[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30912.1

[Show Plain Result]


## Summary of Sequence Search
    1::235
    3::240     3e-32  34%  244 aa  FABG_VIBHA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    3::243     4e-31  35%  247 aa  FABG_PSEAE RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   23::250     2e-30  35%  255 aa  FABG_MYCS2 RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    3::243     2e-30  34%  246 aa  FABG_THEMA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   79::317     4e-29  36%  320 aa  FABG_CUPLA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   23::250     5e-29  33%  255 aa  FABG_MYCAV RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    4::241     6e-29  39%  245 aa  FABG_BUCBP RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    6::240     8e-29  34%  244 aa  FABG_SHIFL RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    6::240     8e-29  34%  244 aa  FABG_ECOLI RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    3::240     8e-29  36%  244 aa  FABG_BUCAP RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    1::238     2e-28  34%  242 aa  FABG_HAEIN RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   15::242     1e-27  32%  247 aa  FABG_MYCTU RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   15::242     1e-27  32%  247 aa  FABG_MYCBO RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    4::237     2e-27  33%  241 aa  FABG_RICPR RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    1::242     7e-27  35%  246 aa  NODG_AZOBR RecName: Full=Nodulation protein G;
    3::240     1e-26  32%  244 aa  FABG_VIBCH RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    2::243     2e-26  29%  246 aa  FABG_BACSU RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   37::278     3e-26  34%  278 aa  FIXR_BRAJA RecName: Full=Protein fixR;
    7::246     3e-26  33%  248 aa  FABG_CHLMU RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    7::246     6e-26  33%  248 aa  FABG_CHLTR RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    2::241     1e-25  31%  244 aa  FABG_STAES RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    2::241     1e-25  31%  244 aa  FABG_STAEQ RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    5::246     2e-25  34%  248 aa  FABG_AQUAE RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    1::253     3e-25  32%  257 aa  YXJF_BACSU RecName: Full=Uncharacterized oxidoreductase yxjF;      
    3::240     3e-25  33%  244 aa  FABG_BUCAI RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    3::249     5e-25  34%  253 aa  BACC2_BACSU RecName: Full=Bacilysin biosynthesis oxidoreductase
    5::240     1e-24  34%  244 aa  DCXR_BOVIN RecName: Full=L-xylulose reductase;         Short=XR;   
   12::264     2e-24  33%  267 aa  LVR_LEIAQ RecName: Full=Levodione reductase;       
    6::240     2e-24  32%  244 aa  FABG_SALTY RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    6::240     2e-24  32%  244 aa  FABG_SALTI RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   58::237     2e-24  34%  241 aa  FABG_RICTY RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   12::255     3e-24  31%  260 aa  DHRS4_RABIT RecName: Full=Dehydrogenase/reductase SDR family member
    5::240     3e-24  36%  244 aa  DCXR_MOUSE RecName: Full=L-xylulose reductase;         Short=XR;   
    2::237     6e-24  33%  241 aa  PHBB_RHIME RecName: Full=Acetoacetyl-CoA reductase;       
    4::241     6e-24  29%  245 aa  NODG_RHIS3 RecName: Full=Nodulation protein G;
    5::240     6e-24  35%  244 aa  DCXR_RAT RecName: Full=L-xylulose reductase;         Short=XR;     
    3::252     8e-24  33%  256 aa  BUDC_KLEPN RecName: Full=Acetoin(diacetyl) reductase;       
    8::243     1e-23  31%  246 aa  FABG_STAAW RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    8::243     1e-23  31%  246 aa  FABG_STAAS RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    8::243     1e-23  31%  246 aa  FABG_STAAR RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    8::243     1e-23  31%  246 aa  FABG_STAAN RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    8::243     1e-23  31%  246 aa  FABG_STAAM RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    8::243     1e-23  31%  246 aa  FABG_STAAC RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    8::249     2e-23  35%  251 aa  DCXR_CAEEL RecName: Full=Probable L-xylulose reductase;       
   58::237     3e-23  32%  241 aa  FABG_RICBR RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    5::240     3e-23  36%  244 aa  DCXR_CAVPO RecName: Full=L-xylulose reductase;         Short=XR;   
    3::249     3e-23  33%  253 aa  BACC_BACSU RecName: Full=Bacilysin biosynthesis oxidoreductase
    5::244     4e-23  30%  248 aa  PHAB_ACISR RecName: Full=Acetoacetyl-CoA reductase;       
    8::249     5e-23  33%  253 aa  KDUD_DICD3 RecName: Full=2-dehydro-3-deoxy-D-gluconate
   11::258     5e-23  32%  259 aa  CMTB_PSEPU RecName: Full=2,3-dihydroxy-2,3-dihydro-p-cumate
   11::258     5e-23  32%  259 aa  CMTB_PSEP1 RecName: Full=2,3-dihydroxy-2,3-dihydro-p-cumate
    2::232     5e-23  35%  237 aa  CBR4_DANRE RecName: Full=Carbonyl reductase family member 4;       
   21::261     6e-23  31%  268 aa  TRNH_DATST RecName: Full=Tropinone reductase homolog;       
   13::253     8e-23  32%  260 aa  TRN2_HYONI RecName: Full=Tropinone reductase 2;       
   13::253     8e-23  32%  260 aa  TRN2_DATST RecName: Full=Tropinone reductase 2;       
    5::240     8e-23  34%  244 aa  DCXR_MESAU RecName: Full=L-xylulose reductase;         Short=XR;   
    3::250     8e-23  33%  254 aa  BACC_BACAM RecName: Full=Bacilysin biosynthesis oxidoreductase
    6::249     2e-22  35%  251 aa  Y325_THEMA RecName: Full=Uncharacterized oxidoreductase TM_0325;   
   86::243     2e-22  40%  247 aa  FABG1_SYNY3 RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    2::237     3e-22  33%  241 aa  PHBB_ZOORA RecName: Full=Acetoacetyl-CoA reductase;       
    3::238     3e-22  31%  242 aa  PHAB_PARDE RecName: Full=Acetoacetyl-CoA reductase;       
    3::242     4e-22  34%  253 aa  YOHF_ECOLI RecName: Full=Uncharacterized oxidoreductase yohF;      
    2::239     7e-22  34%  242 aa  YMFI_BACSU RecName: Full=Uncharacterized oxidoreductase ymfI;      
   25::266     7e-22  33%  273 aa  TRN1_DATST RecName: Full=Tropinone reductase 1;       
   78::312     7e-22  33%  315 aa  FABG3_BRANA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   83::317     7e-22  33%  320 aa  FABG1_BRANA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    5::249     7e-22  32%  261 aa  DHG2_BACME RecName: Full=Glucose 1-dehydrogenase 2;       
   91::325     9e-22  33%  328 aa  FABG2_BRANA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    3::231     9e-22  32%  236 aa  CBR4_XENTR RecName: Full=Carbonyl reductase family member 4;       
    6::236     1e-21  31%  240 aa  FABG2_SYNY3 RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    5::258     2e-21  34%  263 aa  YVRD_BACSU RecName: Full=Uncharacterized oxidoreductase yvrD;      
   10::245     2e-21  31%  248 aa  FABG_CHLPN RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   57::242     3e-21  35%  246 aa  PHBB_CHRVI RecName: Full=Acetoacetyl-CoA reductase;       
   10::250     4e-21  33%  254 aa  KDUD_BACSU RecName: Full=2-dehydro-3-deoxy-D-gluconate
    4::245     4e-21  30%  245 aa  BDH2_MOUSE RecName: Full=3-hydroxybutyrate dehydrogenase type 2;   
   57::246     6e-21  35%  250 aa  LINC_PSEPA RecName: Full=2,5-dichloro-2,5-cyclohexadiene-1,4-diol
   87::249     8e-21  39%  253 aa  KDUD_ECOLI RecName: Full=2-dehydro-3-deoxy-D-gluconate
  125::295     8e-21  37%  300 aa  GRDH_ORYSJ RecName: Full=Glucose and ribitol dehydrogenase homolog;
    4::246     1e-20  29%  250 aa  CPNA_COMTE RecName: Full=Cyclopentanol dehydrogenase;       
    4::246     1e-20  29%  250 aa  CPNA_COMS9 RecName: Full=Cyclopentanol dehydrogenase;       
    7::247     1e-20  33%  251 aa  YJDA_BACSU RecName: Full=Uncharacterized oxidoreductase yjdA;      
   63::246     1e-20  32%  548 aa  Y4VI_RHISN RecName: Full=Uncharacterized short-chain type
    3::254     2e-20  31%  258 aa  BDHA_RHIME RecName: Full=D-beta-hydroxybutyrate dehydrogenase;     
    7::244     2e-20  31%  248 aa  YKVO_BACSU RecName: Full=Uncharacterized oxidoreductase ykvO;      
    1::242     2e-20  32%  246 aa  PHBB_RALEH RecName: Full=Acetoacetyl-CoA reductase;       
    3::237     3e-20  33%  258 aa  YLX6_SCHPO RecName: Full=Uncharacterized oxidoreductase C922.06;   
   39::280     3e-20  32%  285 aa  YHXC_BACSU RecName: Full=Uncharacterized oxidoreductase yhxC;      
    3::246     3e-20  34%  247 aa  YGFF_ECOLI RecName: Full=Uncharacterized oxidoreductase ygfF;      
   80::314     3e-20  33%  317 aa  FABG5_BRANA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   21::251     3e-20  33%  254 aa  FABG4_BRANA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   60::302     3e-20  30%  335 aa  DECR_MOUSE RecName: Full=2,4-dienoyl-CoA reductase, mitochondrial; 
   55::250     4e-20  32%  255 aa  HDHA_ECOLI RecName: Full=7-alpha-hydroxysteroid dehydrogenase;     
   55::250     4e-20  32%  255 aa  HDHA_ECO57 RecName: Full=7-alpha-hydroxysteroid dehydrogenase;     
    4::252     4e-20  31%  267 aa  HDHA_CLOSO RecName: Full=NADP-dependent 7-alpha-hydroxysteroid
    5::257     4e-20  33%  261 aa  DHKR_STRCM RecName: Full=Monensin polyketide synthase putative
    3::254     4e-20  29%  258 aa  BUTA_STAAW RecName: Full=Acetoin(diacetyl) reductase;       
    3::254     4e-20  29%  258 aa  BUTA_STAAS RecName: Full=Acetoin(diacetyl) reductase;       
    3::254     4e-20  29%  258 aa  BUTA_STAAR RecName: Full=Acetoin(diacetyl) reductase;       
    3::254     4e-20  29%  258 aa  BUTA_STAAN RecName: Full=Acetoin(diacetyl) reductase;       
    3::254     4e-20  29%  258 aa  BUTA_STAAM RecName: Full=Acetoin(diacetyl) reductase;       
    3::254     4e-20  29%  258 aa  BUTA_STAAC RecName: Full=Acetoin(diacetyl) reductase;       
    4::255     5e-20  30%  263 aa  UCPA_ECOLI RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
   12::255     5e-20  27%  260 aa  DHRS4_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
   11::251     5e-20  33%  260 aa  DHR11_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
    6::257     5e-20  32%  261 aa  ACT3_STRCO RecName: Full=Putative ketoacyl reductase;       
   16::267     7e-20  30%  303 aa  PECR_PONAB RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase;  
    1::246     7e-20  32%  254 aa  FADH_BACSU RecName: Full=Probable 2,4-dienoyl-CoA reductase;       
   52::237     7e-20  30%  241 aa  FABG_RICFE RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   60::302     7e-20  30%  335 aa  DECR_RAT RecName: Full=2,4-dienoyl-CoA reductase, mitochondrial;   
   62::244     9e-20  32%  247 aa  Y1385_MYCBO RecName: Full=Uncharacterized oxidoreductase Mb1385;   
   62::244     9e-20  32%  247 aa  Y1350_MYCTU RecName: Full=Uncharacterized oxidoreductase
    4::255     1e-19  29%  263 aa  UCPA_ECO57 RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
  103::245     1e-19  37%  245 aa  BDH2_BOVIN RecName: Full=3-hydroxybutyrate dehydrogenase type 2;   
   55::241     2e-19  27%  245 aa  NODG_RHIME RecName: Full=Nodulation protein G;AltName:
    9::251     2e-19  30%  256 aa  GNO_GLUOX RecName: Full=Gluconate 5-dehydrogenase;       
    4::255     3e-19  29%  263 aa  UCPA_SALTY RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
    4::255     3e-19  29%  263 aa  UCPA_SALTI RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
   10::242     3e-19  32%  246 aa  DER_CHICK RecName: Full=D-erythrulose reductase;       
   58::252     3e-19  32%  273 aa  YXBG_BACSU RecName: Full=Uncharacterized oxidoreductase yxbG;      
   43::284     3e-19  33%  289 aa  YHDF_BACSU RecName: Full=Uncharacterized oxidoreductase yhdF;      
    7::249     4e-19  28%  254 aa  IDNO_ECOLI RecName: Full=Gluconate 5-dehydrogenase;       
    7::249     4e-19  28%  254 aa  IDNO_ECOL6 RecName: Full=Gluconate 5-dehydrogenase;       
    5::240     4e-19  29%  242 aa  FABG_ACTAC RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   11::240     4e-19  32%  244 aa  CBR2_MOUSE RecName: Full=Carbonyl reductase [NADPH] 2;       
   62::245     4e-19  31%  249 aa  BAIA1_EUBSP RecName: Full=Bile acid 7-dehydroxylase 1/3;       
   16::267     6e-19  30%  303 aa  PECR_HUMAN RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase;  
    5::240     6e-19  31%  244 aa  DCXR_HUMAN RecName: Full=L-xylulose reductase;         Short=XR;   
    5::249     7e-19  30%  261 aa  DHG_BACSU RecName: Full=Glucose 1-dehydrogenase;       
  103::245     7e-19  38%  245 aa  BDH2_HUMAN RecName: Full=3-hydroxybutyrate dehydrogenase type 2;   
   11::251     1e-18  33%  260 aa  DHR11_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
