHAITKSSLIMQGAEK---
RS6_COXBR       ISELENAFRYNDAVIRSLILKRDHAITKSSLIMQGAEK---
RS6_COXB2       ISELENAFRYNDAVIRSLILKRDHAITKSSLIMQGAEK---
RS6_RALPJ       LAELEHAFKFNDAVLRHLIVQTKKAETAPSPMM--------
RS6_PECCP       IDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKA------
RS6_ERWCT       IDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKA------
RS6_ALTMD       VDELENAFRFNDVILRNMVMRTKTAVT--------------
RS6_VEREI       MAELEHAFKFNDAVLRHLTVHKKKAVTGPSAMMKTVERE--
RS6_STRM5       LNELTESFRFNDAVLRNLVIKRDEADTEQSLIMKSKDEK--
RS6_RALSO       LAELEHAFKFNDAVLRHLIVQTKKAETAPSPMM--------
RS6_RALEH       LAELEHAFKFNDAVLRHLIVQTKKAETAPSPMMKEVQRE--
RS6_CUPTR       LAELEHAFKFNDAVLRHLIVQTKKAETAPSPMMKEVQRE--
RS6_SODGM       IDELETVFRFNDAVIRSMIMRVKHAVTEASPMVKAKD----
RS6_RALME       LAELEHAFKFNDAVLRHLIVQTKKAETAPSPMMKEVQRE--
RS6_BURTA       LDELEHAFKFNDAVLRHLIVKMKKAETGPSPMM--------
RS6_BURPS       LDELEHAFKFNDAVLRHLIVKMKKAETGPSPMM--------
RS6_BURP6       LDELEHAFKFNDAVLRHLIVKMKKAETGPSPMM--------
RS6_BURP1       LDELEHAFKFNDAVLRHLIVKMKKAETGPSPMM--------
RS6_BURP0       LDELEHAFKFNDAVLRHLIVKMKKAETGPSPMM--------
RS6_BURMS       LDELEHAFKFNDAVLRHLIVKMKKAETGPSPMM--------
RS6_BURMA       LDELEHAFKFNDAVLRHLIVKMKKAETGPSPMM--------
RS6_BURM9       LDELEHAFKFNDAVLRHLIVKMKKAETGPSPMM--------
RS6_BURM7       LDELEHAFKFNDAVLRHLIVKMKKAETGPSPMM--------
RS6_BURCJ       LDELEHAFKFNDAVLRHLIVKMKKAETGPSPMM--------
RS6_BURCC       LDELEHAFKFNDAVLRHLIVKMKKAETGPSPMM--------
RS6_DELAS       MAELEHAFKFNDAVLRHLTVQKKKADTAPSSMMKTVERE--
RS6_COXBN       ISELENAFRYNDAVIRSLILKRDHAITKSSLIMQ-------
RS6_BURP8       LDELEHAFKFNDAVLRHLIVKMKKAETGPSPMM--------
RS6_BAUCH       MDELSKYLRFNEAIIRSMIMRVKHIVTEASPMVKTKDDNLV
RS6_POLNA       MEEIEHAFKFNDAVLRHLTVVKKKAETGPSLMMRNVERE--
RS6_BURS3       LDELEHAFKFNDAVLRHLIVKMKKAETGPSPMM--------
RS6_BURM1       LDELEHAFKFNDAVLRHLIVKMKKAETGPSPMM--------
RS6_RHOFD       MAELEHAFKFNDAVLRHLTVLKKKADTGPSSMMKTVERE--
RS6_KLEP7       IDELETNFRFNDAVIRSMVMRTKHAVTEASPMVKAKD----
RS6_KLEP3       IDELETNFRFNDAVIRSMVMRTKHAVTEASPMVKAKD----
RS6_BURVG       LDELEHAFKFNDAVLRHLIVKMKKAETGPSPMM--------
RS6_BURCM       LDELEHAFKFNDAVLRHLIVKMKKAETGPSPMM--------
RS6_BURCH       LDELEHAFKFNDAVLRHLIVKMKKAETGPSPMM--------
RS6_BURCA       LDELEHAFKFNDAVLRHLIVKMKKAETGPSPMM--------
RS6_BURA4       LDELEHAFKFNDAVLRHLIVKMKKAETGPSPMM--------
RS6_POLSJ       MEEIEHAFKFNDAVLRHLTVVKKKAETGPSLMMRN------
RS6_LEGPL       LNEIKNAFKFNDAILRHLITVQKQAITTESVLMK-KEKE--
RS6_LEGPH       LNEIKNAFKFNDAILRHLITVQKQAITTESVLMK-KEKE--
RS6_LEGPC       LNEIKNAFKFNDAILRHLITVQKQAITTESVLMK-KEKE--
RS6_LEGPA       LNEIKNAFKFNDAILRHLITVQKQAITTESVLMK-KEKE--
RS6_XANC5       LSELVESFRFNDAVLRHLVVKRDGADTEQSLIMKSKDEK--
RS6_XANAC       LSELVESFRFNDAVLRHLVVKRDGADTEQSLIMKSKDEK--
RS6_NEIMB       XXXXXXAFRFNDAILRHLTIKTKHAVTEASPML--------
RS6_ACIAC       MAELEHAFKFNDAVLRHLTVVKKKAETGASSMMKTVERE--
RS6_VARPS       MGELEHAFKFNDAVLRHLTVQKKKAETGPSSMMKT------
RS6_PSYIN       IDDLENAFRFNDSVIRNMIMRTKTAVT--------------
RS6_NEIMF       XXXXXXAFRFNDAVLRHLTIKTKHAVTEASPML--------
RS6_NEIMA       XXXXXXAFRFNDAVLRHLTIKTKHAVTEASPML--------
RS6_NEIM0       XXXXXXAFRFNDAVLRHLTIKTKHAVTEASPML--------
RS6_LEPCP       LAEIETGFRFNDAVLRHLTVKRDKAETGPSAVMKRVEKE--
RS6_XANCP       LSELVESFRFNDAVLRHLVIKRDGPDTEQSLIMKSKDEK--
RS6_XANCB       LSELVESFRFNDAVLRHLVIKRDGPDTEQSLIMKSKDEK--
RS6_XANC8       LSELVESFRFNDAVLRHLVIKRDGPDTEQSLIMKSKDEK--
RS6_XANOR       LSELVESFRFNDAVLRHLVVKRDGPDTEQSLIMKSKDEK--
RS6_XANOP       LSELVESFRFNDAVLRHLVVKRDGPDTEQSLIMKSKDEK--
RS6_XANOM       LSELVESFRFNDAVLRHLVVKRDGPDTEQSLIMKSKDEK--
RS6_SHESH       XXXLETAFRFNDAVLRSMVMRTKAAITEASPM---------
RS6_XYLFM       LNELVDLFRFNDAILRHLAIKRSGPYTEQSFIMKS------
RS6_ACIAD       LDELEELFRYNDAXXXXXXXXXEHAITEESLL---------