    2::231     1e-18  28%  236 aa  CBR4_XENLA RecName: Full=Carbonyl reductase family member 4;       
   52::237     1e-18  29%  241 aa  FABG_RICCN RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   58::245     2e-18  32%  249 aa  HCDS_XANP2 RecName: Full=2-(S)-hydroxypropyl-CoM dehydrogenase;    
    4::248     2e-18  31%  250 aa  FABL_BACSU RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    7::263     3e-18  31%  267 aa  SORD_KLEPN RecName: Full=Sorbitol-6-phosphate 2-dehydrogenase;     
   79::267     4e-18  29%  303 aa  PECR_RAT RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase;    
   79::267     4e-18  29%  303 aa  PECR_MOUSE RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase;  
   11::240     4e-18  32%  244 aa  CBR2_PIG RecName: Full=Carbonyl reductase [NADPH] 2;       
   12::255     5e-18  26%  260 aa  DHRS4_RAT RecName: Full=Dehydrogenase/reductase SDR family member
  116::302     5e-18  31%  335 aa  DECR_HUMAN RecName: Full=2,4-dienoyl-CoA reductase, mitochondrial; 
   90::257     6e-18  32%  261 aa  YGCW_ECOLI RecName: Full=Uncharacterized oxidoreductase ygcW;      
    2::245     6e-18  29%  250 aa  HCDR_XANP2 RecName: Full=2-(R)-hydroxypropyl-CoM dehydrogenase;    
    6::246     6e-18  31%  255 aa  DHR11_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
   62::245     6e-18  31%  249 aa  BAIA2_EUBSP RecName: Full=Bile acid 7-dehydroxylase 2;       
    9::258     8e-18  31%  261 aa  DHB8_HUMAN RecName: Full=Estradiol 17-beta-dehydrogenase 8;        
    2::231     8e-18  27%  236 aa  CBR4_MOUSE RecName: Full=Carbonyl reductase family member 4;       
    2::232     8e-18  28%  237 aa  CBR4_BOVIN RecName: Full=Carbonyl reductase family member 4;       
  153::316     1e-17  33%  319 aa  FABG_ARATH RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    2::253     1e-17  31%  257 aa  BUTA_STAEQ RecName: Full=Acetoin(diacetyl) reductase;       
   12::255     1e-17  27%  260 aa  DHRS4_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
  103::284     2e-17  37%  289 aa  GRDH2_ARATH RecName: Full=Glucose and ribitol dehydrogenase homolog
   14::256     2e-17  29%  259 aa  DHB8_CANFA RecName: Full=Estradiol 17-beta-dehydrogenase 8;        
    9::246     3e-17  31%  255 aa  Y3106_PSEAE RecName: Full=Uncharacterized oxidoreductase PA3106;   
  101::283     3e-17  35%  288 aa  GRDH1_ARATH RecName: Full=Glucose and ribitol dehydrogenase homolog
   12::245     3e-17  28%  260 aa  DHRS4_PIG RecName: Full=Dehydrogenase/reductase SDR family member
   80::254     3e-17  32%  258 aa  BDHA_RALEH RecName: Full=D-beta-hydroxybutyrate dehydrogenase;     
   82::249     4e-17  32%  278 aa  Y4LA_RHISN RecName: Full=Uncharacterized short-chain type
   82::249     4e-17  32%  281 aa  Y2146_BRAJA RecName: Full=Probable short-chain type
   40::281     4e-17  32%  286 aa  GS39_BACSU RecName: Full=General stress protein 39;       
    5::250     4e-17  31%  262 aa  DHGB_BACME RecName: Full=Glucose 1-dehydrogenase B;       
   11::258     5e-17  27%  262 aa  MTDH_AGABI RecName: Full=NADP-dependent mannitol dehydrogenase;    
   81::253     5e-17  36%  257 aa  BUTA_STAES RecName: Full=Acetoin(diacetyl) reductase;       
  120::281     7e-17  32%  286 aa  YAY8_SCHPO RecName: Full=Uncharacterized oxidoreductase C4H3.08;   
   67::259     7e-17  28%  262 aa  VER1_ASPPA RecName: Full=Versicolorin reductase;       
   27::283     7e-17  26%  283 aa  T4HR_MAGGR RecName: Full=Tetrahydroxynaphthalene reductase;        
   60::242     9e-17  33%  255 aa  HSD_STREX RecName: Full=3-alpha-(or 20-beta)-hydroxysteroid
    9::258     9e-17  31%  261 aa  BEND_ACIAD RecName:
   61::247     1e-16  31%  256 aa  Y019_THEMA RecName: Full=Uncharacterized oxidoreductase TM_0019;   
  105::286     1e-16  33%  291 aa  GRDH_DAUCA RecName: Full=Glucose and ribitol dehydrogenase;        
   99::198     1e-16  42%  201 aa  FABG6_BRANA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    5::236     1e-16  33%  255 aa  DHR11_CHICK RecName: Full=Dehydrogenase/reductase SDR family member
   79::266     2e-16  30%  302 aa  PECR_CAVPO RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase;  
    8::260     2e-16  30%  262 aa  VIBA_VIBCH RecName: Full=Vibriobactin-specific
    7::253     2e-16  32%  256 aa  RHLG_PSEAE RecName: Full=Rhamnolipids biosynthesis
  107::240     3e-16  29%  244 aa  NOG4_RHIME RecName: Full=Nodulation protein G;AltName:
   69::261     3e-16  31%  264 aa  STCU_EMENI RecName: Full=Versicolorin reductase;       
   33::280     3e-16  29%  300 aa  DECR2_DANRE RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase;   
    4::246     4e-16  29%  248 aa  ENTA_ECOLI RecName: Full=2,3-dihydro-2,3-dihydroxybenzoate
   72::250     4e-16  33%  272 aa  DHK1_STRVN RecName: Full=Granaticin polyketide synthase putative
    2::232     4e-16  27%  237 aa  CBR4_HUMAN RecName: Full=Carbonyl reductase family member 4;       
   84::274     6e-16  32%  278 aa  ARDH_PICST RecName: Full=D-arabinitol 2-dehydrogenase
    2::231     8e-16  26%  236 aa  CBR4_RAT RecName: Full=Carbonyl reductase family member 4;       
   85::267     1e-15  27%  292 aa  SPS19_YEAST RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase
    5::249     1e-15  28%  261 aa  DHGA_BACME RecName: Full=Glucose 1-dehydrogenase A;       
    4::216     2e-15  28%  231 aa  Y2478_STAAM RecName: Full=Uncharacterized oxidoreductase SAV2478;  
    4::216     2e-15  28%  231 aa  Y2266_STAAN RecName: Full=Uncharacterized oxidoreductase SA2266;   
   86::246     2e-15  33%  248 aa  Y182_METEA RecName: Full=Uncharacterized oxidoreductase
    5::249     2e-15  28%  261 aa  DHG3_BACME RecName: Full=Glucose 1-dehydrogenase 3;       
    5::249     3e-15  28%  261 aa  DHG4_BACME RecName: Full=Glucose 1-dehydrogenase 4;       
    4::216     4e-15  27%  231 aa  Y2778_STAA8 RecName: Full=Uncharacterized oxidoreductase
    4::216     4e-15  27%  231 aa  Y2488_STAAC RecName: Full=Uncharacterized oxidoreductase SACOL2488;
    4::216     4e-15  27%  231 aa  Y2422_STAA3 RecName: Full=Uncharacterized oxidoreductase
    4::216     4e-15  28%  231 aa  Y2403_STAAW RecName: Full=Uncharacterized oxidoreductase MW2403;   
    4::216     4e-15  28%  231 aa  Y2370_STAAS RecName: Full=Uncharacterized oxidoreductase SAS2370;  
  131::280     4e-15  35%  285 aa  Y048_HAEIN RecName: Full=Uncharacterized oxidoreductase HI0048;    
   47::251     4e-15  29%  270 aa  DHB14_HUMAN RecName: Full=17-beta-hydroxysteroid dehydrogenase 14; 
    6::259     5e-15  27%  261 aa  DHBA_BACSU RecName: Full=2,3-dihydro-2,3-dihydroxybenzoate
   15::254     6e-15  29%  266 aa  TRNH1_ARATH RecName: Full=Tropinone reductase homolog At1g07440;   
   59::252     6e-15  31%  256 aa  DHSO_RHOSH RecName: Full=Sorbitol dehydrogenase;       
    3::190     6e-15  33%  241 aa  BUDC_KLETE RecName: Full=Acetoin(diacetyl) reductase;       
   88::278     6e-15  29%  282 aa  ARDH_CANTR RecName: Full=D-arabinitol 2-dehydrogenase
    4::216     2e-14  27%  231 aa  Y2567_STAAR RecName: Full=Uncharacterized oxidoreductase SAR2567;  
   87::277     2e-14  28%  281 aa  ARDH_CANAL RecName: Full=D-arabinitol 2-dehydrogenase
   19::269     3e-14  26%  271 aa  SDR1_PICAB RecName: Full=Short-chain type dehydrogenase/reductase; 
    6::191     3e-14  32%  311 aa  RDH8_HUMAN RecName: Full=Retinol dehydrogenase 8;       
    7::252     3e-14  27%  256 aa  MTDH_UROFA RecName: Full=Probable NADP-dependent mannitol
   84::256     4e-14  27%  259 aa  DHB8_RAT RecName: Full=Estradiol 17-beta-dehydrogenase 8;       
   66::256     4e-14  27%  259 aa  DHB8_PIG RecName: Full=Estradiol 17-beta-dehydrogenase 8;       
  108::273     4e-14  33%  292 aa  DECR2_PONAB RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase;   
  108::273     4e-14  33%  292 aa  DECR2_HUMAN RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase;   
  129::271     9e-14  32%  278 aa  UXUB_BACSU RecName: Full=Uncharacterized oxidoreductase uxuB;      
  177::257     9e-14  49%  271 aa  DHMA_FLAS1 RecName: Full=N-acylmannosamine 1-dehydrogenase;        
    3::256     1e-13  32%  259 aa  NAHB_PSEU8 RecName: Full=1,2-dihydroxy-1,2-dihydronaphthalene
    3::256     1e-13  31%  259 aa  NAHB_PSEPU RecName: Full=1,2-dihydroxy-1,2-dihydronaphthalene
  165::257     1e-13  35%  260 aa  DHB8_MOUSE RecName: Full=Estradiol 17-beta-dehydrogenase 8;        
    8::254     2e-13  33%  269 aa  XYLL_PSEPU RecName:
   64::251     2e-13  31%  255 aa  SOU1_SCHPO RecName: Full=Sorbose reductase sou1;       
    4::193     3e-13  24%  230 aa  Y2049_STAEQ RecName: Full=Uncharacterized oxidoreductase SERP2049; 
    4::193     3e-13  24%  230 aa  Y2036_STAES RecName: Full=Uncharacterized oxidoreductase SE_2036;  
   79::272     5e-13  30%  313 aa  YXEK_CAEEL RecName: Full=Uncharacterized oxidoreductase F53C11.3;  
   48::132     5e-13  36%  134 aa  DHB8_CALJA RecName: Full=Estradiol 17-beta-dehydrogenase 8;        
    1::254     6e-13  25%  259 aa  YWFH_BACSU RecName: Full=Bacilysin biosynthesis oxidoreductase
    4::190     6e-13  29%  259 aa  YQJQ_BACSU RecName: Full=Uncharacterized oxidoreductase yqjQ;      
    4::193     6e-13  28%  234 aa  Y0419_STAS1 RecName: Full=Uncharacterized oxidoreductase SSP0419;  
   78::271     8e-13  29%  309 aa  YVX3_CAEEL RecName: Full=Uncharacterized oxidoreductase T05C12.3;  
    5::258     8e-13  28%  264 aa  YVAG_BACSU RecName: Full=Uncharacterized oxidoreductase yvaG;      
   64::249     8e-13  25%  253 aa  Y4MP_RHISN RecName: Full=Uncharacterized short-chain type
    5::248     8e-13  26%  250 aa  LINX_PSEPA RecName: Full=2,5-dichloro-2,5-cyclohexadiene-1,4-diol
    2::222     1e-12  30%  236 aa  FABG_SCHPO RecName: Full=3-oxoacyl-[acyl-carrier-protein]
  108::270     1e-12  32%  292 aa  DECR2_RAT RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase;     
   18::194     1e-12  32%  269 aa  YBBO_ECOLI RecName: Full=Uncharacterized oxidoreductase ybbO;      
   18::194     1e-12  32%  269 aa  YBBO_ECOL6 RecName: Full=Uncharacterized oxidoreductase ybbO;      
   85::237     1e-12  30%  260 aa  HSD_MYCTU RecName: Full=3-alpha-(or 20-beta)-hydroxysteroid
   85::237     1e-12  30%  260 aa  HSD_MYCBO RecName: Full=3-alpha-(or 20-beta)-hydroxysteroid
   78::271     2e-12  27%  309 aa  YWC4_CAEEL RecName: Full=Uncharacterized oxidoreductase W01C9.4;   
   12::255     2e-12  34%  261 aa  HCD2_RAT RecName: Full=3-hydroxyacyl-CoA dehydrogenase type-2;     
    9::206     4e-12  28%  284 aa  VDLC_HELPY RecName: Full=Probable short-chain type
  121::270     4e-12  32%  292 aa  DECR2_MOUSE RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase;   
  108::293     5e-12  29%  294 aa  YGHA_ECOLI RecName: Full=Uncharacterized oxidoreductase yghA;      
  108::293     5e-12  29%  294 aa  YGHA_ECO57 RecName: Full=Uncharacterized oxidoreductase yghA;      
  486::682     7e-12  29%  689 aa  YUXG_BACSU RecName: Full=Uncharacterized oxidoreductase yuxG;      
    5::233     7e-12  23%  237 aa  YJGI_ECOLI RecName: Full=Uncharacterized oxidoreductase yjgI;      
   60::254     7e-12  27%  261 aa  FABI_NEIMB RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   35::222     7e-12  25%  312 aa  DRS7C_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
    3::227     7e-12  32%  243 aa  BZRD_BACSU RecName: Full=Benzil reductase;         EC=1.1.1.n7;
   27::265     9e-12  24%  272 aa  THR1_GLOLA RecName: Full=Trihydroxynaphthalene reductase;       
   35::221     9e-12  26%  311 aa  DRS7C_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
   12::245     9e-12  23%  260 aa  DHRS4_PONAB RecName: Full=Dehydrogenase/reductase SDR family member
  191::334     1e-11  41%  342 aa  YR419_MIMIV RecName: Full=Uncharacterized short-chain type
   89::277     1e-11  30%  281 aa  SOU1_CANAL RecName: Full=Sorbose reductase SOU1;       
    2::256     1e-11  33%  256 aa  PTMA_CAMCO RecName: Full=Post-translational flagellin modification
   62::252     1e-11  35%  258 aa  FABI_ANASP RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   12::245     1e-11  23%  260 aa  DHRS4_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
    5::252     1e-11  29%  258 aa  DHG2_BACSU RecName: Full=Glucose 1-dehydrogenase 2;       
   94::243     2e-11  33%  894 aa  FOX2_NEUCR RecName: Full=Peroxisomal
   90::241     2e-11  34%  906 aa  FOX2_CANTR RecName: Full=Peroxisomal
   11::252     3e-11  29%  267 aa  YM71_YEAST RecName: Full=Uncharacterized oxidoreductase YMR226C;   
    2::255     3e-11  25%  259 aa  SRLD_ECOLI RecName: Full=Sorbitol-6-phosphate 2-dehydrogenase;     
    2::249     3e-11  31%  255 aa  HCD2_DROME RecName: Full=3-hydroxyacyl-CoA dehydrogenase type-2;   
    9::195     3e-11  32%  900 aa  FOX2_YEAST RecName: Full=Peroxisomal
   81::245     4e-11  30%  255 aa  YTKK_BACSU RecName: Full=Putative oxidoreductase ytkK;       
  201::295     7e-11  40%  299 aa  YHXD_BACSU RecName: Full=Uncharacterized oxidoreductase yhxD;      
    1::198     7e-11  29%  271 aa  VDLC_HELPJ RecName: Full=Probable short-chain type
    5::249     1e-10  26%  261 aa  DHG1_BACME RecName: Full=Glucose 1-dehydrogenase 1;       
   46::239     1e-10  31%  317 aa  DHRS7_ANOGA RecName: Full=Dehydrogenase/reductase SDR family
    5::249     1e-10  25%  261 aa  DHG_BACME RecName: Full=Glucose 1-dehydrogenase;       
    1::196     1e-10  29%  344 aa  DHB1_RAT RecName: Full=Estradiol 17-beta-dehydrogenase 1;       
   91::286     2e-10  35%  289 aa  PTR1_LEITA RecName: Full=Pteridine reductase 1;       
   35::254     2e-10  25%  331 aa  KDSR_BOVIN RecName: Full=3-ketodihydrosphingosine reductase;       
    1::196     2e-10  27%  344 aa  DHB1_MOUSE RecName: Full=Estradiol 17-beta-dehydrogenase 1;        
  145::248     2e-10  36%  257 aa  MOAE_KLEAE RecName: Full=Protein moaE;
   63::188     2e-10  30%  287 aa  HETN_ANASP RecName: Full=Ketoacyl reductase hetN;       
   54::251     2e-10  27%  270 aa  DHB14_BOVIN RecName: Full=17-beta-hydroxysteroid dehydrogenase 14; 
   35::254     3e-10  26%  332 aa  KDSR_HUMAN RecName: Full=3-ketodihydrosphingosine reductase;       
   64::255     3e-10  34%  261 aa  HCD2_HUMAN RecName: Full=3-hydroxyacyl-CoA dehydrogenase type-2;   
   10::248     3e-10  29%  249 aa  DHK2_STRVN RecName: Full=Granaticin polyketide synthase putative
    3::236     4e-10  28%  265 aa  PGDH_CAVPO RecName: Full=15-hydroxyprostaglandin dehydrogenase
   64::255     4e-10  35%  261 aa  HCD2_MOUSE RecName: Full=3-hydroxyacyl-CoA dehydrogenase type-2;   
   12::241     6e-10  24%  249 aa  RIDH_KLEAE RecName: Full=Ribitol 2-dehydrogenase;       
   66::252     6e-10  28%  258 aa  FABI_BACSU RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   35::221     6e-10  22%  311 aa  DRS7C_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
   25::257     8e-10  25%  261 aa  YQC8_SCHPO RecName: Full=Uncharacterized oxidoreductase C1739.08c; 
   12::253     8e-10  24%  258 aa  DHRS2_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
    5::200     1e-09  26%  249 aa  SDH_RHIRD RecName: Full=Serine 3-dehydrogenase;       
    5::200     2e-09  26%  249 aa  SDH_AGRT5 RecName: Full=Serine 3-dehydrogenase;       
   94::225     2e-09  31%  736 aa  DHB4_HUMAN RecName: Full=Peroxisomal multifunctional enzyme type 2;
   35::254     2e-09  26%  332 aa  KDSR_MOUSE RecName: Full=3-ketodihydrosphingosine reductase;       
   51::243     2e-09  25%  326 aa  DHRS7_DROME RecName: Full=Dehydrogenase/reductase SDR family
    2::248     2e-09  30%  249 aa  BZRD_BACCE RecName: Full=Benzil reductase;         EC=1.1.1.n7;
   64::255     3e-09  31%  261 aa  HCD2_BOVIN RecName: Full=3-hydroxyacyl-CoA dehydrogenase type-2;   
   35::221     3e-09  24%  311 aa  DRS7C_XENTR RecName: Full=Dehydrogenase/reductase SDR family member
    5::241     4e-09  28%  247 aa  YB45_SCHPO RecName: Full=Uncharacterized oxidoreductase C30D10.05c;
   61::226     4e-09  25%  231 aa  Y0585_STAHJ RecName: Full=Uncharacterized oxidoreductase SH0585;   
    6::192     4e-09  29%  312 aa  RDH8_BOVIN RecName: Full=Retinol dehydrogenase 8;       
   50::242     4e-09  26%  323 aa  DRS7B_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
   21::253     4e-09  27%  303 aa  ACR1_ACIAD RecName: Full=Fatty acyl-CoA reductase;       
    3::197     5e-09  30%  269 aa  PGDH_MOUSE RecName: Full=15-hydroxyprostaglandin dehydrogenase
  138::244     7e-09  31%  248 aa  Y4EL_RHISN RecName: Full=Uncharacterized short-chain type
   94::225     7e-09  31%  735 aa  DHB4_RAT RecName: Full=Peroxisomal multifunctional enzyme type 2;  
    3::254     7e-09  26%  277 aa  BPHB_PSEPU RecName: Full=Cis-2,3-dihydrobiphenyl-2,3-diol
   13::245     7e-09  27%  295 aa  ACR1_ACIBI RecName: Full=Fatty acyl-CoA reductase;       
    3::228     9e-09  25%  248 aa  Y432_LISMO RecName: Full=Uncharacterized oxidoreductase Lmo0432;   
   94::225     9e-09  31%  735 aa  DHB4_MOUSE RecName: Full=Peroxisomal multifunctional enzyme type 2;
   60::253     1e-08  24%  260 aa  FABI_BUCAP RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   34::260     1e-08  27%  309 aa  DRS7B_XENTR RecName: Full=Dehydrogenase/reductase SDR family member
    1::206     1e-08  30%  328 aa  DHB1_PANTR RecName: Full=Estradiol 17-beta-dehydrogenase 1;        
  192::285     2e-08  39%  288 aa  PTR1_LEIMA RecName: Full=Pteridine reductase 1;       
   63::237     2e-08  29%  266 aa  PGDH_MACFA RecName: Full=15-hydroxyprostaglandin dehydrogenase
   63::237     2e-08  29%  266 aa  PGDH_HUMAN RecName: Full=15-hydroxyprostaglandin dehydrogenase
  153::253     2e-08  36%  262 aa  FABI_HAEIN RecName: Full=Enoyl-[acyl-carrier-protein] reductase
  206::326     3e-08  41%  336 aa  TS2_MAIZE RecName: Full=Sex determination protein tasselseed-2;
    4::276     3e-08  25%  277 aa  LIMC_RHOER RecName: Full=(-)-trans-carveol dehydrogenase;       
   64::249     3e-08  27%  275 aa  FABI_HELPJ RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    3::223     3e-08  29%  252 aa  DLTE_BACSU RecName: Full=Uncharacterized oxidoreductase dltE;      
    1::206     3e-08  29%  328 aa  DHB1_HUMAN RecName: Full=Estradiol 17-beta-dehydrogenase 1;        
    3::228     3e-08  25%  248 aa  Y452_LISIN RecName: Full=Uncharacterized oxidoreductase Lin0452;   
   59::253     3e-08  26%  265 aa  FABI_PSEAE RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    3::198     4e-08  24%  296 aa  YAEB_SCHPO RecName: Full=Uncharacterized oxidoreductase C23D3.11;  
   63::197     4e-08  33%  266 aa  PGDH_BOVIN RecName: Full=15-hydroxyprostaglandin dehydrogenase
    7::239     4e-08  30%  240 aa  FOLM_KLEP7 RecName: Full=Dihydrofolate reductase folM;       
   89::240     6e-08  30%  441 aa  MFEA_DICDI RecName: Full=Peroxisomal multifunctional enzyme A;     
    4::253     6e-08  24%  262 aa  FABI_SHIFL RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    4::253     6e-08  24%  262 aa  FABI_ECOLI RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    4::253     6e-08  24%  262 aa  FABI_ECO57 RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   80::288     6e-08  28%  387 aa  DHB2_HUMAN RecName: Full=Estradiol 17-beta-dehydrogenase 2;        
   61::246     6e-08  26%  254 aa  3BHD_COMTE RecName: Full=3-beta-hydroxysteroid dehydrogenase;      
   41::129     8e-08  39%  129 aa  YUSR_BACSU RecName: Full=Short-chain dehydrogenase/reductase
   48::260     8e-08  29%  339 aa  DHRS7_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
  169::262     8e-08  37%  266 aa  DCXR_TRIRE RecName: Full=L-xylulose reductase;         Short=XR;   
    3::254     8e-08  27%  277 aa  BPHB_BURXL RecName: Full=Cis-2,3-dihydrobiphenyl-2,3-diol
   78::263     1e-07  25%  267 aa  MTDH_CLAHE RecName: Full=Probable NADP-dependent mannitol
   40::263     1e-07  28%  269 aa  INHA_MYCTU RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   40::263     1e-07  28%  269 aa  INHA_MYCBO RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   67::252     1e-07  30%  258 aa  FABI_SYNY3 RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    4::253     1e-07  24%  262 aa  FABI_SALTY RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   48::243     1e-07  28%  338 aa  DHRS7_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
   60::271     1e-07  24%  320 aa  DHB12_XENTR RecName: Full=Estradiol 17-beta-dehydrogenase 12;      
   52::244     1e-07  28%  312 aa  DHB12_ANAPL RecName: Full=Estradiol 17-beta-dehydrogenase 12;      
   60::251     1e-07  26%  319 aa  DH12A_DANRE RecName: Full=Estradiol 17-beta-dehydrogenase 12-A;    
    1::190     1e-07  23%  280 aa  YUSZ_BACSU RecName: Full=Uncharacterized oxidoreductase yusZ;      
  109::268     1e-07  26%  341 aa  RDH10_XENTR RecName: Full=Retinol dehydrogenase 10;       
    3::255     1e-07  25%  280 aa  BPHB_RHOGO RecName: Full=Cis-2,3-dihydrobiphenyl-2,3-diol
  326::552     2e-07  23%  592 aa  EPHD_MYCTU RecName: Full=Probable oxidoreductase ephD;       
  326::552     2e-07  23%  592 aa  EPHD_MYCBO RecName: Full=Probable oxidoreductase ephD;       
   50::244     2e-07  24%  325 aa  DRS7B_PONAB RecName: Full=Dehydrogenase/reductase SDR family member
   50::244     2e-07  24%  325 aa  DRS7B_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   63::250     2e-07  27%  270 aa  FABI_AQUAE RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   81::286     2e-07  30%  381 aa  DHB2_RAT RecName: Full=Estradiol 17-beta-dehydrogenase 2;       
   70::260     3e-07  30%  326 aa  YL426_YEAST RecName: Full=Uncharacterized oxidoreductase YLR426W;  
   38::227     3e-07  28%  308 aa  YD114_YEAST RecName: Full=Uncharacterized oxidoreductase YDL114W;  
    9::186     3e-07  26%  248 aa  Y4EK_RHISN RecName: Full=Uncharacterized short-chain type
    4::227     3e-07  25%  246 aa  Y1627_STAS1 RecName: Full=Uncharacterized oxidoreductase SSP1627;  
   78::255     3e-07  28%  353 aa  MKAR_ASPTN RecName: Full=3-ketoacyl-CoA reductase;       
   51::280     4e-07  28%  315 aa  STDH2_CAEEL RecName: Full=Putative steroid dehydrogenase 2;        
   37::220     4e-07  22%  324 aa  DS7CA_DANRE RecName: Full=Dehydrogenase/reductase SDR family member
   35::229     4e-07  25%  309 aa  DRS7B_DANRE RecName: Full=Dehydrogenase/reductase SDR family member
   54::289     4e-07  27%  312 aa  DHB12_MACFA RecName: Full=Estradiol 17-beta-dehydrogenase 12;      
  115::268     5e-07  26%  341 aa  RD10B_XENLA RecName: Full=Retinol dehydrogenase 10-B;       
   44::200     6e-07  24%  236 aa  YI78_SCHPO RecName: Full=Uncharacterized oxidoreductase
   58::250     6e-07  27%  318 aa  DH12A_XENLA RecName: Full=Estradiol 17-beta-dehydrogenase 12-A;    
   62::252     6e-07  27%  275 aa  BPHB_PSEPS RecName: Full=Cis-2,3-dihydrobiphenyl-2,3-diol
  113::266     8e-07  26%  339 aa  RD10A_DANRE RecName: Full=Retinol dehydrogenase 10-A;       
   54::294     8e-07  26%  312 aa  DHB12_HUMAN RecName: Full=Estradiol 17-beta-dehydrogenase 12;      
    8::185     1e-06  25%  292 aa  YQ53_SCHPO RecName: Full=Uncharacterized oxidoreductase C162.03;   
    2::198     1e-06  29%  248 aa  YDFG_ECOL6 RecName: Full=NADP-dependent L-serine/L-allo-threonine
  115::268     1e-06  25%  341 aa  RD10A_XENLA RecName: Full=Retinol dehydrogenase 10-A;       
   60::251     1e-06  26%  262 aa  FABI_RICBR RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    2::198     1e-06  28%  248 aa  YDFG_SHIFL RecName: Full=NADP-dependent L-serine/L-allo-threonine
   89::276     1e-06  23%  280 aa  SOU2_CANAL RecName: Full=Sorbose reductase homolog SOU2;       
  164::286     1e-06  29%  381 aa  DHB2_MOUSE RecName: Full=Estradiol 17-beta-dehydrogenase 2;        
   54::245     1e-06  29%  312 aa  DHB12_MOUSE RecName: Full=Estradiol 17-beta-dehydrogenase 12;      
   81::254     1e-06  28%  281 aa  BPHB_COMTE RecName: Full=Cis-2,3-dihydrobiphenyl-2,3-diol
   98::273     1e-06  27%  285 aa  ABA2_ARATH RecName: Full=Xanthoxin dehydrogenase;       
  110::288     2e-06  25%  336 aa  RD10B_DANRE RecName: Full=Retinol dehydrogenase 10-B;       
  169::262     2e-06  31%  266 aa  MTDH_ALTAL RecName: Full=Probable NADP-dependent mannitol
   68::260     2e-06  27%  331 aa  HSDL1_CHICK RecName: Full=Hydroxysteroid dehydrogenase-like protein
  165::253     2e-06  36%  272 aa  FABI1_RHIME RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   45::227     2e-06  22%  318 aa  DS7CB_DANRE RecName: Full=Dehydrogenase/reductase SDR family member
   38::228     2e-06  26%  323 aa  DRS7B_XENLA RecName: Full=Dehydrogenase/reductase SDR family member
   52::244     2e-06  26%  325 aa  DRS7B_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
   34::270     2e-06  27%  300 aa  DHB11_HUMAN RecName: Full=Estradiol 17-beta-dehydrogenase 11;      
   81::254     2e-06  28%  276 aa  BPHB_PSES1 RecName: Full=Cis-2,3-dihydrobiphenyl-2,3-diol
   34::270     2e-06  27%  300 aa  DHB11_PONAB RecName: Full=Estradiol 17-beta-dehydrogenase 11;      
   58::250     2e-06  27%  318 aa  DH12B_XENLA RecName: Full=Estradiol 17-beta-dehydrogenase 12-B;    
    2::198     3e-06  29%  248 aa  YDFG_ECO57 RecName: Full=NADP-dependent L-serine/L-allo-threonine
    2::198     4e-06  28%  248 aa  YDFG_ECOLI RecName: Full=NADP-dependent L-serine/L-allo-threonine
   51::239     4e-06  32%  314 aa  STDH1_CAEEL RecName: Full=Putative steroid dehydrogenase 1;        
   60::251     4e-06  26%  260 aa  FABI_RICFE RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   80::268     4e-06  26%  386 aa  DHI2_MOUSE RecName: Full=Corticosteroid 11-beta-dehydrogenase
   34::223     4e-06  25%  300 aa  DHB13_HUMAN RecName: Full=17-beta hydroxysteroid dehydrogenase 13; 
   28::208     5e-06  23%  230 aa  DR4L2_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   54::245     5e-06  29%  312 aa  DHB12_RAT RecName: Full=Estradiol 17-beta-dehydrogenase 12;        
    4::234     7e-06  26%  253 aa  YCP8_SCHPO RecName: Full=Uncharacterized oxidoreductase C663.08c;  