RS6_DIAST       MAELEHAFKFNDAVLRHLTVQKKKAETGASSMMKTVERE--
RS6_ACISJ       MAELEHAFKFNDAVLRHLTVQKKKAETGASSMMKTVERE--
RS6_XYLFT       LNELVDLFRFNDAILRHLAIKRSGPDTEQSFIMKS------
RS6_XYLFA       LNELVDLFRFNDAILRHLAIKRSGPDTEQSFIMKS------
RS6_XYLF2       LNELVDLFRFNDAILRHLAIKRSGPDTEQSFIMKS------
RS6_BUCAP       ISLLETDFRFNNAVIRNIIISVKKAINEPS-----------
RS6_SHEPA       XXXXXXXFRFNDAVLRSMVMRTKAAITEASPMAKA------
RS6_SHEHH       XXXXXXXFRFNDAVLRSMVMRTKAAITEASPMAKA------
RS6_AERS4       IDELETNFRFNDAVIRNMIMRTKHAVTEVSPMAKA------
RS6_BUCBP       IQDLSNTFRYDDLVIRNIIMHVKKSVTEISPM---------
RS6_BLOPB       VKELNDDFHFNKNIIRSMIVRTKYAIVEPSPMMKKIEE---
RS6_BUCAT       ITLLETDFRFNNIILRNMIMSVKKAIVELS-----------
RS6_BUCAI       ITLLETDFRFNNIILRNMIMSVKKAIVELS-----------
RS6_BUCA5       ITLLETDFRFNNIILRNMIMSVKKAIVELS-----------
RS6_WIGBR       XXXXXXXXXXXXXXXRNMIMRVKNAINEPSPMKKTKENK--
RS6_BLOFL       LDILDNDFRFNEIILRYLIMRTKNIIVDPSAMVKKKD----
RS6_METNO       LAEMERQMRISEDILRFLTIRVEALETEPSAMMQ-------
RS6_RHISN       VHEVERQMRINEDILRYMTIAVEKHEEGPSAMMQ-------
RS6_AGRVS       VHEVERQMRINEDVLRYMTIAVEAHEEGPSAMMQ-------
RS6_RHILW       VQEMERQMRISEDVLRYMTIAVEKHEEGPSAMMQ-------
RS6_RHIL3       VQEMERQMRISEDVLRYMTIAVEKHEEGPSAMMQ-------
RS6_METRJ       IAEMERQMQISEDVLRFMTIRVEELDSEPSAMMQ-------
RS6_RHIME       VHEVERQMRINEDVLRYMTIAVGKHEEGPSAMMQ-------
RS6_RHIE6       IQEMERQMRISEDVLRYMTIAVEKHEEGPSAMLQ-------
RS6_BARBK       IAEMERQMRINEDILRYITIRVEKHEKEQSAMLSRPDRD--
RS6_AGRRK       VHEMERQMRISEDVLRYMTIAVEKHEEGPSAMMQ-------
RS6_SINMW       VHEVERQMRINEDILRYMTIAVDKHEEGPSAMMQ-------
RS6_RHIEC       IQEMERQMRISEDVLRYMTIAVEKHEEGPSAMLQ-------
RS6_AGRT5       VHEVERQMRINEDVLRYMTIAVEAHEEGPSAMMQ-------
RS6_METS4       LAEMERQMRISEDILRFLTIRVDALEGEPSAMMQ-------
RS6_BART1       IAEMERQMRINEDILRYMTIRVEKHEKEKSAML--------
RS6_OCHA4       VAEMERQMRINEDVLRFLTVRVEEHEEGQSAML--------
RS6_BARHE       IAEVERQMRINEDILRYMTIRVEKHEKEKSAM---------
RS6_METPB       LAEMERQMQISEDVLRFMTVRVEQLEAEPSAMMQ-------
RS6_RHILO       LNEMERQMGLSEDVLRFLTIKVEAHEEGPSAMMQKREE---
RS6_METEP       VAEMERQMQISEDVLRFMTVRVEQLEAEPSAMMQ-------
RS6_METC4       VAEMERQMQISEDVLRFMTVRVEQLEAEPSAMMQ-------
RS6_CARHZ       AQELDRLLRISDDVVRHIVI---------------------
RS6_MESSB       VKEMERQMGISEDILRFMTIRVEAHEEGPSAMLQ-------
RS6_BRUSU       VAEMERQMRINEDVLRFLTVRVEEHEEGQSAML--------
RS6_BRUSI       VAEMERQMRINEDVLRFLTVRVEEHEEGQSAML--------
RS6_BRUMB       VAEMERQMRINEDVLRFLTVRVEEHEEGQSAML--------
RS6_BRUC2       VAEMERQMRINEDVLRFLTVRVEEHEEGQSAML--------
RS6_BRUAB       VAEMERQMRINEDVLRFLTVRVEEHEEGQSAML--------
RS6_BRUA2       VAEMERQMRINEDVLRFLTVRVEEHEEGQSAML--------
RS6_BRUA1       VAEMERQMRINEDVLRFLTVRVEEHEEGQSAML--------
RS6_BUCCC       IKELENSFKFNINIIRYFILTRTKA----------------
RS6_BARQU       IAEVERQMHINEDILRYMTVRVEKHEKEKSAM---------
RS6_RHORT       VHELDRRLRLNEDVIRHMTVKVEELEEAPSAMMQKN-----
RS6_PARL1       VAEMERQMGISEDVLRFITVRVEEHETEPSAMMQS------
RS6_CORA7       VLELDRRLNLNDSILRTKVLRT-------------------
RS6_AZOC5       VQEMERQMGIDEDVLRFLTIRVDELEEGPSAMLQ-------
RS6_BRUME       VAEMERQMRINEDVLSFLTVRVEEHEEGQSAML--------
RS6_THETN       SRELERVYRITDGVLRYLIIRTDD-----------------
RS6_MAGSA       VKEMERQMSINEDVLRTLTIRVEELEEGPSAMMQS------
RS6_OLICO       VAEVERQERINEDIIRYLTVRVDELEEGPSAMM--------
RS6_CLONN       PRELERVFRITDGVMRFMVV---------------------
RS6_MARMM       INELERLQRLSEDVIRHMTLRVEAHTEEPSAILTKKD----
RS6_METSB       ITEMERQSSLNEDVLRLLTIRVEALEAGQSAMM--------
RS6_BRAJA       IAEIERQERISEDVIRYLSVRVEELEEGPSAMM--------
RS6_HYPNA       IHELERRQRIAEDVMRYMTVRVETLSDEPSPVLSRKER---
RS6_BRASO       IAEIERQERISEDVIRYLSVRVEELEEGPSAMM--------
RS6_ZYMMO       IQELERQMALNEDVIRYMTVRVDAHEQGPSAMM--------
RS6_THEPX       SQELERVYKITDGVLRYLIIRTDE-----------------
RS6_THEP3       SQELERVYKITDGVLRYLIIRTDE-----------------
RS6_DESRM       SAELDRVMKINDDIVRHMIIREGE-----------------
RS6_XANP2       IQELERQQRIDEDVLRILTLRVEEHEEGPSAMLQ-------
RS6_BRASB       IAEIERQERISEDVIRYLSVRVDELEEGPSAMM--------
RS6_RHOPT       VSEIERQERINEDVIRYLTVRVDEHEEGPSAMM--------
RS6_RHOPA       VSEIERQERINEDVIRYLTVRVDEHEEGPSAMM--------
RS6_RHOP2       VSEIERQERINEDIVRYLTVRVDEHEEGPSAMM--------
RS6_RHOPS       VAEVERQERINEDIIRYLTVRVEEHEEGPSAMM--------
RS6_CORK4       VLEVDRLLNLNDSVLRTKVLRT-------------------
RS6_RHOP5       VAEVERQERINEDVIRYLTVRVDEHEEGPSAMM--------
RS6_GLUOX       LRELERQLGLNEDVLRVLTLRVDEIDENPSSVL--------
RS6_BEII9       LTEMERQMGINEDVLRFMTLRVEEHEQGPSAMM--------
RS6_CORDI       VLELDRVLNLNDSVMRTKVL---------------------
RS6_RHOPB       VAEVERQERINEDVIRYLTVRVDELEEGPSAMM--------
RS6_NITHX       VSEIERQERIHEDVIRYLSIRVEEHEEGPSAMM--------
RS6_BDEBA       IAELERTMRINDKVLR-------------------------
RS6_RHOCS       VAEMERNMSINEDVLRFMTVKV-EKIEEGQTAMLTNKGE--
RS6_NOVAD       IAELERQTQINEDVIRYMTVRVDEHEAGPSVMMRKND----
RS6_GEOSW       VQEFDRLARISDDIIRHIVV---------------------
RS6_DESVM       VAEVERNIRISDGIFKFVTVKLADAVEE-------------
RS6_CLOBM       PKELDRVFRITDTVIRHMII---------------------
RS6_CLOBH       PKELDRVFRITDTVIRHMII---------------------
RS6_CLOB1       PKELDRVFRITDTVIRHMII---------------------
RS6_NITWN       VNEIERQERIHEDVIRYLTVRVDEHEDGPSAMM--------
RS6_DESAH       VTELERNFRLDDKILKYMTILLEKDIDPEALKLQ-------
RS6_CLOBL       PKELDRVFRITDTVIRHMII---------------------
RS6_CLOBK       PKELDRVFRITDTVIRHMII---------------------
RS6_CLOBJ       PKELDRVFRITDTVIRHMII---------------------
RS6_GRABC       ITEVERQLRLNEDVLRFMTIRVEEIDDVPSVILKSDDRE--
RS6_CORJK       VLEIDRLLNINDQILRTKVL---------------------
RS6_MOOTA       AQELERVLKISDDVIRYLITRLEE-----------------
RS6_GEOKA       VQEFDRLARISEDIIRHIVVKEEE-----------------
RS6_CAUCR       VKEMERQLLINEDVLRFMTIRVEELDLELSPVL--------
RS6_CAUCN       VKEMERQLLINEDVLRFMTIRVEELDLELSPVL--------
RS6_PELTS       AAELDRVFKITDEVLRHMIVRENE-----------------
RS6_GLUDA       IKEIERQLGLNEDVMRVLTLRVDEIDEAPSVILSRKGDE--
RS6_CAUSK       VKEMERQLLINEDVLRFMTIRVEELDLELSPVL--------
RS6_SILST       VQEMERLMRLHDDVMRVLTIKVEEHAEGPSVQMQ-------
RS6_PELCD       IDEYERRLRLDEAVIK-------------------------
RS6_CLOPS       PKELDRVFGITDGIIRHIIVKEEQ-----------------
RS6_CLOPE       PKELDRVFGITDGIIRHIIVKEEQ-----------------
RS6_CLOP1       PKELDRVFGITDGIIRHIIVKEEQ-----------------
RS6_CLOB6       PKELDRVFRITDTVIRHMII---------------------
RS6_THEEB       IAPLERAMRLNENILRFMTI---------------------
RS6_RICTY       KEELERKMKLNESIIRFLTIKVDSISSEPSPILKNQSTE--
RS6_PARDP       VQEMERLARLHDDVMRVLTVRVDEHKDGPSVQMQ-------
RS6_CLOB8       PRELDRIFRITDGVIRHIIV---------------------
RS6_CLOAB       PKELDRVFRISDSIIRHLIISLEK-----------------
RS6_RICPR       KEELERKMKLNENIIRFLTIKADSISSEPSPILKNQSTE--
RS6_HELMI       AQELERVMKISDDIIRFLVVRKDE-----------------
RS6_BREBN       VAEAERLMKINDDVIRFMFV---------------------
RS6_BACWK       INEFDRLAKINEDILRHIVVKEEE-----------------
RS6_BACHK       INEFDRLAKINEDILRHIVVKEEE-----------------
RS6_BACCZ       INEFDRLAKINEDILRHIVVKEEE-----------------
RS6_BACCR       INEFDRLAKINEDILRHIVVKEEE-----------------
RS6_BACCQ       INEFDRLAKINEDILRHIVVKEEE-----------------
RS6_BACC7       INEFDRLAKINEDILRHIVVKEEE-----------------
RS6_BACC4       INEFDRLAKINEDILRHIVVKEEE-----------------
RS6_BACC3       INEFDRLAKINEDILRHIVVKEEE-----------------
RS6_BACC1       INEFDRLAKINEDILRHIVVKEEE-----------------
RS6_BACC0       INEFDRLAKINEDILRHIVVKEEE-----------------
RS6_BACAN       INEFDRLAKINEDILRHIVVKEEE-----------------
RS6_BACAC       INEFDRLAKINEDILRHIVVKEEE-----------------