   37::223     7e-06  23%  286 aa  YBPE_SCHPO RecName: Full=Uncharacterized oxidoreductase C16H5.14c; 
   95::231     7e-06  25%  309 aa  RDHE2_MOUSE RecName: Full=Epidermal retinal dehydrogenase 2;       
   39::286     7e-06  26%  331 aa  RDH13_HUMAN RecName: Full=Retinol dehydrogenase 13;       
  276::367     7e-06  35%  385 aa  FABI_BRANA RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   50::244     7e-06  24%  325 aa  DRS7B_RAT RecName: Full=Dehydrogenase/reductase SDR family member
    5::227     7e-06  27%  313 aa  DHRS1_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
  115::268     9e-06  25%  341 aa  RDH10_RAT RecName: Full=Retinol dehydrogenase 10;       
  115::268     9e-06  25%  341 aa  RDH10_MOUSE RecName: Full=Retinol dehydrogenase 10;       
  115::268     9e-06  25%  341 aa  RDH10_HUMAN RecName: Full=Retinol dehydrogenase 10;       
  115::268     9e-06  25%  341 aa  RDH10_BOVIN RecName: Full=Retinol dehydrogenase 10;       
   57::265     1e-05  27%  269 aa  INHA_MYCS2 RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   60::251     1e-05  25%  261 aa  FABI_RICPR RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   64::249     1e-05  25%  275 aa  FABI_HELPY RecName: Full=Enoyl-[acyl-carrier-protein] reductase
  155::250     1e-05  32%  268 aa  FABI2_RHIME RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   63::192     2e-05  22%  253 aa  Y5909_MYXXD RecName: Full=Uncharacterized oxidoreductase MXAN_5909;
  108::275     2e-05  32%  278 aa  FABG_YEAST RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   34::223     2e-05  24%  304 aa  DHB13_MOUSE RecName: Full=17-beta hydroxysteroid dehydrogenase 13; 
   34::224     2e-05  26%  298 aa  DHB11_RAT RecName: Full=Estradiol 17-beta-dehydrogenase 11;        
   34::223     2e-05  25%  298 aa  DHB11_MOUSE RecName: Full=Estradiol 17-beta-dehydrogenase 11;      
    3::199     3e-05  28%  263 aa  YIV6_YEAST RecName: Full=Uncharacterized oxidoreductase YIR036C;   
    4::234     3e-05  25%  253 aa  YCP6_SCHPO RecName: Full=Uncharacterized oxidoreductase C663.06c;  
   71::282     3e-05  23%  345 aa  MKAR_NEOFI RecName: Full=3-ketoacyl-CoA reductase;       
    5::203     3e-05  23%  313 aa  DHRS1_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   51::239     4e-05  31%  349 aa  STDH3_CAEEL RecName: Full=Putative steroid dehydrogenase 3;        
   34::227     4e-05  25%  316 aa  S16C6_BOVIN RecName: Full=Short chain dehydrogenase/reductase
   64::282     5e-05  24%  339 aa  MKAR_AJECN RecName: Full=3-ketoacyl-CoA reductase;       
   63::248     5e-05  24%  305 aa  LIGD_PSEPA RecName: Full=C alpha-dehydrogenase;         EC=1.-.-.-;
   80::268     5e-05  27%  400 aa  DHI2_RAT RecName: Full=Corticosteroid 11-beta-dehydrogenase isozyme
   34::223     5e-05  24%  300 aa  DHB13_RAT RecName: Full=17-beta hydroxysteroid dehydrogenase 13;   
   34::240     5e-05  23%  300 aa  DHB11_MACFA RecName: Full=Estradiol 17-beta-dehydrogenase 11;      
   10::223     6e-05  27%  252 aa  YCIK_ECOLI RecName: Full=Uncharacterized oxidoreductase yciK;      
   51::263     6e-05  30%  316 aa  LE767_CAEEL RecName: Full=Putative steroid dehydrogenase let-767;  
   36::231     6e-05  23%  302 aa  DHRS3_BOVIN RecName: Full=Short-chain dehydrogenase/reductase 3;   
  109::214     8e-05  35%  341 aa  Y1570_MYCBO RecName: Full=Uncharacterized oxidoreductase Mb1570;   
  109::214     8e-05  35%  341 aa  Y1543_MYCTU RecName: Full=Uncharacterized oxidoreductase
   18::205     8e-05  29%  274 aa  MOMAS_ORYSJ RecName: Full=Momilactone A synthase;       
   65::248     8e-05  28%  346 aa  MKAR_PICST RecName: Full=3-ketoacyl-CoA reductase;       
  145::239     8e-05  33%  240 aa  FOLM_CITK8 RecName: Full=Dihydrofolate reductase folM;       
   60::251     8e-05  24%  261 aa  FABI_RICTY RecName: Full=Enoyl-[acyl-carrier-protein] reductase
  154::251     8e-05  30%  260 aa  FABI_RICCN RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   36::231     8e-05  23%  302 aa  DHRS3_HUMAN RecName: Full=Short-chain dehydrogenase/reductase 3;   
   10::200     1e-04  24%  253 aa  Y945_MYCTU RecName: Full=Uncharacterized oxidoreductase
  109::223     1e-04  27%  319 aa  DHRS9_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
   10::200     1e-04  26%  297 aa  AYR1_YEAST RecName: Full=NADPH-dependent 1-acyldihydroxyacetone
   34::204     2e-04  23%  316 aa  S16C6_MOUSE RecName: Full=Short chain dehydrogenase/reductase
  115::227     2e-04  25%  254 aa  Y3820_MYCBO RecName: Full=Uncharacterized oxidoreductase Mb3820;   
  115::227     2e-04  25%  254 aa  Y3791_MYCTU RecName: Full=Uncharacterized oxidoreductase
  153::250     2e-04  32%  260 aa  FABI_BUCAI RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   87::242     3e-04  27%  259 aa  YI13_SCHPO RecName: Full=Uncharacterized oxidoreductase C521.03;   
   71::282     3e-04  24%  345 aa  MKAR_ASPFU RecName: Full=3-ketoacyl-CoA reductase;       
   71::282     3e-04  24%  345 aa  MKAR_ASPFC RecName: Full=3-ketoacyl-CoA reductase;       
   95::231     4e-04  23%  309 aa  RDHE2_HUMAN RecName: Full=Epidermal retinal dehydrogenase 2;       
   71::282     4e-04  22%  345 aa  MKAR_ASPCL RecName: Full=3-ketoacyl-CoA reductase;       
   36::231     5e-04  23%  302 aa  DHRS3_MOUSE RecName: Full=Short-chain dehydrogenase/reductase 3;   
   88::216     7e-04  22%  320 aa  TSC10_YEAST RecName: Full=3-ketodihydrosphingosine reductase TSC10;
  479::556     7e-04  34%  573 aa  PATL1_ARATH RecName: Full=Patellin-1;
   13::197     9e-04  24%  417 aa  HSDL2_XENLA RecName: Full=Hydroxysteroid dehydrogenase-like protein
  170::261     9e-04  26%  298 aa  DECR2_ARATH RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase;   
    1::235

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSNRIVLITGATKRIGLATSLYLNNQGWQVIGIARSYIDNFPGELFLCDLANEEQTASTLIQINEIHGCP
FABG_VIBHA      LEGKIALVTGASRGIGRAIAELLVERGATVIGTATSEISEYLGENLALNVTDVESIEATLKTINDECGAI
FABG_PSEAE      LQGKVALVTGASRGIGQAIALELGRLGAVVIGTATSAANGVEGAGLVLDVSSDESVAATLEHIQQHLGQP
FABG_MYCS2      --SRSVLVTGGNRGIGLAIARRLAADGHKVAVTHRG--SGAPDDLFQCDVTDSAAVDRAFKEVEEHQGPV
FABG_THEMA      LEGKVCLITGAASGIGKATTLLFAQEGATVIAISKENLDSLPGKVYVLNVTDRDQIXXXXXXXXQKYGRI
FABG_CUPLA      ----VVIVTGASRGIGKAIALSLGKAGCKVVNYARSSIEAFGGQAFGGDVSKEEDVEAMIKTAVDAWGTV
FABG_MYCAV      --SRSVLVTGGNRGIGLAIAQRLAAEAHKVAVTHRG--SGAPDGLFECDVTDNDAVDRAFTEVEEHQGPV
FABG_BUCBP      -TKKIAVITGANRGLGKGIAEELSNNNITVIGTSTSYLKN-NGIGIKLDITNPNEITKTMDFVYKNFGRV
FABG_SHIFL      ---KIALVTGASRGIGRAIAETLAARGAKVIGTATSEISDYNGKGLMLNVTDPASIESVLEKIRAEFGEV
FABG_ECOLI      ---KIALVTGASRGIGRAIAETLAARGAKVIGTATSEISDYNGKGLMLNVTDPASIESVLEKIRAEFGEV
FABG_BUCAP      IEKKTALVTGANQGLGKEIAIKLSQKGIQVIGTSTTVINKYNGFGFILDLKDTDSILEKMKEICQKKYSI
FABG_HAEIN      MQGKIALVTGSTRGIGRAIAEELSSKGAFVIGTATSYLGD-KGKGLVLNVTDKESIETLLEQIKNDFGDI
FABG_MYCTU      --SRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRG--SGAPKGLFECDVTDSDAVDRAFTAVEEHQGPV
FABG_MYCBO      --SRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRG--SGAPKGLFECDVTDSDAVDRAFTAVEEHQGPV
FABG_RICPR      LTGKTSLITGASSGIGSAIARLLHKLGSKVISLGNALKDNYTIEV--CNLANKEECSNLISKTSNL----
NODG_AZOBR      MSQKIALVTGAMGGLGTAICQALAKDGCIV---AANCLPNFPAAAWLGDVSDFESCKAMVAKIEADLGPV
FABG_VIBCH      LEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSYLDN--GKGMALNVTNPESIEAVLKAITDEFGGV
FABG_BACSU      LNDKTAIVTGASRGIGRSIALDLAKSGANVVAKANEVVDEIKSMAVKADVSNPEDVQNMIKETLSVFSTI
FIXR_BRAJA      ---KVMLLTGASRGIGHATAKLFSEAGWRIISCARQPFDGCPWEAFQVDLGDHRMLPRAITEVKKLAGAP
FABG_CHLMU      --NKAAIVTGGSRGIGFGIAKLFAEHGAQIWGIAQDLSDKTGSKVSLVDVSKNDMVSAQVQKFLAEYGTI
FABG_CHLTR      --NKTAIVTGGSRGIGFSIAKLFAEQGWGINGEAGQAAAQTLSEFALVDVSKNDMVSAQVQNFLAEYNTI
FABG_STAES      --NKSALVTGASRGIGRSIALQLAEEGYNVADKAEAVVEEIKAKAIQANVAKGDEVKEMIKEVVSQFGSV
FABG_STAEQ      --NKSALVTGASRGIGRSIALQLAEEGYNVADKAEAVVEEIKAKAIQANVAKGDEVKEMIKEVVSQFGSV
FABG_AQUAE      LQGKVSLVTGSTRGIGRAIAEKLASAGSTVIEIANKYGVKAHGVEM--NLLSEESINKAFEEIYNLVDGI
YXJF_BACSU      MRKQVALVTGAAGGIGFEIAREFAREGASVIAASKLAEEGFDAAAIPYDVTKEAQVADTVNVIQKQYGRL
FABG_BUCAI      INRQTAFITGANQXXXXXXXXXXXXXXXQVIGTSTTYLEG-NGFGFVLNLKNIDSITEKIQEIYKKKHSI
BACC2_BACSU     LTDKTVLITGGASGIGYAAQAFLNQQANVVV----ADIDEAQGEAMITDITDEPACQNAIRSAVDKFGGL
DCXR_BOVIN      LAGRRALVTGAGKGIGRSIVKALHAAGARVVAVSRTQADECPGVETVCDLADWEATEQALGGVGPV----
LVR_LEIAQ       -TDRVVLITGGGSGLGRATAVRLAAEGAKLSGLEASVLETAPDAEVLADVSDEAQVEAYVTATTERFGRI
FABG_SALTY      ---KIALVTGASRGIGRAIAETLVARGAKVIGTATSEISDYNGKGLMLNVTDPASIESVLENIRAEFGEV
FABG_SALTI      ---KIALVTGASRGIGRAIAETLVARGAKVIGTATSEISDYNGKGLMLNVTDPASIESVLENIRAEFGEV
FABG_RICTY      ----------------------------------------------VCNLANKEECNNLISKISNL----
DHRS4_RABIT     LANKVAIVTASTDGIGLAIARRLAQDGAHVVISSRKQVDRAVAALTVCHVGKAEDRERLVATALNLHGGI
DCXR_MOUSE      LAGRRALVTGAGKGIGRSTVLALKAAGAQVVAVSRTREDECPGVEPVCDLADWEATEQALSNVGPV----
PHBB_RHIME      --SRVALVTGGSRGIGAAICVALKAAGYKV---AANYAGNFEQEVYKWDVSSYQACVDGIARVEADLGPV
NODG_RHIS3      LTGRKALVTGASGGIGEAIARVLHAQG-AIVGLHGTRVEKLETKLFPANLSNRDEVKALGQKAEADLEGV
DCXR_RAT        LAGRRALVTGAGKGIGRSTXXXXXXXXXXXXXXSRSLVRECPGVEPVCDLADWEATEQALSNVGPV----
BUDC_KLEPN      ---KVALVTGAGQGIGKAIALRLVKDGFAVAKAVASEINQAGGRAMAVDVSDRDQVFAAVEQARKTLGGF
FABG_STAAW      ------LVTGASRGIGRSIALQLAEEGYNVAXXXXXXXDSFAIQ---ANVADADEVKAMIKEVVSQFGSL
FABG_STAAS      ------LVTGASRGIGRSIALQLAEEGYNVAXXXXXXXDSFAIQ---ANVADADEVKAMIKEVVSQFGSL
FABG_STAAR      ------LVTGASRGIGRSIALQLAEEGYNVAXXXXXXXDSFAIQ---ANVADADEVKAMIKEVVSQFGSL
FABG_STAAN      ------LVTGASRGIGRSIALQLAEEGYNVAXXXXXXXDSFAIQ---ANVADADEVKAMIKEVVSQFGSL
FABG_STAAM      ------LVTGASRGIGRSIALQLAEEGYNVAXXXXXXXDSFAIQ---ANVADADEVKAMIKEVVSQFGSL
FABG_STAAC      ------LVTGASRGIGRSIALQLAEEGYNVAXXXXXXXDSFAIQ---ANVADADEVKAMIKEVVSQFGSL
DCXR_CAEEL      -TDKRILVTGASQGIGKEICLSLAKAGAQVIAFARNEANLLSLVKETTSLANEEVLFKLIVPHFPIHG--
FABG_RICBR      ----------------------------------------------VCNLTNTEECSNLVAQIEKL----
DCXR_CAVPO      LAGRRALVTGAGKGIGRSTVLALKAAGAQVVAVSRTREDECPGVEPVCDLADWEATEQALSNV----GPX
BACC_BACSU      LTDKTVLITGGASGIGYAAQAFLGQQANVVV----ADIDEAQGEAMVTDITDEAACQHAVESAVHTFGGL
PHAB_ACISR      ---KVALVTGALGGIGSEICRQLVTAGYKIIALQSEGFQDSDVRFVLTDLNNHXXXXXXXXXXXXXXGRV
KDUD_DICD3      LQGKVALITGCDTGLGQGMAVGLAEAGCDIVGVPKETIEKVTGRRFLADMSDISGHAALVEKAVAEFGKV
CMTB_PSEPU      LEGQVAVVTGGAHGIGLGIVERLLGLGARVTA---SDIDE-SGLSLLCEXLSEEQGAQGLHRAAERFGSV
CMTB_PSEP1      LEGQVAVVTGGAHGIGLGIVERLLGLGARVTA---SDIDE-SGLSLLCEXLSEEQGAQGLHRAAERFGSV
CBR4_DANRE      --SRLAVVFGGSRGIGRAASKLLAQRGHRIVLLSRSTAQSLPGENHLCDVSKEEEVQKAFETINKTCGTV
TRNH_DATST      ------LVTGGTRGIGYAIVEELANFGAEVYTCSRSQNDGFKVSGPVCDVSSISQRQTLMESVSSFNGKL
TRN2_HYONI      ------LVTGGSRGIGYGIVEELANLGASVYTCSRNQKEGFNVEASVCDLSSRSEREEFMKTVNHFHGKL
TRN2_DATST      ------LVTGGSRGIGYGIVEELASLGASVYTCSRNQKEGFKVEASVCDLSSRSERQELMNTVNHFHGKL
DCXR_MESAU      LAGRRALVTGAGKGIGRSTVLALQAAGAHVVAVSRSLVSECPGVETVCDLADWEATEQALSSVGPV----
BACC_BACAM      LTDKTVLITGGASGIGYAAQAFLNQQANVVV----ADIDEAQGEAMITDITNEPACQNAILSAVDKFGGL
Y325_THEMA      ---KVVLITGAGSGIGKKAAVMFAERGAKVADISEELIKSMGGEFIFGDVAKDEQIVKKTV---ETFGRL
FABG1_SYNY3     ----------------------------------------------------------------------
PHBB_ZOORA      --SRVALVTXXXXXXXXXXXXXLKAAGYKV---AASYAGNFKAEVYKWDVSSYEACVEGIAKVEADLGPI
PHAB_PARDE      ---KVALVTGGSRGIGAAISKALKEAGYTVAAAARAFTEETGIKTYKWSVADYDACAAGIKQVEEELGPI
YOHF_ECOLI      ---QVAIITASDSGIGKECALLLAQQGFD-IGIAREVVSHVRAEIVQLDLGNLPEGALALEKLIQRLGRI
YMFI_BACSU      --NKTALITGASGGIGKSISETLAARGYNLLAEKLSQMFGVNAEILQADLSAQDKLTSSIVQPI------
TRN1_DATST      ------LVTGGSKGIGYAIVEELAGLGARVYTCSRNEKENVEGSV--CDLLSRTERDKLMQTVAHVFGKL
FABG3_BRANA     --------TGASRGIGKAIALSLGKAGCKVVNYARSQIEAYGGQAFGGDVSKEADVEAMMKTAIDAWGTI
FABG1_BRANA     --------TGASRGIGKAIALSLGKAGCKVVNYARSQIEAYGGQAFGGDVSKEADVEAMMKTAIDAWGTI
DHG2_BACME      LKDKVVVVTGGSKGLGRAMAVRFGQEQSKVVVNYRSNXXXXXGQAIIVDVTKEEDVVNLVETAVKEFGSL
FABG2_BRANA     --------TGASRGIGKAIALSLGKAGCKVVNYARSQIEAYGGQAFGGDVSKEADVDAMMKTAVDAWGTI
CBR4_XENTR      ---KVCAVFGGSRGIGKAVSKLLAQRDYKVAVISRDXXXXXXXXXXXCDVSKENEIQDTFKEITNNLGNV
FABG2_SYNY3     LEDKVIVVTGGNRGIGAAIVKLLQEMGAKV-----AFTDNTEALGVVANVTDLESMTAAAAEITDKLGPV
YVRD_BACSU      LKEKLVLITGSTSGIGKAAAKSFLQEGAAVIGRKQETVDRTIEELSAADLSKTDEAAAFIEKVNEI-GDI
FABG_CHLPN      -----VIVTGGSRGIGLGVKLFLENGAVEIWGLGQAVIESLTGSFARVDVSHNGGVKDCVQKFLDKHNKI
PHBB_CHRVI      --------------------------------------------VFTADVSSFDDSARMVREITEQVGPI
KDUD_BACSU      LKGKTALVTGPGTGIGQGIAKALAGAGADIIGTSHTSSLSETQQLFTLDMSKPEDSAAELFENRQI----
BDH2_MOUSE      LDGKVIVLTAAAQGIGRASALAFAREGAKVIATKLQELESYRGQTRVLDVTKKRQIDQFASEIERI----
LINC_PSEPA      ---------------------------------------------FRCDIAQEEDVKALVAQTLAAFGGL
KDUD_ECOLI      ----------------------------------------------------------------------
GRDH_ORYSJ      -------------------------------------------------------------------GAI
CPNA_COMTE      VNDKVVLVTGGAMGMGLTHCTLLAREGATVYAVAEIRRQGGKAHFLHLDVTNENHWTGAVDTILAESDRL
CPNA_COMS9      VNDKVVLVTGGAMGMGLTHCTLLAREGATVYAVAEIRRQGGKAHFLHLDVTNENHWTGAVDTILAESDRL