RS6_BACAA       INEFDRLAKINEDILRHIVVKEEE-----------------
RS6_SILPO       VQEMERLMRLHDDVMRVLTIKVDEHAEGPSVQMQ-------
RS6_DESAA       IAEMERIMRIDDRILKFLTIQTEEEV---------------
RS6_CLOK5       PKELDRVFRITDTVVRHIIV---------------------
RS6_CLOK1       PKELDRVFRITDTVVRHIIV---------------------
RS6_BACHD       IAEFNRLIKINDNVIRVLITKDEE-----------------
RS6_BACC2       INEFDRLAKINEDILRHIVVKEEE-----------------
RS6_STRCO       VKELDRQMNLNESVLRTKVL---------------------
RS6_PROAC       IQELDRLLAIDEKIMRTKVM---------------------
RS6_MICLC       TQELDRLLNLNETILRTKIIRPEE-----------------
RS6_STRGG       VKELDRQMNLNESVLRTKVL---------------------
RS6_ROSDO       VHEMERLMRLHDDVMRVLTIKVDEHAELPSVQMQ-------
RS6_NITSB       VLELERIYRITEDVIRFLTIETKKDISAWEKMVERAKK---
RS6_SPHAL       XXXXXXXXXXXXDIIRWMTIKVDELEKGPSVMM--------
RS6_RICCK       KEEIERKMKLNENIIRFLTIKADAISSEPSPMLKNQSTE--
RS6_STRAW       VKELDRQMNLNESVLRTKVL---------------------
RS6_SALAI       VAELERQLRLNESVLRTKVI---------------------
RS6_RICRS       KEELERKMKLNENIIRFLTIQADSISSEPSPILKNQSTE--
RS6_RICPU       KEELERKMKLNENIIRFLTIQADSISSEPSPILKNQSTE--
RS6_RICFE       KEELERKMKLNENIIRFLTIKADSISSEPSQILKNQSTE--
RS6_RICCN       KEELERKMKLNENIIRFLTIQADSISSEPSPILKNQSTE--
RS6_NATTJ       LTELERSLKMDESILRYLIARDEDA----------------
RS6_DINSH       VQEMERLMRLHDDVMRVMTIKVDEHPEGPSIQMQ-------
RS6_DESAP       AQELDRVFRITDGLLRHMII---------------------
RS6_BACLD       VQEFDRLAKISDDIIRHIVVKEEE-----------------
RS6_BACCN       VKEFDRLAKINEDIIRHIVVKEEE-----------------
RS6_ALKOO       PKELDRNLKIADEVIRHMII---------------------
RS6_ACIC1       VKELDRQLNLNENVLRTKLV---------------------
RS6_RHOSK       VQEMERLMRLHDDVMRVLTIKVDKHAEGPSIQMQ-------
RS6_RHOS4       VQEMERLMRLHDDVMRVLTIKVDKHAEGPSIQMQ-------
RS6_RHOS1       VQEMERLMRLHDDVMRVLTIKVDKHAEGPSIQMQ-------
RS6_NOCFA       VNELDRQLGLNESVLRTKVL---------------------
RS6_EXISA       ILETERLMKISDDVVRQM-----------------------
RS6_DESVV       VAELERIIRISDGIFKFVTVKLADAVEE-------------
RS6_DESVH       VAELERIIRISDGIFKFVTVKLADAVEE-------------
RS6_BACFR       IDKLELNFRRDERVIRFLTFRMDKYAAEYAASVKSNKKE--
RS6_BACFN       IDKLELNFRRDERVIRFLTFRMDKYAAEYAASVKSNKKE--
RS6_STACT       TDEFQRLAKINDDIIRYIVIREDE-----------------
RS6_SALTO       VAELDRQLRLNESVLRTKVI---------------------
RS6_PELPD       IAELERRLRLDEKVLR-------------------------
RS6_BACTN       IDKLELNFRRDERVIRFLTFKMDKYAAEYAASVKSNKKE--
RS6_RHOS5       VQEMERLMRLHDDVMRVLTIKVDKHAEGPSIQMQ-------
RS6_DESDA       VAELERNIRMTDGVFKFVTVKLADEV---------------
RS6_CYAP7       IAPLERMMRLSDEVIRYLTI---------------------
RS6_CAMHC       IAELVRNLRINEDIIRFLTI---------------------
RS6_BACV8       IEKLEINFRRDERVIRFL-----------------------
RS6_ARTCA       AKELDRQLSLNETIMRTKITRPEE-----------------
RS6_ANAVT       IAILERAMRLSEEVIRYLTV--KQEVTK-------------
RS6_ANASP       IAILERAMRLSEEVIRYLTV--KQEVTK-------------
RS6_SOLUE       VKELERRLRVSDIVLKFLTVRIDE-----------------
RS6_KOCRD       AKELDRVLSLNEAVMRTKIIRPEE-----------------
RS6_DESMR       IAEFERIVRITDGVMKFITV---------------------
RS6_RHOCA       VQEMERLARLHDDVMRVLTIKVDGHDEGPSVQMQ-------
RS6_GEOSL       IAELERRLRLDDKVLR-------------------------
RS6_CLOD6       PKEIDRNLKINENVIRHMIV---------------------
RS6_PORGI       IAKLETNFRRDERVIRFL-----------------------
RS6_PORG3       IAKLETNFRRDERVIRFL-----------------------
RS6_CYAA5       VAPLERMMRLGEDVMRYLTI---------------------
RS6_ARTS2       AKELDRQLSLNETIMRTKITRPEE-----------------
RS6_ARTAT       AKELDRQLSLNETIMRTKIIRPED-----------------
RS6_AQUAE       LNELDFQLKIDEDVIRWLNFQIKES----------------
RS6_OCEIH       INEFDRLAKFNDDIIRHMAIKDEQ-----------------
RS6_JANSC       VQEMERLMRLHDDVMRVLTIKVDAHDEGPSVQMQ-------
RS6_RICBR       KQELERKMKLNENIIRFLTQKVDSISNEPSPILKNQSTE--