YJDA_BACSU      ---KIALITGASSQIGTAICRKLASQGIHIFNSDTAWIEEFQQEILRMDLSDAHAAFTIHEKISDKLGYP
Y4VI_RHISN      ------------------------------------------------DVSREDDVVALRALLEKRFSRI
BDHA_RHIME      ---KTAVITGSTSGIGLAIARTLAKAGANIVGLSSGTVLHHPA-----DMTKPSEIADMMAMVADRFGGA
YKVO_BACSU      ---KIALVTGGTSGIGLATAQKFVNEGAYVYGRRQNELDKAVNQIVQGDISKLEDLDKLYDIIKQEKGKL
PHBB_RALEH      MTQRIAYVTGGMGGIGTAICQRLAKDGFRVVALEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEV
YLX6_SCHPO      VEGRVVLITGAAGGIGKVLCKMFTELGDRVAGI--DIVD--PSKVLQADVSKADQIETAIEKVIQTLGPI
YHXC_BACSU      LEGKTAIITGGDSGIGRAVSVLFAKEGANVVIVTKQYVEKEGVKCLLIDVGDEAFCNDVVGQASQVFPSI
YGFF_ECOLI      ----IALVTGGSRGIGRATALLLAQEGYTV---AVNYQQNLHGKAFVADISDENQVVAMFTAIDQHDEPL
FABG5_BRANA     --------TGASRGIGKAIALSLGKAGCKVVNYARSQIEEYGGEAFGGDVSKEADVDSMMKTAVDKWGTI
FABG4_BRANA     ---------GASRGIGKAIALSLGKAGCKVVNYARSQIEEYGGQAFGGDVSKEADVDAMMKTAVDKWGTI
DECR_MOUSE      ---KVAFITGGGTGLGKAMTTFLSTLGAQCVIASRNIISSKTGNAIRCDVRDPDMVHNTVLELIKVAGHP
HDHA_ECOLI      -------------------------------------IQQLGGQAFACDITSEQELSALADFAISKLGKV
HDHA_ECO57      -------------------------------------IQQLGGQAFACDITSEQELSALADFAISKLGKV
HDHA_CLOSO      LENKVALVTSATRGIGLASAIKLAQNGAIVMGVRREICDKYKEEGLILDAYNIDIYKEMIDTIIKNEGKI
DHKR_STRCM      -TSRVALVTGATSGIGLATARLLAAQGHLVFLGARTESDGLEAEGQVLDVRDGASVTAFVQAAVDRYGRI
BUTA_STAAW      -NNKVALVTGGAQGIGFKIAERLVEDGFKVAVVLKLSSDGTKAIAIKADVSNRDDVFNAVRQTAAQFGDF
BUTA_STAAS      -NNKVALVTGGAQGIGFKIAERLVEDGFKVAVVLKLSSDGTKAIAIKADVSNRDDVFNAVRQTAAQFGDF
BUTA_STAAR      -NNKVALVTGGAQGIGFKIAERLVEDGFKVAVVLKLSSDGTKAIAIKADVSNRDDVFNAVRQTAAQFGDF
BUTA_STAAN      -NNKVALVTGGAQGIGFKIAERLVEDGFKVAVVLKLSSDGTKAIAIKADVSNRDDVFNAVRQTAAQFGDF
BUTA_STAAM      -NNKVALVTGGAQGIGFKIAERLVEDGFKVAVVLKLSSDGTKAIAIKADVSNRDDVFNAVRQTAAQFGDF
BUTA_STAAC      -NNKVALVTGGAQGIGFKIAERLVEDGFKVAVVLKLSSDGTKAIAIKADVSNRDDVFNAVRQTAAQFGDF
UCPA_ECOLI      LTGKTALITGALQGIGEGIARTFARHGANLILLDISEIEKLADELVVADVRDPASVAAAIKRAKEKEGRI
DHRS4_BOVIN     LDNKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQVATLKGEGLVCHVGKAEDRERLVATAVKLHGGV
DHR11_HUMAN     --DRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNGYPGTLYRCDLSNEEDILSMFSAIRSQHSGV
ACT3_STRCO      --SEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGGVEADGRTCDVRSVPEIEALVAAVVERYGPV
PECR_PONAB      LQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLLKSAAGELIQCNIRNEEEVNNLVKSTLDIFGKI
FADH_BACSU      MEKKAVIITGGSSGMGKAMAKKQAELGWHVMVTGRNHIQTFEGQVFQMDVRSDSAASDMIKEAVKAFGRL
FABG_RICFE      --------------------------------------DNYTIEI--CNLANKEECSNLISKAPKL----
DECR_RAT        ---KVAFITGGGTGLGKAMTTFLSSLGAQCVIASRNIITSKTGNAIRCDVRDPDMVHNTVLELIKVAGHP
Y1385_MYCBO     -----------------------------------------------CDVTQADDVDILIRTAVERFGGL
Y1350_MYCTU     -----------------------------------------------CDVTQADDVDILIRTAVERFGGL
UCPA_ECO57      LTGKTALITGALQGIGEGIARTFARHGANLILLDISEIEKLADELVVADVRDPASVAAAIKRAKEKEGRI
BDH2_BOVIN      ----------------------------------------------------------------------
NODG_RHIME      -------------------------------------------KLFPANLANRDEVKALGQRAEADLEGV
GNO_GLUOX       LSGARALVTGASRGIGLTLAKGLARYGAEVVLNGRNAAEGLKASTAVFDVTDQDAVIDGVAAIERDMGPI
UCPA_SALTY      LTGKTALITGASQGIGEGIARVFARHGANLILLDISLADELGGRGHRCDVRDFASVQAAVARAKETEGRI
UCPA_SALTI      LTGKTALITGASQGIGEGIARVFARHGANLILLDISLADELGGRGHRCDVRDFASVQAAVARAKETEGRI
DER_CHICK       ---RRALVTGAGKGIGRAVAVALCKAGARVTALSRTAADECPGIEPLCDLADWDATEAAV----GAAGPF
YXBG_BACSU      -------------------------------------------ESFHLDVSDENSVKAFADQIKDACGTI
YHDF_BACSU      LKGKVAIITGGDSGIGRAAAIAFAKEG---ADISILYLDNVRCLLIPGDVGDENHCEQAVQQTVDHFGKL
IDNO_ECOLI      LAGKNILITGSAQGIGFLLATGLGKYGAQIIAVEKLHQEGIQAVAAPFNVTHKHEIDAAVEHIEKDIGPI
IDNO_ECOL6      LAGKNILITGSAQGIGFLLATGLGKYGAQIIAVEKLHQEGIQAVAAPFNVTHKHEIDAAVEHIEKDIGPI
FABG_ACTAC      -----ILITGSSRGIGKAIALRLAQAGFDIVVHCRSRIXXXXARVLQFDVSCRSEAADKLTADVEAHGAY
CBR2_MOUSE      ------LVTGAGKGIGRDTVKALHASGAKVVAVTRTNSDECPGIEPVCDLGDWDATEKALGGIGPV----
BAIA1_EUBSP     ---------------------------------------------FAPDLTSRDAVMAAVGTVAQKYGRL
PECR_HUMAN      LQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRSAADELQANLIQCNIRNEEEVNNLVKSTLDTFGKI
DCXR_HUMAN      LAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADECPGIEPVCDLGDWEATERALGSVGPV----
DHG_BACSU       LKGKVVAITGAASGLGKAMAIRFGKEQAKVVNEVKEEVIKAGGEAVVVDVTKEEDVKNIVQTAIKEFGTL
BDH2_HUMAN      ----------------------------------------------------------------------
DHR11_MOUSE     --DRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNGYPGTLYRCDLSNEEDILSMFSAVRSQHSGV
CBR4_XENLA      --SKVCAVFGGSRGIGKAVAKLLAQKDYKVLEVAQAAVTEIGAHLALCDVSKENEIQCTFKEIKNNLGNI
FABG_RICCN      --------------------------------------DNYTIEV--CNLADKEECRNLISKASKL----
HCDS_XANP2      ------------------------------------------------DVTDEAAITAAMAGAQRALGPL
FABL_BACSU      --NKCALVTGSSRGVGKAAAIRLAENGYNVINYARSKIEKL-GVKVLVVKANVGQPAKIFQQIDETFGRL
SORD_KLEPN      LKDNVIIVTGGASGIGLAIVDELLSQGAHVQGDRHHNGDNY--HFWSTDISSATEVQQTIDAIIQRWSRI
PECR_RAT        -----------------------------------------------CNIRKEEEVNNLVKSTLAKYGKI
PECR_MOUSE      -----------------------------------------------CNIRKEEEVSNLVKSTLAKYGKI
CBR2_PIG        ------LVTGAGKGIGRDTVKALHVSGARVVAVTRTNGDECPGIEPVCDLGDWEATERALGGVGPV----
DHRS4_RAT       LANKVALVTASTDGIGLAIARRLAEDGAHVVISSRKQVATLQGEGLVCHVGKAEDREKLVNMALKLHQGI
DECR_HUMAN      -----------------------------------------------CDVRDPDMVQNTVSELIKVAGHP
YGCW_ECOLI      ----------------------------------------------------------------ERFGTV
HCDR_XANP2      --SRVAIVTGASSGNGLAIATRFLARGDRVAALARTHWHAYADKVLRADVADEGDVNAAIAATMEQFGAI
DHR11_BOVIN     --DRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNGYPGTLYRCDLSNEEDILSMFSAVRSQHSGV
BAIA2_EUBSP     ---------------------------------------------FAPDLTSRDAVMAAVGQVAQKYGRL
DHB8_HUMAN      LRSALALVTGAGSGIGRAVSVRLAGEGATVAACAQETVRLLGGPAFQADVS-EARAARCLLE--QVQACP
CBR4_MOUSE      --DKVCAVFGGSRGIGRAVAQLMAQKGYRLAIVSRNLAKVTAGELFRCDVAKEQDVQSTFQEMEKHLGPV
CBR4_BOVIN      --DKVCAVFGGSRGIGRAVARLMAQRGYRLAIVARNXXXXXXXXXXXCDVAKEHDVQNTFEEIEKNLGRV
FABG_ARATH      -------------------------------------------------------------------GTI
BUTA_STAEQ      --SKTAIITGSAGGLGKGIAERLANDGFNIVXXXXXXXXGYQAVAFKSDVSKKEQEELVQFAVTEF-GQL
DHRS4_MOUSE     LSNKVALVTASTDGIGFAIARRLAEDGAHVVVSSRKQVDRAVATLIVCHVGKAEDREKLITTALKRHRGI
GRDH2_ARATH     ------------------------------------------------DLGFEENCKRVVEEVVNSFGRI
DHB8_CANFA      -------VTGAGSGIGRAVSVRLAKEGWLLGGQGSEKVA--PGGAHTAFQADVSEAGAVRRLLEQVQACP
Y3106_PSEAE     -NGKVALVTGAARGIGLGISAWLIAEGWQVVLADNARVAEALGEFVAMDVAQEGQVAMSVAEVLGQFGRL
GRDH1_ARATH     ------------------------------------------------DLGFDENCKRVVDEVVNAFGRI
DHRS4_PIG       LENKVALVTASTDGIGLAIARRLAQDGAHVVVSSRKQVATLQGEGLVCHVGKAEDRERLVAMAVNLHGGV
BDHA_RALEH      -------------------------------------------------------------------GGA
Y4LA_RHISN      -------------------------------------------------------------------GGV
Y2146_BRAJA     -------------------------------------------------------------------GGV
GS39_BACSU      LKGKVALITGGDSGIGRAVSVAYAKEGADIAIVYKDEHEDAEETLLIAGDVGEEEFCNEAVEVKELGGL-
DHGB_BACME      LEGKVVVITGSSTGLGKSMAIRFATEKAKVVSVLEEEIKKVGGEAIAVDVTVESDVINLVQSAIKEFGKL
MTDH_AGABI      --NKTIIVTGGNRGIGLAFTRXXXXXXXXXXXIYRSAKDGVKTKAYQCDVSNTDIVTKTIQQIDADLGAI
BUTA_STAES      ----------------------------------------------------------------------
YAY8_SCHPO      -------------------------------------------------------------------GWI
VER1_ASPPA      ------------------------------------------------DVGDPEATAKLMAETVRHFGYL
T4HR_MAGGR      LEGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTESAEGSDAACVKANVEDIVRMFEEAVKIFGKL
HSD_STREX       ------------------------------------------------DVTIEEDWQRVVAYAREEFGSV
BEND_ACIAD      --HKVVIVTGAAQGIGRGVALRIAQEGGCLILADRSDLIQAVGALAIAVETDLETYAGAELVVSHAYGRI
Y019_THEMA      ------------------------------------------------DVADENSVKNMVRKTVEIYGGV
GRDH_DAUCA      ------------------------------------------------DLGFDDNCKKVVDQVVNAFGSI
FABG6_BRANA     ----------------------------------------------------------------------
DHR11_CHICK     -TGRVALVTGASVGIGAAVARALVQHGMKVVGCARS-VDKYPGTLYKCDLSNEEEILSMFSAIKTLHQGV
PECR_CAVPO      -----------------------------------------------CNIRKEEEVNNLMKSTLALYGKI
VIBA_VIBCH      --NSKVLLVGSARGIGFSVLEHLLQAGAQVMAADCEWXXRYPDQLTLLDLAEPEAVREQVNQWAEQVAGF
RHLG_PSEAE      LAGRIALVTGGSRGIGQMIAQGLLEAGARVFICARAYGDC---QAIPADLSSEAGARRLAQALGELSARL
NOG4_RHIME      ----------------------------------------------------------------------
STCU_EMENI      ------------------------------------------------DVGDPDAVTKLMDQAVEHFGYL
DECR2_DANRE     LSDQVAFITGGGSGIGFRIAEVLMRHGCDTVIASRNLLTSTTGRRCLPIAMDVRQPETILAAVDETFGRV
ENTA_ECOLI      -SGKNVWVTGAGKGIGYATALAFVEAGAKVTGFDQAFTEQYPFATEXXXXXXXXXXXXXCQRLLAETERL
DHK1_STRVN      ----------------------------------------------VCDVADPAQIRAYVAAAVQRYGTV
CBR4_HUMAN      --DKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLXXXXXXXXFSCDVAKEHDVQNTFEEMEKHLGRV
ARDH_PICST      -----------------------------------------------CNIGDAEAVDATFSSINEHHGIA
CBR4_RAT        --DKVCAVFGGSRGIGKAVAQLMAQKGYRLAIVARNLAKATASELFRCNIAKEGDVHSTFEEMEKHLGPV
SPS19_YEAST     ------------------------------------------------DVRNFEQVENAVKKTVEKFGKI
DHGA_BACME      LKDKVVVITGGSTGLGRAMAVYYNNEEEALD--AKKEVEEAGGQAIIVDVTKEEDVVNLVQTAIKEFGTL
Y2478_STAAM     LTDKIAVVTGAGSGIGEAIATLLHEEGAKVVGRNKDKLQNVANQLAQTDVTNKEEVDELMKIAQQTFGGL
Y2266_STAAN     LTDKIAVVTGAGSGIGEAIATLLHEEGAKVVGRNKDKLQNVANQLAQTDVTNKEEVDELMKIAQQTFGGL
Y182_METEA      ----------------------------------------------------------------------
DHG3_BACME      LKDKVVVITGGSTGLGRAMAVYYNNEEEALD--AKKEVEEAGGQAIIVDVTKEEDVVNLVQTAIKEFGTL
DHG4_BACME      LKDKVVVITGGSTGLGRAMAVYYNNEEEALD--AKKEVEEAGGQAIIVDVTKEEDVVNLVQTAIKEFGTL
Y2778_STAA8     LTDKVAVVTGAGSGIGEAIATLLHEEGAKVVGRNKEKLQNVANQLSQTDVTNKEEVDELIKIAQQTFGGL
Y2488_STAAC     LTDKVAVVTGAGSGIGEAIATLLHEEGAKVVGRNKEKLQNVANQLSQTDVTNKEEVDELIKIAQQTFGGL
Y2422_STAA3     LTDKVAVVTGAGSGIGEAIATLLHEEGAKVVGRNKEKLQNVANQLSQTDVTNKEEVDELIKIAQQTFGGL
Y2403_STAAW     LTDKIAVVTGAGSGIGEAIATLLHEEGAKVVGRNKEKLQNVANQLSQTDVTNKEEVDELIKIAQQTFGGL
Y2370_STAAS     LTDKIAVVTGAGSGIGEAIATLLHEEGAKVVGRNKEKLQNVANQLSQTDVTNKEEVDELIKIAQQTFGGL
Y048_HAEIN      ----------------------------------------------------------------------
DHB14_HUMAN     ----------------------------------RALEQELPGAVFLCDVTQEDDVKTLVSETIRRFGRL
DHBA_BACSU      IEGKIAFITGAAQGIGEAVARTLASQGAHIAAVSSLKAEGRHAEAFPADVRDSAAIDEITARIEREMGPI
TRNH1_ARATH     ---KTVLVTGGTKGIGHAIVEEFAGFGAVIHTCARNEYEGFQVTGSVCDASLRPEREKLMQTVSSMFGGK
DHSO_RHOSH      ------------------------------------------------DVTDQASIDRCVAELLDRWGSI
BUDC_KLETE      ---KVALVTGAGQGIGKAIALRLVKDGFAVATAVAAEINQAGGRAVAIDVSRRDQVFAAVEQARKALGGF
ARDH_CANTR      -----------------------------------------------CNIGDAEAVELTFKAINEHHGVA
Y2567_STAAR     LTDKIAVVTGAGSGIGEAIATLLHEEGAKVVGRNKDKLQNVANQLAQTDVTKKEEVDELIKMAQQTFGGL
ARDH_CANAL      -----------------------------------------------CNIGDAEAVDLTFKAINEHHGIS
SDR1_PICAB      LGGRVAIVTGASRGIGREIALNMAEKGAKVVNKSPSSGDGVRAIVCKADVAEPSQVAQLFDTAEHAFGPL
RDH8_HUMAN      ---RTVLISGCSSGIGLELAVQLAHKRYQVVATMRDLXXXXXXXXXXXDVCSDESVAQCL---SCIQGEV
MTDH_UROFA      LKDQCIIVTGGNRGIGLAMSQACADAGAAVGIIYNSAKDGVKCKAYQCDVGQQHKVKEVFKKINEELGPV
DHB8_RAT        --------------------------------------------------------------LEQVQACP
DHB8_PIG        -----------------------------------------PMAAFQADVSEAETARRLLEQVQAFFRPP
DECR2_PONAB     ----------------------------------------------------------------------
DECR2_HUMAN     ----------------------------------------------------------------------
UXUB_BACSU      ----------------------------------------------------------------------
DHMA_FLAS1      ----------------------------------------------------------------------
NAHB_PSEU8      -NQQVVSITGAGSGIGLELVRSFKSAGYYVSALVR----NEEQEALLCDVRDHATNEKLIKQTIDRFGHL
NAHB_PSEPU      -NQQVVSITGAGSGIGLELVRSFKSAGYYVSALVR----NEEQEALLCDVRDHATNEKLIKQTIDRFGHL
DHB8_MOUSE      ----------------------------------------------------------------------
XYLL_PSEPU      ---KVAVITGAAQGIGRRVAERMAAEGGRLLLVDRSLIHELADELLTADLEQFAECQRVMAAALERFGRL
SOU1_SCHPO      ---------------------------------------------YSCPIENRSAVIETTNQVEELGGRL
Y2049_STAEQ     VKEKVAVVTGASSGIGEAIAKKLSQQGASIVLVGRNEQRNTPAKVVSADVTVKSNIDDMLKAVIDHFGHI
Y2036_STAES     VKEKVAVVTGASSGIGEAIAKKLSQQGASIVLVGRNEQRNTPAKVVSADVTVKSNIDDMLKAVIDHFGHI
YXEK_CAEEL      -------------------------------------------EPFQMDVKDPAKVAKAFDAVEKKLGTP
DHB8_CALJA      ----------------------------------------------------------------------
YWFH_BACSU      MSKRTAFVMGASQGIGKAIALKLADQHFSLVINSRN-LDNIESVVLAGDMSDQHTRAGIFQKIESQCGRL
YQJQ_BACSU      IAGKRIWITGASGGLGERIAYLCAAEGAHVIEIKRKITEEWSGEIFPLDVGRLEDIARVRDQIGSI----
Y0419_STAS1     LQDKVAVVTGASSGIGASIAETLANQGVKVVEVAKRIQDNKQAETSIVDXXXXXXXXXXXXXXXXXFGQI
YVX3_CAEEL      -------------------------------------------EPFRMDIKDPGMVSDTFDKIDKKFGKP
YVAG_BACSU      LQGKTALVTGSTSGIGKAIASSLAEEGAAVIINGRQTIDELKAEAVLYPAAFDLGTEEGCNELFQAYPEV
Y4MP_RHISN      -----------------------------------------------CDVADRASCTSASDEVLSAFGVA
LINX_PSEPA      LAGKVALITGGASGLGAAQAKRFAEEGAKVVGVVAEIRAAGGDALFILDVTDXXXXXXXXXXXVDGFGGL
FABG_SCHPO      ---RKVLITGGSSGLGKRIAQIWSQKGHQCHIVGRSVAKGQQHTLTIADVQSDMKNLKSIFESVEI----
DECR2_RAT       ----------------------------------------------------------------------
YBBO_ECOLI      -----VLITGCSSGIGLESALELKRQGFHVLAGCRKPDDGFTGVLIDLDSPESDRAADEVIALTD--NCL
YBBO_ECOL6      -----VLITGCSSGIGLESALELKRQGFHVLAGCRKPDDGFTGVLIDLDSPESDRAADEVIALTD--NCL
HSD_MYCTU       ----------------------------------------------------------------------
HSD_MYCBO       ----------------------------------------------------------------------
YWC4_CAEEL      -------------------------------------------EPFQMDIKDPGMVSDAFDKIDMKFGVP
HCD2_RAT        ----VAVITGGASGLGLSTAKRLVGQGATAVLLD---VPNSEGEIFAANVTSEKEVQAALTLAKEKFGRI
VDLC_HELPY      -SQKVAIITGASSGIGLECALMLLDQGYKVYALSRHATLCVALNHALCDVSDSNALKEVFSNISAKEKYC
DECR2_MOUSE     ----------------------------------------------------------------------
YGHA_ECOLI      ------------------------------------------------DLSDEKFARSLVHEAHKALGGL
YGHA_ECO57      ------------------------------------------------DLSDEKFARSLVHEAHKALGGL
YUXG_BACSU      ------------------------------------------------DVTKEEDVQSAFERAALAYGGI
YJGI_ECOLI      -TGKTVLILGGSRGIGAAIVRRFVTDGANVYAGSKDAAKRLAQETGATAVFTDSADRDAVIDVVRKSGAL
FABI_NEIMB      --------------------------------------------VFRCDVASDDEINQVFADLGKHWDGL
DRS7C_HUMAN     VQNKVVVITDAISGLGKECALVLCGKNWELISVADPSKQTFTPKLVLLDLSDISCVPDVAKEVLDCYGCV
BZRD_BACSU      ----LYIITGASKGLGQAIALQALEKGHEVHALSRTKTDVSHKKLHQIDLINEQQFETLLSSIDSDRYSG
THR1_GLOLA      LMGKVALVTGAGRGIGREMAMELGRRGAKVIAIKKSGSD---AASIKANVSDVDQIVKMFGEAKQIWGRL
DRS7C_MOUSE     VQNKVVVITDAISGLGKECALVLCGKNWE--GLESLYATTFTPKLVLLDLSDISCVQDVAKEVLDCYGCV
DHRS4_PONAB     LANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQVATLQGEGLVCHVGKAEDRERLVATAVKLHGGI
YR419_MIMIV     ----------------------------------------------------------------------
SOU1_CANAL      ---------------------------------------------YKCNVTDPNDVSKVINEIEKDFGTI
PTMA_CAMCO      LENKIIFVAGACGRIGKALKKILQNKGIAILAILKTELENFKKELLSLDITSKESLNCAIDQAFEKYSKI
FABI_ANASP      --------------------------------------------LFLCNVQNDEQIQSTFDTIRDKWGRL
DHRS4_HUMAN     LANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQVATLQGEGLVCHVGKAEDRERLVATAVKLHGGI
DHG2_BACSU      LTGKTAIVTGSSKGIGKAIAERFGKEKMNVVVNYHSDPSGADETLEIADVSKEEGIQALLDTALEHFGTL
FOX2_NEUCR      ----------------------------------------------------------------------
FOX2_CANTR      -------------------------------------------------------------------GTV
YM71_YEAST      LAKKTVLITGASAGIGKATALYLSNGDMKLILAARRXXQEFPNHVAQLDITQAEKIKPFIENLPQEFKDI
SRLD_ECOLI      --NQVAVVIGGGQTLGAFLCHGLAAEGYRVVDIQSDKAANVAQEIFGADATSEQSVLALSRGVDEIFGRV
HCD2_DROME      IKNAVSLVTGGASGLGRATAERLAKQGASVIDLPSSKGNEVAKELVPVDVTSEKDVSAALQTAKDKFGRL
FOX2_YEAST      --DRVVVITGAGGGLGKVYALAYASRGAKVVKAADLVVDEIKGGIAVANYDSVNENGEKIIEIKEF-GRV
YTKK_BACSU      ----------------------------------------------------------------------
YHXD_BACSU      ----------------------------------------------------------------------
VDLC_HELPJ      ----MAVITGASSGIGLECVLMLLNQGYKVYALSRHALNHALCECVDIDVSDSNALKEVFLNISAKEDHC
DHG1_BACME      LEGKVVVITGSSTGLGKAMAIRFATEKAKVVVNYRSKIKKVGGEAIAVDVTVESDVINLVQSSIKEFGKL
DHRS7_ANOGA     LNGKVVLITGASSGLGLAHSFFL--AGCKVVLAARRKDEL---ERVRKDLLELHATVPTVQSVLEIHGAI
DHG_BACME       LEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEVGGEAIAVDVTVESDVINLVQSAIKEFGKL
DHB1_RAT        MDSTVVLITGCSSGIGLHLAVRLRSQSFKVYATLRDLKSQGPLEILELDVRDSESVAAARACVTE--GRV
PTR1_LEITA      ---------------------------------------------------------SALVDACYMHGRC
KDSR_BOVIN      -----VVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAQVVLCDVSQDSQVENVIKQAQEKLGPV
DHB1_MOUSE      MDPTVVLITGCSSGIGMHLAVRLRSQSFKVYATLRDLKAQGPGSLEILELDVRDSKSVAAAQACVTEGRV
MOAE_KLEAE      ----------------------------------------------------------------------
HETN_ANASP      ------------------------------------------------DVRNTSQLSALVQQAQDIVGPI
DHB14_BOVIN     -----------------------------------------PGTVFLCDVTREEDVRTLVSETIRRFGRL
KDSR_HUMAN      -----VVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAQVVLCDVSQDNQVENVIKQAQEKLGPV
HCD2_HUMAN      ------------------------------------------------DVTSEKDVQTALALAKGKFGRV
DHK2_STRVN      ----VALVTGSSSGIGQTVAQRLAAEGYRVVNSARSVEDGLPDALYVRADVSEEADARRLVDTAEHYGRL
PGDH_CAVPO      VNGKVALVTGAAQGIGRAFAEGLLHKGAKVVKCKAALDEEFEPQLFICDVADQEQLRDTFTKVVDYFGRL
HCD2_MOUSE      ------------------------------------------------NVTSEKEIQAALTLAKEKFGRI
RIDH_KLEAE      LSGKVAAITGAASGIGLECARTLLGAGAKVVLIDREKLNKLVAELLQVDLMQADQVDNLLQGILQLTGRL
FABI_BACSU      -----------------------------------------------CDVTNDAEIETCFASIKEQVGVI
DRS7C_BOVIN     VQNKVVVITDAISGLGKECARVFHTGGARLVLCGKNWSKTFTPKLVLLDLSDISCVQDVAKEVLDCYGCV
YQC8_SCHPO      ------VVFGAAKGIGFSIATAFAQAGGNVI---ITYLTTDPTETLKIDISRSDTVEAGVEEIQKIFKEI
DHRS2_HUMAN     LANRVAVVTGSTSGIGFAIARRLARDGAHVVISSRKQVDRAMAKLIVCHVGKAEDREQLVAKALEHCGGV
SDH_RHIRD       -----ILITGATSGFGQATAQRFVKEGWKVIGTGRERLEALSAELVAFDITDEEATKKALAGLPDGFRDI
SDH_AGRT5       -----ILITGATSGFGQATARRFVKEGWKVIGTGXXXXXXXXGQAFAFDITDEDATEKALAALPDGFRDI
DHB4_HUMAN      ----------------------------------------------------------------------
KDSR_MOUSE      -----VVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAQVVLCDVSQDNQVENVIKQAQEKLGPV
DHRS7_DROME     LPGKVVLITGASSGLGESLAHVFYRAGCRVILAARRTQEAYPPTVLPLDLAELNSIPEFVTRVLAVYNQV
BZRD_BACCE      ---RYVIITGTSQGLGEAIATQLLEESTTVISISRQYNSNIFHSLDLQDVHNLETNFKEIISIKEDNVSS
HCD2_BOVIN      ------------------------------------------------DVTSEKDVQAALTLAREKFGRV
DRS7C_XENTR     LKNKVVVITDAISGLGKECSRVFHSAGWELISVADPSV-TFTPKLVLLDISDINNMEAMGKEIQDCYGCV
YB45_SCHPO      -AEKVILLTGSSKGIGLATAEALQKKA-KVIAVSRSLIQNPDSFVHVKGDVTEVGKASIETAIKKF-GKL
Y0585_STAHJ     ------------------------------------------------DVTNQVEVDALVAKVIDVFGHV
RDH8_BOVIN      ---RTVLISGCSSGIGLELAVQLAHQRYQVVATMRDLLETAAGEALQLDVCSDESVAQCL---NCIQGGE
DRS7B_MOUSE     LRNAVVVVTGATSGLGRECAKVFHAAGAKLVLCGRNVLEELSRELVTFDLADPGTIAAAAAEILQCFGYV
ACR1_ACIAD      VKGKVALITGASSGIGLTIAKRIAAAGAHVLLVARTQIEQQGGQIFPCDLTDMNAIDQLSQQIMASVDHV
PGDH_MOUSE      VNGKVALVTGAAQGIGKAFAEALLLHGAKVVKCKAALDEQFEPQKTLCDVADQKQLRDTFRKVVDHFGRL
Y4EL_RHISN      ----------------------------------------------------------------------
DHB4_RAT        ----------------------------------------------------------------------
BPHB_PSEPU      LTGEVVLITGGASGLGRALVAVLDKSAERLAQLETDHGDNVLGVTGVRSLEDQKQAASRCVAK---FGKI
ACR1_ACIBI      VKGKVALITGASSGIGLTIAKRIAAAGAHVLLVARTQIEQQGGQIFPCDLTDMNAIDQLSQQIMASVDHV
Y432_LISMO      IKNKVIIITGASSGIGKATALLLAEKGAKLVLAARQTIKANSGEAIFADVTKREDNKKLVELAIERYGKV
DHB4_MOUSE      ----------------------------------------------------------------------
FABI_BUCAP      --------------------------------------------IFFCDVSHDENIKELFFNIKKVWNNF
DRS7B_XENTR     LQDAVVVITGATSGLGRECAKVFYAAGTRLVLCGRSELKNLVQELVIFDLSDVEAVNSAANEILHLTGRV
DHB1_PANTR      MARTVVLITGCSSGIGLHLAVRLASQSFKVYATLRDLKTQGPGSLLQLDVRDSKSVAAARERVTE--GRV
PTR1_LEIMA      ----------------------------------------------------------------------
PGDH_MACFA      -----------------------------------------------CDVADQQQLRDTFRKVVDHFGRL
PGDH_HUMAN      -----------------------------------------------CDVADQQQLRDTFRKVVDHFGRL
FABI_HAEIN      ----------------------------------------------------------------------
TS2_MAIZE       ----------------------------------------------------------------------
LIMC_RHOER      VEGQVALITGAARGQGRSHAIKLAEEGADVILVTAKDVENLGRKAIVADVRDLESLTAEVDRAVSTLGRL
FABI_HELPJ      ------------------------------------------------DVSKEEHFKSLYNNIKQDLGSL
DLTE_BACSU      MTNNTVLITGGSAGIGLELAKRLLELGNEVIICGRSEARLAEAKQQLCDVADRSQREALYEWALKEYPNL
DHB1_HUMAN      MARTVVLITGCSSGIGLHLAVRLASQSFKVYATLRDLKTQGPGSLLQLDVRDSKSVAAARERVTE--GRV
Y452_LISIN      IKNKVIIITGASSGIGEATAILLAEKGAKLVLAARQTIKASSGEAIFADVTKREDNKKLVELAIERYGKV
FABI_PSEAE      -----------------------------------------PELCFPCDVADDSQIEAVFAALGKHWDGL
YAEB_SCHPO      -AEKFVLITGCSEGIGNALALKFHQEGFQVLATARQVMDNLTKQTLKLDVTDEDSVREVEQEVRKFNGSL
PGDH_BOVIN      -----------------------------------------------CDVADQEQLRDTFRKVVDHFGKL
FOLM_KLEP7      ---RPILITGAGRRIGLALAHHFLQQRQPVIVSYRTAIDGLREAGALCLQADFSSDDGILTFAEAVKSHT
MFEA_DICDI      -------------------------------------------------------------------GGV
FABI_SHIFL      LSGKRILVTGVASKLSIAAELAFTYQNDKLKGRVEEFAAQLGSDIVLCDVAEDASIDTMFAELGKVWPKF
FABI_ECOLI      LSGKRILVTGVASKLSIAAELAFTYQNDKLKGRVEEFAAQLGSDIVLCDVAEDASIDTMFAELGKVWPKF
FABI_ECO57      LSGKRILVTGVASKLSIAAELAFTYQNDKLKGRVEEFAAQLGSDIVLCDVAEDASIDTMFAELGKVWPKF
DHB2_HUMAN      VDQKAVLVTGGDCGLGHALCKYLDELGFTVF--AGVLNENGPGAEELCSLSVLQMDITKPVQIKDAYSKV
3BHD_COMTE      ------------------------------------------------DVSSEADWTLVMAAVQRRLGTL
YUSR_BACSU      ----------------------------------------------------------------------
DHRS7_HUMAN     LTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHDILVLPLDLTDTGSHEAATKAVLQE---FGRI
DCXR_TRIRE      ----------------------------------------------------------------------
BPHB_BURXL      LKGEAVLITGGASGLGRALVDRFVAEGAKVAVLDKSHGDNVLGIVGVRSLEDQKQAASRCVAR---FGKI
MTDH_CLAHE      ---------------------------------------------YKCQVDSYESCEKLVKDVVADFGQI
INHA_MYCTU      --------------------------GFDRLRLIQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
INHA_MYCBO      --------------------------GFDRLRLIQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
FABI_SYNY3      ------------------------------------------------DVQDDAQVDALFHSVKEKWGKL
FABI_SALTY      LSGKRILVTGVASKLSIAAELAFTYQNDKLKGRVEEFAAQLGSSIVLCDVAEDASIDAMFAELGNVWPKF
DHRS7_MOUSE     LTDMVVWVTGASSGIGEELAFQLSKLGVSLVLSARKEKDILVLPLDLTDTSSHEAATKAVLQE---FGKI
DHB12_XENTR     ------VVTGATDGIGKAYAEELAKRGMNIVLISRSKLEEVAKQIKEKFKVETKIIAADFGKPTEIYGRI
DHB12_ANAPL     ------VVTGATDGIGKAYAKELAKRGMKVALISRSKLDQVAGEI------TEQYGVETKVIVADFGERE
DH12A_DANRE     ------VVTGATDGIGKSYAEELARRGFSMMLISRSQLDDVAKSL---ESTYKVETKTIAVDFSQIDVYP
YUSZ_BACSU      MNKKIAIVTGASSGFGLLAAVKLA-RSFFVIATSRAAAHNVSDSIHITALVTDEQSIVSFGKAVSAYAPI
RDH10_XENTR     ---------------------------------------NFQVYTYTCDVGKRESVYSTAERVRREVGDV
BPHB_RHOGO      LQDEVVLVTGGCAGLGRAIVDRFVCEGARVAVLDRSVLRAAHGDAVVADVRYLDSHKETVAKCVETFGKL
EPHD_MYCTU      ----LVSVTGAGSGIGRETALAFAREGAEIVDIDEATVKDTAAEIYVLDVSDAEAVEAFAERVSAEHGVP
EPHD_MYCBO      ----LVSVTGAGSGIGRETALAFAREGAEIVDIDEATVKDTAAEIYVLDVSDAEAVEAFAERVSAEHGVP
DRS7B_PONAB     LRNAVVVITGATSGLGKECAKVFYAAGAKLVLCGRNKVQTHKPYLVTFDLTDSGAIVAAAAEILQCFGYV
DRS7B_HUMAN     LRNAVVVITGATSGLGKECAKVFYAAGAKLVLCGRNKVQTHKPYLVTFDLTDSGAIVAAAAEILQCFGYV
FABI_AQUAE      -----------------------------------------------CDVSLDEDIKNLKKFLEENWGSL
DHB2_RAT        VDQKAVLVTGADSGFGHALAKHLDKLGFTVF--AGVLDKEGPGAEELRKNCSERLSVLQMDQIKDVHSIQ
YL426_YEAST     --NGIVLITGGSKGLGRAIVSQLSNLTILNVDICPSSVRNTRVKDLICDLSDDEEVAALLNLLNEIR---
YD114_YEAST     --NATALITGGSSGLGFELAKELSRRINKVIV---ADIQSFPNNIFYCDITSLDEIKNLKKAIERDHGXX
Y4EK_RHISN      ----VALVTGASSGIGKAIALELASAGLRVLALGRAALDE------LHSTAGIVPVVFDLSDVSEVYGKI
Y1627_STAS1     VKDKVVVITGASSGIGEETVNLLSENGAKLVLGARRLVGHDSVSIKKTDVTKPDEVNALIETAYNDFGRI
MKAR_ASPTN      ------VVTGASDGLGKEFALQLARAGYNIVLVSRSKLDTLSDELLAMDFARNQD--SDYQKLKELIGDL
STDH2_CAEEL     ------VVTGATDGIGKSYSFELARRGFNVYIVSRTQLEKQPDRFATYDFTNPSVTEKLLSKLNEVS--V
DS7CA_DANRE     --NKVVVITDAVSGMGSECARLFHAGGARLVLCGPSWSQTFTPKLVLLDFSDMENISDVVSEICECYGCV
DRS7B_DANRE     IQDKVVVITGASSGLGKECARVFHAAGARLILCGRDQLQEVVEELVTFDLSNTSVVCSAAAEILKRHGHV
DHB12_MACFA     ------VVTGGTDGIGKSYAEELAKRGMKVVLISRSQLDQVSSEITLEDIYDKIKTGLAGLEIG------
RD10B_XENLA     ---------------------------------------------YTCDVGKRESVYSTAERVRREVGDV
YI78_SCHPO      ----------------------------------------------------------------------
DH12A_XENLA     ------VVTGATDGIGKAYAEELARRGMSIVLISRSKLDEAAKHIKETFKVETKIIAADFGKPTEIYERI
BPHB_PSEPS      -------------------------------------------------LEDQKQAASRCVAR---FGKI
RD10A_DANRE     ---------------------------------------------YVLDVGKRESVYSTAEKVRREVGEV
DHB12_HUMAN     ------VVTGSTDGIGKSYAEELAKHGMKVVLISRSKLDQVSSEIIAVDFASEDKTGLAGLEIG------
YQ53_SCHPO      -----VLITGSSKGLGYALVKVGLAQGYNVIACSRATIEHSXXXXXXXDVTDVKSVETAFKDAKRRFGNV
YDFG_ECOL6      ----IVLVTGATAGFGECITRRFIQQGHKVIATGRELKDELGDNLYIAQLAIEEMLASLPAEWSNI----
RD10A_XENLA     ---------------------------------------------YTCDVGKRESVYSTAERVRREVGDV
FABI_RICBR      ---------------------------------------NFVSEL---DVTNPESITNLFAEVKEKWGTF
YDFG_SHIFL      ----IVLVTGATAGFGECITRRFIQQGHKVIATGRELTDELGDNLYIAQLAIEEMLASLPAEWSNI----
SOU2_CANAL      ---------------------------------------------YKCNVTDFQDVEKVVKQIESDFGTI
DHB2_MOUSE      ----------------------------------------------------------------------
DHB12_MOUSE     ------VVTGGTDGIGKAYAEELAKRGMKIVLISRSQVSNNIKEKFLDDIYDKIKTGLSGLEIG------
BPHB_COMTE      ----------------------------------------------------------------------
ABA2_ARATH      -------------------------------------------------------------------GTL