RS6_RICB8       KQELERKMKLNENIIRFLTQKVDSISNEPSPILKNQSTE--
RS6_GEOLS       VAELERRLRLDEKVLRFLSV---------------------
RS6_RHOSR       VAELDRQLGLNESVLRTKVL---------------------
RS6_RHOOB       VAELDRQLGLNESVLRTKVL---------------------
RS6_GEOBB       IAELERRLRLDDKVIR-------------------------
RS6_FINM2       VKEIERRCRLFDQIIRYMVVRVDE-----------------
RS6_MYCTU       VSELDRQLSLNESVLRTKVMRT-------------------
RS6_MYCTA       VSELDRQLSLNESVLRTKVMRT-------------------
RS6_MYCBT       VSELDRQLSLNESVLRTKVMRT-------------------
RS6_MYCBP       VSELDRQLSLNESVLRTKVMRT-------------------
RS6_MYCBO       VSELDRQLSLNESVLRTKVMRT-------------------
RS6_MICAN       VAPMERAMRLSDEVIRYLTLKLDRVVAPPA-----------
RS6_STAS1       TDEFQRLAKISDDVIRYIVIREDE-----------------
RS6_GEOSM       IAELERRLRLDDKVIR-------------------------
RS6_CORU7       VRE--------------------------------------
RS6_BEUC1       AKELDRQLGLNEAVLRTKLI---------------------
RS6_BACP2       VQEFDRLAKISDDIIRHIVV---------------------
RS6_BACA2       VAEFDRLAKISDDIIRHIVVKEEE-----------------
RS6_ACICJ       ISEMERQLGLNEDVLRFMTVRVEDIDEAPS-----------
RR6_GUITH       IQLLERAMKINESIVRFLTTA--------------------
RS6_BACSU       VQEFDRLAKISDDIIRHIVVKEEE-----------------
RS6_SYNFM       VAELERNMRLDERVLKFITV---------------------
RS6_STAES       TDEFQRLAKINDDIIRYIVI---------------------
RS6_STAEQ       TDEFQRLAKINDDIIRYIVI---------------------
RS6_MYCPA       VSELDRQLSLNESVLRTKVMRT-------------------
RS6_DESHY       AQEVERIMKISDAVVRFL-----------------------
RS6_DESHD       AQEVERIMKISDAVVRFL-----------------------
RS6_NOCSJ       VKEFDRQLTLNESIIRTKVM---------------------
RS6_GLOVI       VAELEKAFRLSEEVIRFLTVREED-----------------
RS6_CYAP8       VAPLERAMRLSEEVIRYMTLKVETAVSE-------------
RS6_ALKMQ       PKELDRNLKIAEQVIRHMIIRIQE-----------------
RS6_SACEN       VKELDRQLNLNE-----------------------------
RS6_CYAP4       VANLQRAMRLSDEVIRYLTICQDEPDTD-------------
RS6_RHOE4       VAELDRQLGLNESVLRTKVL---------------------
RS6_MYCLE       VSELDRQLSLNESVLRTKVMRT-------------------
RS6_FUSNN       LAEVESKLNIMESVMRYIVV---------------------
RS6_THETH       VNDLARELRIRDNVRRVMVVKSQE-----------------
RS6_THET8       VNDLARELRIRDNVRRVMVVKSQE-----------------
RS6_THET2       VNDLARELRIRDNVRRVMVVKSQE-----------------
RS6_CAMJJ       IAELERVLRITEEVIRFLIV---------------------
RS6_CAMJD       IAELERVLRITEEVIRFLIV---------------------
RS6_CAMJ8       IAELERVLRITEEVIRFLIV---------------------
RS6_STAHJ       TDEFQRLAKISDDIIRYIVI---------------------
RS6_GEOSF       XXXXXXXXXXNDKIIR-------------------------
RS6_FLAPJ       LIGFETEFRRDERVMRFLTVSDKHAIS--------------
RS6_EHRCJ       MDEFKRKVRLNEDVLRFLCLKKDKLPKGDSLMIQANQ----
RS6_THEFY       VHELDRQLNLTEAVLRTKVL---------------------
RS6_LEIXX       TKELDRQLKLSEAVMRTKVL---------------------
RS6_CAMFF       IAELVRNVRITEEIIRFLTV---------------------
RS6_BACSK       INEFNRLIKINDNVIRVLV----------------------
RS6_PROMP       IFKIEKAMRLSEDVIRYLTVKQEGPLPTP------------
RS6_PELPB       IAEVEKVIRYEEDLLRYLIIHLTSALLE-------------
RS6_EXIS2       TKELDRLMKISDDIVRLMI----------------------
RS6_DESOH       VQGLENAFRIDERVLKFMTVFLSE-----------------
RS6_CAMLR       IAELERVLRITEEVIRFLIVKYENAWEKLSKGIKQNKKEI-
RS6_SYNS9       VEVLEKAMRISEDVIRYLTVKQEGPLPAPRVV---------
RS6_STAAW       TDEFQRLAKISDDIIRYMVIREDE-----------------
RS6_STAAT       TDEFQRLAKISDDIIRYMVIREDE-----------------
RS6_STAAS       TDEFQRLAKISDDIIRYMVIREDE-----------------
RS6_STAAR       TDEFQRLAKISDDIIRYMVIREDE-----------------
RS6_STAAN       TDEFQRLAKISDDIIRYMVIREDE-----------------
RS6_STAAM       TDEFQRLAKISDDIIRYMVIREDE-----------------
RS6_STAAE       TDEFQRLAKISDDIIRYMVIREDE-----------------
RS6_STAAC       TDEFQRLAKISDDIIRYMVIREDE-----------------