RD10B_DANRE     ---------------------------------------------YMCDVSKRESVYLTAEKVRSEVGDI
MTDH_ALTAL      ----------------------------------------------------------------------
HSDL1_CHICK     ---RWAVVTGSTDGIGKAYAEELAKRGVNIIAVSRSISETYKVEFIVADFSKGREAYQAILKDREI----
FABI1_RHIME     ----------------------------------------------------------------------
DS7CB_DANRE     --NKVVLITDSLSTVGNECALILCGSNWEKLEALAEQLTSFPPKLVELDFSDMESVPEVISEILECFCCL
DRS7B_XENLA     ----VVVITGATSGLGCAKVFYAAGSHLVLCGRDEERLKDLVQELVIFDLSDVEAVNTAAKEILHLAGRV
DRS7B_BOVIN     --NAVVVITGATSGLGRECARVFHAAGARLVLCGRNXXXXXPGVTVTFDLADPGAIAGAASEILQCFGHV
DHB11_HUMAN     VTGEIVLITGAGHGIGRLTAYEINKHGLEETA-AKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDV
BPHB_PSES1      ----------------------------------------------------------------------
DHB11_PONAB     VTGEIVLITGAGHGIGRLTAYEINKHGLEETA-AKCKGLGAKVHTFVVDCSNREDIYSAAKKVKAEIGDV
DH12B_XENLA     ------VVTGATDGIGKAYAEELARRGMNIVLISRSPEKLEEAAIHIKQKFKVETKAADFGKPTEIYERI
YDFG_ECO57      ----IVLVTGATAGFGECITRRFIQQGHKVIATGRELKDELGDNLYIAQLAIEEMLASLPAEWCNI----
YDFG_ECOLI      ----IVLVTGATAGFGECITRRFIQQGHKVIATGRELKDELGDNLYIAQLAIEEMLASLPAEWCNI----
STDH1_CAEEL     ------VVTGATDGIGKSYSFELAKRGFNVYIVSRSKLEHTKKEILTFDFTNPSVSEKLLSKLNEVS--I
FABI_RICFE      ---------------------------------------NFVSEL---DVTNPKSISNLFDDIKEKWGSF
DHI2_MOUSE      VATRAVLITGCDTGFGKETAKKLDAMGFTVLATVLDL--NSPGALELRDLCSKAEDISRVLEITKAHTAS
DHB13_HUMAN     VAGEIVLITGAGHGIGRQTTYFAKRQSILVLGVEETAAEGVTAHAYVVDCSNREEIYRSLNQVKKEVGDV
DR4L2_HUMAN     LTNKVALVTASTDGIGFAIARRLAQDRAHVVVSSRKQVATLQGEGLVCHVGKAEDRERLVAMAVKLHGGI
DHB12_RAT       ------VVTGGTDGIGKSYAEELAKRGMKIVLISRSQVSNNIKEKFLDDIYDKIKTGLSGLEIG------
YCP8_SCHPO      -TNKIYFIAGGNRGIGLSLVKELSNRGTVVFASARK-----PGHIIKLDVSSLESANEAAQEVTKVVDAV
YBPE_SCHPO      ----LIVITGGSGILGHAIIQEALDRGFSVASLPASFLQNSKFSALKCNITKDKDVEGCVHSLKKMNRTP
RDHE2_MOUSE     ---------------------------------------------YTCDCSRREEVYRVADQVKKEVGDV
RDH13_HUMAN     ---KTVIVTGANTGIGKQTALELARRGGNIILACRDMAKDIRGETLNLDLASLKSIREFAAKIIEEEERV
FABI_BRANA      ----------------------------------------------------------------------
DRS7B_RAT       LRNAVVVVTGATSGLGKECARVFHAAGAKVVLCGRNVLEEFTREL-ADSSSSQGQTHQPCVXXXQCFGYV
DHRS1_MOUSE     MKGQVCVVTGASRGIGRGIALQLCKAGATVY-ITGRHLDTLRATAVVCDSSQESEVKSLFEQVDEQKGRL
RDH10_RAT       ---------------------------------------------YTCDVGKRENVYLTAERVRKEVGEV
RDH10_MOUSE     ---------------------------------------------YTCDVGKRENVYLTAERVRKEVGEV
RDH10_HUMAN     ---------------------------------------------YTCDVGKRENVYLTAERVRKEVGEV
RDH10_BOVIN     ---------------------------------------------YTCDVGKRENVYLTAERVRKEVGEV
INHA_MYCS2      -----------------------------------------PAPLLELDVQNEEHLSTLADRITAEIGEG
FABI_RICPR      ---------------------------------------NFISEL---DVTNQKSISNLFNDIKEKWNSF
FABI_HELPY      ------------------------------------------------DVSKEEHFKSLYNSVKKDLGSL
FABI2_RHIME     ----------------------------------------------------------------------
Y5909_MYXXD     ------------------------------------------------DVTKADATLERIRALDAEAGGL
FABG_YEAST      ---------------------------------------------------------------NERRYYV
DHB13_MOUSE     VTGQTVLITGAGHGIGRLTAYEFAKQKSRLVDINKRGVEETADKVFVVDCSNRAEIYNSVDQVKREVGDV
DHB11_RAT       VAGEIVLITGAGHGIGRLTAYEFAKLNTKLVDINKNGIEETAAKCFVVDCSQREEIYSAVRKVKEEVGDV
DHB11_MOUSE     VAGEIVLITGAGHGIGRLTAYEFAKLNTKLVDINKNGIEETAAKCFVVDCSQREEIYSAAKKVKEEVGDV
YIV6_YEAST      ---KVILITGASRGIGLVKTVIEEDDECIVYGVARSLQREYGADKFVLDITDRSRMEALVEEIRQKHGKL
YCP6_SCHPO      -TNKIYFIAGGNRGIGLSLVKELSNEGTVVFASARKSKSHSNVHIIKLDISSLESANEAAQEVAKAVGKV
MKAR_NEOFI      ------VVTGASDGLGKEFSLQLARAGFNIVLVSRSKLTTLAEELAMDFAANDDADYEELKAI--VNGLD
DHRS1_HUMAN     MNGQVCVVTGASRGIGRGIALYITGRHLDTLRVVAQEAQSLGGQCVVCDSSQESEVRSLFEQVDEQQGRL
STDH3_CAEEL     ------VITGGTDGIGKSFSFELAKRGFNIYIVSRTQYSNVEVRFATFDFTNPSISKKLLSQLNEVS--I
S16C6_BOVIN     VTGEIVLITGAASGLGRLLAIKFASLGWDIMETCRIIKEERDAKVFACDCSNRQDVYRVADQVKKEVGNV
MKAR_AJECN      ------LVTGASDGIGKEYSLQLARAGYNILLVSRSKSPTVQTKVFAMDFDGDYENLKLLIQDLDI----
LIGD_PSEPA      ------------------------------------------------DIMDREAYARAADEVEAVFGAP
DHI2_RAT        VATRAVLITGCDTGFGKETAKKLDAMGFTVLATVLDL--NGPGALELMDLTKPEDI-SRVLEITKAHTAS
DHB13_RAT       VAGQTVLITGAGHGIGRLTAYEFAKQKSRLVDISKHGVEETAAKVFVVDCSNRAEIYKSVDQVKKEVGDI
DHB11_MACFA     VAGEIVLITGAGHGIGRLTAYEFAKLKSKLVDINKHGLEETAAKCFVVDCSNREDIYSSAKKVKAEIGDV
YCIK_ECOLI      LNDRIILVTGASDGIGREAAMTYARYGATVILLGRSHINEETGDLLTCTSENCQQLAQR-IAVN--YPRL
LE767_CAEEL     ------VVTGATDGIGKAYAFELARRGFNVLLVSRSKLDETKKEILEKYSSIEVRTAALLATLNQVE--I
DHRS3_BOVIN     LSRENVLITGGGRGIGRQLAREFAERGARKIGRTEKCLKETTEEIFICDVGNREEVYQTAKAVREKVGDI
Y1570_MYCBO     --------------------------------------------VYPCDLSDMDAIAVMADQVLGDLGGV
Y1543_MYCTU     --------------------------------------------VYPCDLSDMDAIAVMADQVLGDLGGV
MOMAS_ORYSJ     ---KVAVITGGASGIGACTARLFVKHGARVV--VADIQDELGASLVACDVTNEGXXXXXXXXXXXRFGKL
MKAR_PICST      ------VITGASDGIGKEYAFQLASKGFNVVLVSRTQLETLASEIYKVETKVVAFDASTDAEDNAISGLP
FOLM_CITK8      ----------------------------------------------------------------------
FABI_RICTY      ---------------------------------------NFISEL---DVTDQKSISNLFNDIKEKWNSF
FABI_RICCN      ----------------------------------------------------------------------
DHRS3_HUMAN     LSRENVLITGGGRGIGRQLAREFAERGARKIGRTEKCLKETTEEIFICDVGNREEVYQTAKAVREKVGDI
Y945_MYCTU      -----ILITGASSGLGAGMARSFAAQGRDLALCARDRLTELKAELSQLDVNDHERVPKVFAELSDEIGGI
DHRS9_MOUSE     ----------------------------------------------------------------------
AYR1_YEAST      ---KIAVVTGASGGIGYEVTKELARNGYLVYACARRLFGNDSIKPYKLDISKPEETFSGFLRANLPDGKL
S16C6_MOUSE     VSGEIVLITGAGSGLGRLLAIHFASHGATLVNMETCRLVKQKGDVYKCDCSSRIEVYRVADQVKEEVGDV
Y3820_MYCBO     ----------------------------------------------------------------------
Y3791_MYCTU     ----------------------------------------------------------------------
FABI_BUCAI      ----------------------------------------------------------------------
YI13_SCHPO      ----------------------------------------------------------------------
MKAR_ASPFU      ------VVTGASDGLGKEFSLQLARAGFNIVLVSRTASK-------LTTLA-EEITTKHSVQTKTVDGLD
MKAR_ASPFC      ------VVTGASDGLGKEFSLQLARAGFNIVLVSRTASK-------LTTLA-EEITTKHSVQTKTVDGLD
RDHE2_HUMAN     ---------------------------------------------YTCDCSQKEGVYRVADQVKKEVGDV
MKAR_ASPCL      ------VVTGASDGLGKEFALQLARAGFNIVLVSRSKLATLAEEILAMDFAANDDTLKTLVDGLDV----
DHRS3_MOUSE     LSRESVLITGGGRGIGRHLAREFAERGARKIGRTEKCLKETTEEIFICDVGNREEVYQMAKAVREKVGDI
TSC10_YEAST     -----------------------------------------------CDLSCYESVECLFNALRDLDLLP
PATL1_ARATH     ----------------------------------------------------------------------
HSDL2_XENLA     -----LFITGASRGIGKAIALKAARDGANIVVAAKSEIEAAGGKALPCDVRDENQISAAVEKAVDAFGGI
DECR2_ARATH     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DAIINNVGIAIPEPLGKISISALNDVYNLNVRSAVQVSQFFIEKMKLKEQCKIVNIASRAIFGVKNRTSY
FABG_VIBHA      DILVNNAGITRDNLLMRMKDDEWNDIINTNLTPIYRMSKAVLRGMMKKRAGRIINVGSVVTMGNAGQTNY
FABG_PSEAE      LIVVNNAGITRDNLLVRMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVAMGNAGQTNY
FABG_MYCS2      EVLVANAGISKDAFLMRMTEERFEEVINTNLTGAFRCAQRASRTMQRKRFGRIIFIGSSGMWGIGNQANY
FABG_THEMA      DVLVNNAGITRDALLVRMKEEDWDAVINVNLKGVFNVTQMVVPYMKQRXXXXXXXXXXXXXXXXPGQTNY
FABG_CUPLA      DILVNNAGITRDGLLMRMKKSQWQEVIDLNLTGVFLCTQXXXXXXXXXXXGRIINIASVVLVGNAGQANY
FABG_MYCAV      EVLVSNAGISKDAFLIRMTEERFTEVINANLTGAFRVTQRAARSMQKKRFGRIIYIGSSGMWGIGNQANY
FABG_BUCBP      DILINNAGIIRDKLLINMKTQDWNSVLNVNLNSIFYMSKSVIRNMIKNKQGKIITIGSVAHIGNCGQTNY
FABG_SHIFL      DILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVTMGNGGQANY
FABG_ECOLI      DILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVTMGNGGQANY
FABG_BUCAP      DILINNAGITSDNLLVYMSNKEWENVIKINLTSVFYMSKSVIRSMIKKRYGRIVTIGSVGYLGNRGQINY
FABG_HAEIN      DILVNNAGITRDNLLMRMKDEEWFDIMQTNLTSVYHLSKAMLRSMMKKRFGRIINIGSVVSTGNPGQTNY
FABG_MYCTU      EVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSSGSWGIGNQANY
FABG_MYCBO      EVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSSGSWGIGNQANY
FABG_RICPR      DILVCNAGITSDTLAIRMKDQDFDKVIDINLKANFILNREAIKKMIQKRYGRIINISSIVIAGNPGQANY
NODG_AZOBR      DILVNNAGITRDKFFAKMDKAQWDAVIATNLSSLFNVTQQVSPKMAERGWGRIINISSNGVKGQAGQTNY
FABG_VIBCH      DILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVTMXXXXXXXX
FABG_BACSU      DILVNNAGITRDNLIMRMKEDEWDDVININLKGVFNCTKAVTRQMMKQRSGRIINVSSIVVSGNPGQANY
FIXR_BRAJA      HALVNNAGVSPKTPTGDTSLTTSTDVFHLNLVAPILLAQGLFDELRAASG-SIVNVTSIAGSRVHPGSAY
FABG_CHLMU      DVVVNNAGITRDSLLMRMSEEEWSSVIDTNLGSIYNVCSAVIRPMIKARSGAIVNISSIVLRGSPGQTNY
FABG_CHLTR      DVIVNNAGITRDALLMRMSEEEWSSVINTNLGSIYNVCSAVIRPMIKARSGAIINISSIVLRGSPGQTNY
FABG_STAES      DVLVNNAGITKDNLLMRMKEQEWDDVIDTNLKGVFNCIQKVTPQMLRQRSGAIINLTSIVAMGNPGQANY
FABG_STAEQ      DVLVNNAGITKDNLLMRMKEQEWDDVIDTNLKGVFNCIQKVTPQMLRQRSGAIINLTSIVAMGNPGQANY
FABG_AQUAE      DILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVGFGNVGQVNY
YXJF_BACSU      DILVNNAGIQHVAPIEEFPTDTFEQLIKVMLTAPFIAMKHVFPIMKKQQFGRIINIASNGLVGFAGKSAY
FABG_BUCAI      DILINNAGIKEDNLLVNMKSTEWDDVIKTNLSSVFHLVKSVIRSMIKKRQGRIITIGSVIAYGNKGQVNY
BACC2_BACSU     DVLINNAGIEIVAPIHEMELSNWNKVLNVNLTGMFLMSKHALKYMLKSGKGNIINTCSGGVVAWPDIPAY
DCXR_BOVIN      DLLVNNAAVAFLQPFLEVTKEAYDMSFSVNLRAVIQVSQIVARGLIARAPGVIVNVSSQASQGLTNHSVY
LVR_LEIAQ       DGFFNNAGIEGKQPTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQGSGMVVNTASGGIRGIGNQSGY
FABG_SALTY      DILVNNAGITRDNLLMRMKDDEWNDIIETNLSSVFRLSKAVMRAMMKKRCGRIITIGSVVTMXXXXXXXX
FABG_SALTI      DILVNNAGITRDNLLMRMKDDEWNDIIETNLSSVFRLSKAVMRAMMKKRCGRIITIGSVVTMXXXXXXXX
FABG_RICTY      DILVCNAGITSDTLAIRMKDQDFDKVIDINLKANFILNREAIKKMIQKRYGRIINISSIVIAGNPGQANY
DHRS4_RABIT     DILVSNA--AVNPFFGKVTEEVWDKILDINVKAMALMTKAVVPEMEKRGGGSVVIVASIAAFNFSGLGPY
DCXR_MOUSE      DXXXXXXXXXXXQPFLEVTKEACDTSFNVNLRAVIQVSQIVAKGMIARGPGAIVNVSSQASQALTNHTVY
PHBB_RHIME      DILVNNAGITRDAMFHKMTPEQWGEVIGTNLTGVFNMTHPLWSGMRDRGFGRIVNISSNGQKGQMGQVNY
NODG_RHIS3      DILVNNAGITKDGLFVRMSDADWDTVLEVNLTAVFRLTRELTHPMMRRRHGRIINITSVVVTGNPGQTNY
DCXR_RAT        DLLVNNAAVATLQPFLEVTKEACDTSFNVNFRAVVQVSQIVARGMIARGPGAIVNVSSQASQALTNHTVY
BUDC_KLEPN      DVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEHGGKIINACSQAHVGNPELAVY
FABG_STAAW      DVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVAVGNPGQANY
FABG_STAAS      DVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVAVGNPGQANY
FABG_STAAR      DVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVAVGNPGQANY
FABG_STAAN      DVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVAVGNPGQANY
FABG_STAAM      DVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVAVGNPGQANY
FABG_STAAC      DVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVAVGNPGQANY
DCXR_CAEEL      --LVNNAGIATNHAIGQITQQSIDRTFAVNVRGPILIAQL-VARNFVDRQIKIVNISSQAIRPLDNHTVY
FABG_RICBR      DILVCNAGITKDTLAIRMKNEDFDQVIDINLKANFILNREAIKKMMTNRYGRIINITSIVVSGNPGQANY
DCXR_CAVPO      XXXXXXXXXXXXQPFLEVTKEACVTSFNVNLRAVIQVSQIVAKGMIARGPGAIVNVSSQASQALTNHTVY
BACC_BACSU      DVLINNAGIEIVAPIHEMELSDWNKVLQVNLTGMFLMSKHALKHMLAAGKGNIINTCSGGLVAWPDIPAY
PHAB_ACISR      DVLVNNAGITRDATFKKMSYEQWSQVIDTNLKTLFTVTQPVFNKMLEQKSGRIVNISSNGLKGQFGQANY
KDUD_DICD3      DILVNNAGIIRREDAIEFSEKNWDDVMNLNIKSVFFMSQTVARQIKQGHGGKIINIASMLSFGGIPVPSY
CMTB_PSEPU      QILVNCAGGGVIRPFLEHTPETLKATIDRNLWTALWCSRVFLPDMLARQYGRIINIGADSVRGLPDHAAY
CMTB_PSEP1      QILVNCAGGGVIRPFLEHTPETLKATIDRNLWTALWCSRVFLPDMLARQYGRIINIGADSVRGLPDHAAY
CBR4_DANRE      GFLVNAAGINRDALLLRSKSEDMLSVLHTNLLGSMLTCKAAVRNM-LSHGGAIVNIGS--VVGVKGNAGY
TRNH_DATST      NILINNAGTTIPKEATNFTAEDYSIIMGTNFEASYNLCQLAHPLLKASGNASIVNSSAAGVIAVPLSSIY
TRN2_HYONI      NILVNNAGIVIYKEAKDYTMEDYSHIMSINFEAAYHLSVLAHPFLKASERGNVVFISSSGASALPYEAVY
TRN2_DATST      NILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSSGALAVPYEAVY
DCXR_MESAU      DXXXXXXXXXXXQPFLEVTKEAFDMSFNVNLRAVIQVSQIVARGMIARAPGAIVNVSSQASQALANHSVY
BACC_BACAM      DVLINNAGIEIVAPIHEMELSDWNKVLNVNLTGMFLMSKHALKYMLKSGKGNIINTCSGGVVAWPDIPAY
Y325_THEMA      DILVNNAGIV---PYGNIEETSEEDTMAVNVKGPFLLSKYAVEQMKKQGGGVIVNVSSEALIGIPRRCVY
FABG1_SYNY3     DVLVNNAGITRDTLLLRMKLEDWQAVIDLNL-TGVFLCTKAVSKLMLKQKSRIINITSVAMMGNPGQANY
PHBB_ZOORA      DVLVNNAGITKDAMFHKMTPDQWNAVINTNLTGLFNMTHPVWSGMRDRSFGRIVNISSNGQKGQMGQANY
PHAB_PARDE      AVLVNNAGITRDAMFHKMTPQQWKEVIDTNLTGLFNMTHPVWSGMRDRKYGRIVNISSNGQKGQAGQANY
YOHF_ECOLI      DVLVNNAGAMTKAPFLDMAFDEWRKIFTVDVDGAFLCSQIAARQMKQGQGGRIINITSHEHTPLPDASAY
YMFI_BACSU      DAIVLNSGRSHFGLITDVDNATVQEMVQLHVASPYMLTRNLLPGMIRNKSGAIVAVSSIGETGASCEVLY
TRN1_DATST      NILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSY
FABG3_BRANA     DVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATXXXXXXXXXXXXXXASVVLIGNIGQANY
FABG1_BRANA     DVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATXXXXXXXXXXXXXXASVVLIGNIGQANY
DHG2_BACME      DVMINNAGVENPVPSHELSLENWNQVIDTNLTGAFEAIKYFVEN---DIKGNVINMSSHEMIPWPLFVHY
FABG2_BRANA     DVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATXXXXXXXXXXXXXXASVVLIGNIGQANY
CBR4_XENTR      DYLVNSAGIRRDALLLRTRSEDIRSLLSVNLVGTIQTCKLALRSMIQQQGGAIVNIGS--IVGHKGQSIY