RS6_STAAB       TDEFQRLAKISDDIIRYMVIREDE-----------------
RS6_STAA9       TDEFQRLAKISDDIIRYMVIREDE-----------------
RS6_STAA8       TDEFQRLAKISDDIIRYMVIREDE-----------------
RS6_STAA3       TDEFQRLAKISDDIIRYMVIREDE-----------------
RS6_STAA2       TDEFQRLAKISDDIIRYMVIREDE-----------------
RS6_STAA1       TDEFQRLAKISDDIIRYMVIREDE-----------------
RS6_MYCA9       VSELDRQLGLNESVLRTKVLRT-------------------
RS6_DEHE1       IRKINADLRISEQVIRHMAINMDE-----------------
RS6_PELUB       IDELEKNEAIDKNLLRYMTVKVKK-----------------
RS6_NOSP7       IAPFERAMRLSEEVIRYLTI---------------------
RS6_GEOMG       -----------------------------------------
RS6_EHRCR       MDEFKRKVRLNEDILRFLCLKKDKLPKGDSLMIQASQ----
RS6_DESDG       VAELERIIRITDGIYKFVTVKLADEAEE-------------
RS6_CHLPD       IAEIEKVLRYEEALMRYLIIHLTSALLE-------------
RS6_SYNSC       VAVLEKAMRLSEDVIRYLTVKQEGPLPAPRVM---------
RS6_PROVI       IAEIERVLRYEDVLLRYLII---------------------
RS6_DEHSC       IRKISTDLRISEQVIRHMAINMDE-----------------
RS6_CAMJR       IAELERVLRITEEVIRFLIV---------------------
RS6_ACIC5       VAELERRLRVTEQVIKFITVRMDE-----------------
RS6_SYMTH       ANELNRVLKITDEVVRFLIVRPAE-----------------
RS6_PARD8       IATLELNFRRDERVIRFL-----------------------
RS6_LISMO       INEFDRLAKISDDIIRHMVI---------------------
RS6_LISMH       INEFDRLAKISDDIIRHMVI---------------------
RS6_LISMF       INEFDRLAKISDDIIRHMVI---------------------
RS6_LISMC       INEFDRLAKISDDIIRHMVI---------------------
RS6_GRAFK       IE---------------------------------------
RS6_EHRRW       MDEFKRKVRLNEDVLRFLCLKRDKLPEGDSLMVQASQ----
RS6_EHRRG       MDEFKRKVRLNEDVLRFLCLKRDKLPEGDSLMVQASQ----
RS6_SYNPX       VAVLEKAMRLSEDVIRYLTVKQEGPLPAPRVV---------
RS6_LISW6       INEFDRLAKISDDIVRHMVI---------------------
RS6_LISIN       INEFDRLAKISDDIVRHMVI---------------------
RS6_DICTD       L----------------------------------------
RS6_PELLD       IAEIERVLRYEEVLLRYLIVHLTSPLLE-------------
RS6_ORITI       -----------------------------------------
RS6_ORITB       -----------------------------------------
RS6_FLAJ1       LIAFETEFRRDERVMRFLTVSDKHAIS--------------
RS6_SYNY3       IALIERDMRLNDNVMRFLSI---------------------
RS6_PROM4       IAVLEKAMRLTEDVIRYLTV---------------------
RS6_HELHP       ILELERNYRINEEILRFIVI---------------------
RS6_CAMJE       IAELERVLRITEEVIRFLIV---------------------
RS6_SYNPW       VAVLEKVMRLSEDVIRYLTVKQEGPLPAPRVV---------
RS6_CHLTE       IAEIERVFRYEEAILRFLIIQLSSPLLE-------------
RS6_CAMC5       LAELTRNIRITEDIIRFLSV---------------------
RS6_SYNS3       VGVIEKAMRLSEDVIRYLTVKQEGPLPAPRV----------
RS6_AZOPC       ISKLETQFRRDEKVLRFLTFRQNKVFMEYALKRRNKLKE--
RS6_ACIBL       IKEVERRLRVQEQVIKFITVRVDE-----------------
RS6_STRMU       LNEFDRLSKINNDILRHMIV---------------------
RS6_PROM9       IFKIEKAMRISEDVIRYMTVKQEGPLPTPKPSNKSS-----
RS6_PROM1       VATLERAMRLSEDVIRYITVKQDGPLPTPKPTSKEDETE--
RS6_CHLPB       LAAIETAFRYNENILRFLIVHLSTPLLE-------------
RS6_CAMC1       LAELTRNVRITEDIIRFLSV---------------------
RS6_WOLSU       VIELERLYRINEDILRFIVI---------------------
RS6_SYNJB       VAAWEKNLRINESVLRHMTL---------------------
RS6_STRSV       LKEFDRLSKINADILRHMIV---------------------
RS6_STRGC       LKEFDRLSKINADILRHMIV---------------------
RS6_CHLL2       IGAIEKVLRYEEDLLRYLIIHLTSALLE-------------
RS6_TRIEI       IAILERAMRLSEEVIRYLTV---------------------
RS6_SYNR3       VGPLEKAMRLSEDVIRYLTV---------------------
RS6_SYNP2       IKAVERDMRLGEMVIRYLTM---------------------
RS6_SYNE7       IAPLERALRLSEEVLRFLTV--KQEVRPPA-----------
RS6_LACAC       VNEFSRLSKIDNAILRSMTV---------------------
RS6_HELP2       IVELERLYRINEDVLRFIVISKKEVEAWHALVDRANKK---
RS6_HELAH       ILELERLYRINEDVLRFIVISKKEVEAWHALVDRANKK---
RS6_DICT6       L----------------------------------------
RS6_STRTD       LNEFDRLSKINGDILRHMIV---------------------
RS6_STRT2       LNEFDRLSKINGDILRHMIV---------------------
RS6_STRT1       LNEFDRLSKINGDILRHMIV---------------------
RS6_LACSS       LNEFDRLAKIDGAILRHMIVKRED-----------------
RS6_LACCB       INEFDRLGKINNDILRHMIVKRED-----------------
RS6_LACC3       INEFDRLGKINNDILRHMIVKRED-----------------
RS6_HELPJ       ILELERLYRINEDVLRFIVISKKEVEAWHALVDRANKK---
RS6_STRU0       LNEFDRLAKINGDILRHMIV---------------------
RS6_STRS2       LKEFDRLSKINGDILRHMIV---------------------
RS6_STRA5       LNEFDRLSKINGDILRHMIV---------------------
RS6_STRA3       LNEFDRLSKINGDILRHMIV---------------------
RS6_STRA1       LNEFDRLSKINGDILRHMIV---------------------
RS6_CHLT3       LKELERQYRLNESIIRFLTIILDKRLLE-------------
RR6_PORYE       VKSFEKSLRFDDNIIRYLTNKQKRNIKKDS-----------
RS6_STRS7       LNEFDRLSKINGDILRHMIV---------------------
RS6_STRPZ       LNEFDRLSKINGDILRHMIV---------------------
RS6_STRPM       LNEFDRLSKINGDILRHMIV---------------------
RS6_STRPG       LNEFDRLSKINGDILRHMIV---------------------
RS6_STRPD       LNEFDRLSKINGDILRHMIV---------------------
RS6_STRPC       LNEFDRLSKINGDILRHMIV---------------------
RS6_STRPB       LNEFDRLSKINGDILRHMIV---------------------
RS6_STRP8       LNEFDRLSKINGDILRHMIV---------------------
RS6_STRP6       LNEFDRLSKINGDILRHMIV---------------------
RS6_STRP3       LNEFDRLSKINGDILRHMIV---------------------
RS6_STRP1       LNEFDRLSKINGDILRHMIV---------------------
RS6_STRE4       LNEFDRLSKINGDILRHMIV---------------------
RS6_PROMM       VAVLEKAMRLSEDVIRYLTVKQEGPLPAPRIV---------
RS6_PROM3       VAVLEKAMRLSEDVIRYLTVKQEGPLPAPRIV---------
RS6_OENOB       VNEFDRLAKISGDILRHMIVA--------------------
RS6_MAGSM       VHDLEAKLGIDEDVLK-------------------------
RS6_LACRJ       LNEFDRLAKFSDDILRHMIV---------------------
RS6_LACRD       LNEFDRLAKFSDDILRHMIV---------------------
RS6_LACPL       LNEFDRLSKINDDILRHMIVKRED-----------------
RS6_HELPY       IVELERLYRINEDVLRFIVISKKEVEAWHALVDRANKK---
RS6_GEOUR       -----------------------------------------
RS6_PROM5       IFKIEKAMRLSEDVIRYLTVKQEGPLPTPSSNKSSNQAE--
RS6_LACLA       LSEFDRLAKINLDILRHMIV---------------------
RS6_HELPH       ILELERLYRINEDVLRFIVISKKEVEAWHALVDRANKK---
RS6_HELPG       ILELERLYRINEDVLRFIVISKKEVEAWHALVDRANKK---
RS6_STREM       LNEFDRLSKINGDILRHMIV---------------------
RS6_MYCA5       MAELTRKLNIAKFILRSLII---------------------
RS6_HELPS       ILELERLYRINEDVLRFIVISKKEVEAWHALVDRANKK---
RS6_SYNWW       VDELDRIIKISENFLRHIIIRQDE-----------------
RS6_SYNP6       IAPLERALRLSEEVLRFLTV--KQEVRPPA-----------
RS6_STRZT       LKEFDRLSKINADILRHMIV---------------------
RS6_STRZP       LKEFDRLSKINADILRHMIV---------------------
RS6_STRZJ       LKEFDRLSKINADILRHMIV---------------------
RS6_STRR6       LKEFDRLSKINADILRHMIV---------------------
RS6_STRPS       LKEFDRLSKINADILRHMIV---------------------
RS6_STRPN       LKEFDRLSKINADILRHMIV---------------------
RS6_STRPJ       LKEFDRLSKINADILRHMIV---------------------
RS6_STRPI       LKEFDRLSKINADILRHMIV---------------------
RS6_STRP7       LKEFDRLSKINADILRHMIV---------------------
RS6_STRP2       LKEFDRLSKINADILRHMIV---------------------
RS6_ANAMM       MDEFRRRVRLNEDVLRFLCLKVDKVCEGKSAMMGSDQ----
RS6_SULDN       ISEIERRFRINEELLRFVTIKTNREVTAWNQLVQKAQKK--
RS6_PROMA       VETLERSMRLSEDVIRYLTV---------------------
RS6_LACLS       LSEFDRLAKINLDILRHMIV---------------------
RS6_LACLM       LSEFDRLAKINLDILRHMIV---------------------
RS6_LACJO       VDEFGRLSRIDNQILRSMTV---------------------
RS6_ENTFA       INEFDRLAKINDDIIRHMIV---------------------
RS6_THEMA       LQELENFYRVTPEIIR-------------------------
RS6_PROMT       VATLERAMRLSEDVIRYITV---------------------
RS6_LACGA       VDEFGRLSRIDNQVLRSMTV---------------------
RS6_LACBA       LNEFDRLAKINDSILRHMIVKRED-----------------
RS6_ACHLI       IAEYKRVVNITESVIRNIEVKEGE-----------------
RS6_THEP1       LQELENFYRVTPEIIR-------------------------
RS6_LACF3       LNEFDRLAKFSDDILRHMIV---------------------
RS6_CHLP8       IAEIERVFRYEENILRFLIIQLSSPLLEMSVMLGSPEDQ--
RS6_TREDE       MIELDKRFKLITQMLTYLFVRLED-----------------
RS6_LACH4       VNEFGRLSKIDNMILRSMTV---------------------
RS6_BIFLO       SDELDRVLNLNESVIRTKIL---------------------
RS6_WOLTR       MDEFVRRIKLNENIIRHLSVHVDKFFEGKSHMMNKQVEE--
RS6_STRP4       LKEFDRLSKINADILRHMIV---------------------
RS6_PHYMT       IEEFNRVVKINEDIIRSIVI---------------------
RS6_ANAPZ       MDEFKRKVKLNEDVLRFLCLKVDKVPEGRSAMMGSDQ----
RR6_PORPU       VQSFEKSLRFDENIIRYL-----------------------
RS6_ELUMP       VKSWDEMAKLNEQILRSIVMLSIE-----------------
RS6_PARUW       ISDLWQEYHLNEDLIRFITLRTDEVM---------------
RS6_RHOBA       LTQLARAFALAEPVIRELTIKLDPRLVEP------------
RS6_THEAB       LNELEMYFKVRPEFLR-------------------------
RS6_MESFL       IKEFERIANIEKNVVRTLIINTEEQGYEQSVQLSKTD----
RS6_THESQ       LQELENFYRITPEIIR-------------------------
RS6_THENN       LQELENFYRITPEIIR-------------------------
RS6_CORGL       VLELDRVLNLNDGVLRTKVL---------------------
RS6_CHLCH       -----------------------------------------
RS6_COREF       VLELDRVLNLNDGVLRTKVL---------------------
RT06_CHICK      VSTMMDHLGRDIDIIRRAFIKYPVSKTE-------------
RR6_GRATL       VRILEKAMRLSQHVIRYMTI---------------------
RS6_MYCGE       TKEFKRAANINKQIIRELII---------------------
RS6_DEIGD       -----------------------------------------
RS6_AKKM8       IRPIRERLRLNPQI---------------------------
RS6_PHYAS       VLEFNRIVKITEEVIRFIII---------------------
RS6_FERNB       LDQLENYFKVHPEFMR-------------------------
RS6_SULNB       IAEIERNLKINEEVIKFLTV---------------------
RS6_LEPBP       VAKIEHEFKLNVNILKTLVI---------------------
RS6_LEPBA       VAKIEHEFKLNVNILKTLVI---------------------
RS6_TREPS       -----------------------------------------
RS6_TREPA       -----------------------------------------
RS6_THEM4       ITVLESYFRVRPEFLR-------------------------
RS6_CHLPN       ITELWKEYHLNEDLLRFMTL---------------------
RS6_LEPBL       IEKVEKEFLINQNILRSMVV---------------------
RS6_LEPBJ       IEKVEKEFLINQNILRSMVV---------------------
RS6_LAWIP       -----------------------------------------
RS6_UREU1       LNEFRRLAIINKNVLRHIII---------------------
RS6_DEIRA       -----------------------------------------
RS6_SYNJA       VATWEKNLRINESILRYMTL---------------------
RS6_MYCAP       IAEFTRRANIAKFIWRQMVI---------------------
RS6_CHLMU       ISELWREYHLNEDLLRFMTLAVKEVL---------------
RR6_CYACA       LNSLIKRLKLEESILRYIVQKT-------------------
RS6_MYCPE       IQEFRRVTLLKKEVLRHLII---------------------
RS6_LEPIN       IEKVEKEFLINQNILRSMVV---------------------
RS6_LEPIC       IEKVEKEFLINQNILRSMVV---------------------
RS6_CHLTR       IAELWREYHLNEDLLRFMTLAVKEVL---------------
RS6_CHLTB       IAELWREYHLNEDLLRFMTLAVKEVL---------------
RS6_CHLTA       IAELWREYHLNEDLLRFMTLAVKEVL---------------
RS6_CHLT2       IAELWREYHLNEDLLRFMTLAVKEVL---------------
RS6_CHLAB       IAELWKEYHLNEDLLRFLTLKT-DAVKE-------------
RT06_DROME      IADLKEEFGRDIDIIRRYIFKVEEPEQKPCTLHE-------
RS6_UREPA       LNEFRRLAIINKNVLRHIII---------------------
RS6_UREP2       LNEFRRLAIINKNVLRHIII---------------------
RS6_MYCPN       TKDFKRTANINKQVLRELII---------------------
RS6_CHLFF       IAELWKEYHLNEDLLRFLTLKT-DAVKE-------------
RS6_DEIDV       -----------------------------------------
RS6_CHLCV       IAELWKEYHLNEDLLRFLTLAVKEVL---------------
RR6_CYAME       VKKLEKYLQVNEKGLRYMIL---------------------
COG3_YEAST      IPKALHYFEVLDPIMRRLNHATSPAIVKKS-----------