FABG2_SYNY3     YGVVANAGITKDNFFPKLTPADWDAVLNVNLKGVAYSIKPFIEGMERKXXXXXXXXXXXXERGNVGQTNY
YVRD_BACSU      DILVNNLGFFEVKDFADVTDEEWNQYFEVNVMSAVRTSRHFLPKMLAKNSGRILNIASEA--GVKTMIPY
FABG_CHLPN      DILVNNAGITRDNLLMRMSEDDWQSVISTNLTSLYYTCSSVIRHMIKARSGSIINVASIAKIGSAGQTNY
PHBB_CHRVI      DILVNCAGITRDKTFKKMEQAHWEAVINVNLNSVFNVTRQVWDGMLERGFGRIINISSRGQFGQAN---Y
KDUD_BACSU      DILVNNAGIIHREKAEDFPEENWQHVLNVNLNSLFILTQLAGRHMLKRGHGKIINIASLLSFGGILVPAY
BDH2_MOUSE      DVLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMFLMIKAFLPKMLAQKSGNIINMSSVAIKGVENRCVY
LINC_PSEPA      DGSFNNA--AIPQPLAEVSLERFRQSMDINVTGTFLCMKYQILAMERGTKGSIVNTASAAVVGVPMHGEY
KDUD_ECOLI      DILVNNAGLIRREDALEFSEKDWDDVMNLNIKSVFFMSQAAAKHFIAQGNGKIINIASMLSFGGIRVPSY
GRDH_ORYSJ      DILVNNAAEQYERPITDITEDDLERVFRTNIFSYFFMSKHAVKRMRXXXXCSIINTSSNAYKGNKTLLDY
CPNA_COMTE      DALVNNAGILTLKPVQDTSNEEWDRIFEINVRSVFLGTRAVIEPMRKAHKGCIVNVSSYGLVGAPGAAAY
CPNA_COMS9      DALVNNAGILTLKPVQDTSNEEWDRIFEINVRSVFLGTRAVIEPMRKAHKGCIVNVSSYGLVGAPGAAAY
YJDA_BACSU      SILINNAAHSASDNYVSLDAKSLDEHYAVNMRSNFLLCVEFARRFKKSNLIRIINMTSGQDLGLPGELAY
Y4VI_RHISN      EVLVNNAGIG--PTMAATADTALEDFQRALAINLVGAYSVACETAKLKPGAAIVNVASLALLGNPKRSAY
BDHA_RHIME      DILVNNAGVQFVEKIEDFPVEQWDRIIAVNLSSSFHTIRGAIPPMKKKGWGRIINIASHGLVASPFKSAY
YKVO_BACSU      DILFANAGIGNFLPLGEITEEQVDRTFDINVKGTIFTVQKALSLFPDKVGSIIVTGSTAGSIGNPAFSVY
PHBB_RALEH      DVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGWGRIVNISSNGQKGQFGQTNY
YLX6_SCHPO      DVLINNAGLADDTPFEQLSHESWDHDVSLVLRGNYLTQRYVIPHMKQGKGGSIVNIGSVNGHIYLGSPAY
YHXC_BACSU      DILVNNAAEQHVQPIEKITSHQLIRTFQTNI-----FSMFYLTKAHLKKGSSIINTASITAYGNKTLIDY
YGFF_ECOLI      AALVNNAGILFTQTVENLTAERINRVLSTNVTGYFLCCREAVKRMALKNGGSIVNVSSVALGSPGEYVDY
FABG5_BRANA     DVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATXXXXXXXXXXXXXXASVVLIGNIGQANY
FABG4_BRANA     DVVVNNAGDTL---LIRMKKSQWDEVMDLNLTGVFLCSQAATXXXXXXXXXXXXXXASVVLIGNIGQANY
DECR_MOUSE      DVVINNAAGNFISPSERLTPNGWKTITDIVLNGTAYVT-LEIGKQLIKAQKGAAFLAITTIYAESGSMPS
HDHA_ECOLI      DILVNNAGGGGPKPFD-MPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNNMTSY
HDHA_ECO57      DILVNNAGGGGPKPFD-MPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNNMTSY
HDHA_CLOSO      DILVNNFGTGRPEKLVNGDEDTFFELFNYNVGSVYRLSKLIIPHMENKXXXXXXXXXXXXXXPDISRIGY
DHKR_STRCM      DVLVNNAGRSGGGVTADLTDELWDDVIDTNLNSVFRMTRAVLXXXXXXXXXXIINVASTAKQGVVLGAPY
BUTA_STAAW      HVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKFNHGGKIINATSQAVEGNPGLSLY
BUTA_STAAS      HVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKFNHGGKIINATSQAVEGNPGLSLY
BUTA_STAAR      HVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKFNHGGKIINATSQAVEGNPGLSLY
BUTA_STAAN      HVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKFNHGGKIINATSQAVEGNPGLSLY
BUTA_STAAM      HVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKFNHGGKIINATSQAVEGNPGLSLY
BUTA_STAAC      HVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKFNHGGKIINATSQAVEGNPGLSLY
UCPA_ECOLI      DILVNNAGVCRLGSFLDMSDDDRDFHIDINIKGVWNVTKAVLPEMIARKDGRIVMMSSVTMVADPGETAY
DHRS4_BOVIN     DILISNAAVSFFGSLMDVPEEVWDKILDVNVKATALLTKAVVPEMAKRXXXXXXXXXXXAAYSFPSLGPY
DHR11_HUMAN     DICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERDDGHIININSMSVLPLSVTHFY
ACT3_STRCO      DVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAGGMLERGRIVNIASTGKQGVVHAAPY
PECR_PONAB      NFLVNNGGGQFLSLAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVSIKTGLPLAVHS
FADH_BACSU      DALINNAAGNFICPAEKLTPNGWKAVIEIVLNGTFFCSQAAARHIDQKQQGVILNMAATXXXXXXXXXXX
FABG_RICFE      DILVCNAGITSDTLAIRMKDEDFDKVIDINLKANFILNREAIKKMMQNRYGRXXXXXXXXXXXXXGQANY
DECR_RAT        DVVINNAAGNFISPSERLSPNGWKTITDIVLNGTAYVT-IEIGKQLIKAQKGAAFLAITTIYAESGSMPS
Y1385_MYCBO     DVMVNNAGITRDATMRTMTEEQFDQVIAVHLKGTWNGTRLAAAIMRERKRGAIVNMSSSGKVGMVGQTNY
Y1350_MYCTU     DVMVNNAGITRDATMRTMTEEQFDQVIAVHLKGTWNGTRLAAAIMRERKRGAIVNMSSSGKVGMVGQTNY
UCPA_ECO57      DILVNNAGVCRLGSFLDMSDDDRDFHIDINIKGVWNVTKAVLPEMIARKDGRIVMMSSVTMVADPGETAY
BDH2_BOVIN      ---------------------------NLNVRSMYLMIKAFLPKMMAQKSGNIINMSSVAIKGVVNRCVY
NODG_RHIME      DILVNNAGITKDGLFLHMADPDWDIVLEVNLTAMFRLTREITQQMIRRRNGRIINVTSVAAIGNPGQTNY
GNO_GLUOX       DILINNAGIQRRAPLEEFSRKDWDDLMSTNVNAVFFVGQAVARHMIPRGRGKIVNICSQSELARPGIAPY
UCPA_SALTY      DILVNNAGVCRLGNFLDMSEEDRDFHIDINIKGVWNVTKAVLPEMIKRKDGRIVMMSSVTMVADPGETAY
UCPA_SALTI      DILVNNAGVCRLGNFLDMSEEDRDFHIDINIKGVWNVTKAVLPEMIKRKDGRIVMMSSVTMVADPGETAY
DER_CHICK       ELLVNNAAVAMLQPFLQVTREAVERSFDVNFRAVLHVSQIVARQMIAQGPGAIVNVSSQASQALRDHAVY
YXBG_BACSU      DILFNNAGV--DQEGGKVHVDLFDRIIAVDLRGTFLCSKYLIPLM-LENGGSIINTSSMSGRAADDRSGY
YHDF_BACSU      DILVNNAAEQHPQDILNISTEQLEKTFRTNIFSMFHMTKKALPH--LQEGCAIINTTSITAYGDTALIDY
IDNO_ECOLI      DVLVNNAGIQRRHPFTEFPEQEWNDVIAVNQTAVFLVSQAVTRHMVERKAGKVINICSQSELGRDTITPY
IDNO_ECOL6      DVLVNNAGIQRRHPFTEFPEQEWNDVIAVNQTAVFLVSQAVTRHMVERKAGKVINICSQSELGRDTITPY
FABG_ACTAC      YGVVLNAGLTRDNAFPALTDEDWDRVLRTNLDGFYNVLHIMMPMIRRRKAGRIVCITSSGLIGNRGQVNY
CBR2_MOUSE      DLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMNRGVPGSIVNVSSMAHVTFPNLITY
BAIA1_EUBSP     DVMINNAGITMNSVFSRVSEEDFKNIMDINVNGVFNGAWSAYQCMKDAKQGVIINTASTGIYGSLSGIGY
PECR_HUMAN      NFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHS
DCXR_HUMAN      DXXXXXXXXXXXQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGPGAIVNVSSQCSQAVTNHSVY
DHG_BACSU       DIMINNAGLENPVPSHEMPLKDWDKVIGTNLTGAFEAIKYFVEN---DIKGNVINMSSHEVIPWPLFVHY
BDH2_HUMAN      ---------------------------NLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVAVKGVVNRCVY
DHR11_MOUSE     DICINNAGMARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERDDGHIININSMCGHRVPPQSFY
CBR4_XENLA      DYLVNSAGISRDALLLRTRSEDIMSLLSINLVGTIQTCKVALKGMXXXXXXXXXXXXXXXXHGNIGQSIY
FABG_RICCN      DILVCNAGITSDTLAIRMKDEDFDKVIDINLKANFILNREAIKKMIQNRYGRXXXXXXXXXXXXXGQANY
HCDS_XANP2      TGLVNNAGIAGFGSVHATEVETWSRIMAVNVTGTFLASKAALFGMLERGRGAIVNFGSVALVGIPTMAAY
FABL_BACSU      DVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGGHIVSISSLSIRYLENYTTV
SORD_KLEPN      DGLVNNAGVNFPRPAGRYELNAFEKMVNINQKGVFFMSQAVARQMVKQRAGVIVNVXXXXXXXXXXXXXY
PECR_RAT        NFLVNNAGGQFMAPAEDITAKGWQAVIETNLTGTFYMCKAVYNSWMKDHGGSIVNIIVLLNNGFPTAAHS
PECR_MOUSE      NFLVNNGGGQFMAPVEDITAKGWHAVIETNLTGTFYMCKEVYNSWMREHGGSIVNIIVLLNNGFPTAAHT
CBR2_PIG        DLLVNNAAVALMQPFLDTTKEVFDRSFNVNLRSVFQVSQIVARSMERGVPGSIVNVSSMSHVTYPGLAAY
DHRS4_RAT       DILVSNAAVPFFGNLMDVTEEVWNKVLSINVTASAMMIKAVVPAMEKRXXXXXXXXXXXXXFVLPSLGPY
DECR_HUMAN      NIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVT-LEIGKQLIKAQKGAAFLSITTIYAETGSVPS
YGCW_ECOLI      DILVNNAGICKLNKVLDFGRADWDPMIDVNLTAAFELSYEAAKIMIPQKSGKIINICSLSYLGGQWSPAY
HCDR_XANP2      DVLVNNAGITGNSEAGVLHVEQFDKVMAVNVRGIFLGCRAVLPHMLLQGAGVIVNIASVALVAFPGRSAY
DHR11_BOVIN     DICINNAGLARPDTLLSGSTSGWKEMFNVNVLALSICTREACQSMRERDDGHIININSMCGHRVPPPAEY
BAIA2_EUBSP     DVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAKKGVIINTASTGIFGSLSGVGY
DHB8_HUMAN      SVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQAL-VSNGCRIINISSIVKVGNVGQTNY
CBR4_MOUSE      NFLVNAAGINRDSLLVRTKTEDMISQLHTNLLGSMLTCKAAMKTMIQQXXXXXXXXXXXXLKGNVGQSAY
CBR4_BOVIN      NFLVNAAGINRDNLLVRTNTEDMLSQLHTNLLGSMLTCRAALKTMIKQQRGSIVNVGS--VVGLKGNSGY
FABG_ARATH      DVVVNNAGITRDTLLIRMKQSQWDEVIALNLTGVFLCTQAAVXXXXXXXXXXXXXXSSVVLIGNIGQANY
BUTA_STAEQ      DVMVNNAGVDAVTPILEIGEEELSKLFNINVFGTLAANQFIKQKSKGKNACSIAGHESYEVLG-----TY
DHRS4_MOUSE     DILVSNAAVPFFGNLMDVTEEVWDKVLSINVTATAMMIKAVVPEMEKRXXXXXXXXXXXAGFTFPSLGPY
GRDH2_ARATH     DVLVNCAAEQHEVSIEDIDEARLERVFRTNI-----FSQFFLVKYALKEGSSIINTTSVVAYGNSSLLEY
DHB8_CANFA      SVVVSCAGLTRDEFLLRMSEDDWDRVIAVNLKGIFLVTQAAAQAL-VSSGCRIINISSIVKVGNVGQTNY
Y3106_PSEAE     DGLVCNAAIANPRPLEALSLGEWTRTLAVNLTGPMLLAKYCTPYLRAHNGA-IVNIASRAHQSEPDSEAY
GRDH1_ARATH     DVLINNAAEQYESSIEEIDEPRLERVFRTNIFSYFFLTRHALKHMK--EGSSIINTTSNAYKGNASLLDY
DHRS4_PIG       DILVSNAAV---NPFFGNIIDATEEVWDVNVKATVLMTKAVVPEMKRXXXXXXXXXXXXAYHPFPNLGPY
BDHA_RALEH      DILVNNAGIQHVAAIEDFPPERWDAIIAINLTSAFHTTRLALPGMKQKDWGRIINVASHGLVASAQKSAY
Y4LA_RHISN      DLLVNNASAMHLTPRDRLDLAVWDQTMATNLRGTLLCCRQAIPRMIARGGGAIVNMSSQGLSGDTAQTSY
Y2146_BRAJA     DLLVNNASAMHLTPRDRLELAVWDQTMATNLRGTLLCCRQAIPRMIARGGGAIVNMSSQGLSGDTALTSY
GS39_BACSU      DILVNNAGEQHPESIKDITSEQLHRTFKTNF-----YSQFYLTKKALKPGSAIINTTSNPYVGNPTLIDY
DHGB_BACME      DVMINNAGMENPVSSHEMSLSDWNKVIDTNLTGAFEAIKYFVEN---DIKGTVINMSSVHEWKIPWPVHY
MTDH_AGABI      SGLIANAGVSVVKPATELTHEDFKFVYDVNVFGVFNTCRA-VAKLWLQKQQKGSIVVTXXXXXXXTQVFY
BUTA_STAES      DVMVNNAGVDAVTPILEIGEEELSKLFNINVFGTLAANQFIKQKSKGKNACSIAGHESYEVLG-----TY
YAY8_SCHPO      DVLVNNIAYQVAQSIEDIDDEQWDLTFKTNIFSFFWVTKAAISHMK--SGSSIVNCSSNAYVGRPDLLDY
VER1_ASPPA      DIVSSNAGIVSFGHLKDVTPEEFDRVFRVNTRGQFFVAREAYRHMREGGRIILTSSNTACVKGVPKHAVY
T4HR_MAGGR      DIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMGSITGQAKAVPKHAVY
HSD_STREX       DGLVNNAGISTGMFLETESVERFRKVVDINLTGVFIGMKTVIPAMKDAGGGSIVNISSAALMGLALTSSY
BEND_ACIAD      DVLINNVGGAIMKPXXXXXXXXXXXXVHRSLFPALWCCRAVLPEMLKHQQGTIVNVSSIATRGI-HRIPY
Y019_THEMA      DVLVNNAAVMSVKSIFERPLEEWERVIRVNLTGPYICSRYCAEEMIKRGGGVIINIASTRAFQSEPDTEY
GRDH_DAUCA      DVLVNNAAEQYKSTVEDIDEERLERVFRTNI-----FAYFFMARHALKEGSTIINTTSNAYKGNAKLLDY
FABG6_BRANA     ------------------------------------------------------------LIGNIGQANY
DHR11_CHICK     DVCINNAGLARPEPLLSGKTEGWRTMIDVNVMAVSICTREAYQSMKERDDGHIININSMNGHSVVPQSFY
PECR_CAVPO      DFLVNNGGGQFWSSPEHISSKGWHAVIETNLTGTFYMCKAAYNSWMKEHGGAIVNIII-LLNGQPFVAHS
VIBA_VIBCH      DHLVCCAGILHVAPLHEMPMEQVSSIFTVNAFGVLACMQGVASSMKARQQGSMVIIGSNAANTPRMSIAY
RHLG_PSEAE      DILVNNAGTSWGAALESYPVSGWEKVMQLNVTSVFSCIQQLLPLLRAENPARVINIGSVAGISAMGEQAY
NOG4_RHIME      -------------------------VLEVNLTAMFRLTREITQQMIRRRNGRIINVTSVAAIGNPGQTNY
STCU_EMENI      DIVSSNAGIVSFGHVKDVTPDEFDRVFRVNTRG-----QFFVARRHLREGGRIILTSSNSVKGVPRHAVY
DECR2_DANRE     DILINNAAGNFLCPATSLSFNAFKTVMEIDTMGTFNTSKVIYDKWFKDHGGSIVNISATLGYGQALQVHA
ENTA_ECOLI      DALVNAAGILRMGATDQLSKEDWQQTFAVNVGGAFNLFQQTMNQFRRQRGGAIVTVASDAAHTPRGMSAY
DHK1_STRVN      DILVNNAGRSGGGATAEIADELWLDVITTNLTSVFLMTKEVLNAMLAKKRGRIINIASTGKQGVVHAVPY
CBR4_HUMAN      NFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMQQQXXXXXXXXXXXXLKGNSGQSVY
ARDH_PICST      DLLINTAGYCENFPAETYPATNAESIMKVNGLGSFYVSQSFARPLNLRGSIILIGSMSGTIVNPQPQCMY
CBR4_RAT        NFLVNAAGINRDSLLVRTKTEDMLSQLHTNLLGTMLTCRAAMRTMIQQXXXXXXXXXXXXLKGNVGQAAY
SPS19_YEAST     DFVIAGAAGNFVCDFANLSPNAFKSVVDIDLLGSFNTAKACLKELKKSKGSILFVSATFHYYGVPFQGHV
DHGA_BACME      DVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFEAIKYFVEN---DIKGNVINMSSHEMIPWPLFVHY
Y2478_STAAM     DIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMLEQSSGHLINIASISGFEVKSSTIY
Y2266_STAAN     DIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMLEQSSGHLINIASISGFEVKSSTIY
Y182_METEA      DVLVNNSGVYEFAAIEEVTEEHYRRIFDVNVLGVLLATQ--AASKHLGEGGSIINISS-VVTDVLMPTSY
DHG3_BACME      DVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFEAIKYFVEN---DIKGNVINMSSHEMIPWPLFVHY
DHG4_BACME      DVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFEAIKYFVEN---DIKGNVINMSSHEMIPWPLFVHY
Y2778_STAA8     DIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMLEQSSGHLINIASISGFEVKSSTIY
Y2488_STAAC     DIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMLEQSSGHLINIASISGFEVKSSTIY
Y2422_STAA3     DIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMLEQSSGHLINIASISGFEVKSSTIY
Y2403_STAAW     DIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTVQAALPTMLEQSSGHLINIASISGFEVKSSTIY
Y2370_STAAS     DIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTVQAALPTMLEQSSGHLINIASISGFEVKSSTIY
Y048_HAEIN      --------------------SGIEFVFNLNYLGSLLPTQVFAKDMLGKQGANIINISSMNAFTPLTKIAY
DHB14_HUMAN     DCVVNNAGHPPPQRPEETSAQGFRQXXXXXXXXXXXXXKLALPYLR-KSQGNVINISSLVAIGQAQAVPY
DHBA_BACSU      DILVNVAGVLRPGLIHSLSDEEWEATFSVNSTGVFNASRSVSKYMMDRRSGSIVTVGSNAA-GVPRTXXX
TRNH1_ARATH     DILINNLGAIRSKPTLDYTAEDFSFHISTNLESAYHLSQLAHPLLKASGCGNIIFMXXXXXXXXXXXXXX
DHSO_RHOSH      DILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGGRGKIINMASQALVGV-----Y
BUDC_KLETE      NVIVNNAGIAPSTPIESITEEIVDRVYNINVKGVIWGMQAAVEAFKKEHGGKIVNACSQAHVGNPELAVY
ARDH_CANTR      SVLINTAGYAENFPAEEYPAKNAENIMKVNGLGSFYVSQAFIQNNMTGSIILIGSMSGTIVNDPQPQCMY
Y2567_STAAR     DIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAKAALPTMLEQSSGHLINIASISGFEVKSSTIY
ARDH_CANAL      SVLVNTAGYAENFPAEEYPAKNAENLMKVNGLGSFYVSQAFIQNNMTGSIILIGSMSGTIVNDPQPQCMY
SDR1_PICAB      HIVVNNAGVTDSKTLAQTSDEEWDRIFQVNCKGAFLCSREAAKXXXXXXXXXXXXXXXXLVMPIPRYGAY
RDH8_HUMAN      DVLVNNAGMGLVGPLEGLSLAAMQNVFDTNFFGAVRLVKAVLPGMKRRRQGHIVVISSMGLQGVIFNDVY
MTDH_UROFA      TGLIANAGVSVVKEALQYNKDDFNKIFDVNVFGVFNCAQAFQRGXXXXXXXXXXQICNRPL----TQCFY
DHB8_RAT        SVVVSCAGITRDEFLLHMSEEDWDRVIAVNLKGTFLVTQAAAQALXXXXXXXXXXXXXXXXXXXXNQTNY
DHB8_PIG        SVVVSCAGITRDEFLLRMSEDDWDKVIAVNLKGIFLVTQAAAQALVXXXXXXXXXXXXXXXXKVGNQTNY
DECR2_PONAB     DILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNIATLGNRGQALQVHA
DECR2_HUMAN     DILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNIATLGNRGQALQVHA
UXUB_BACSU      -------------------------VFSTNFTGAFLASQVFGKELLKADSPAIINLSSMSAYSPMTKVAY
DHMA_FLAS1      ----------------------------------------------------------------------
NAHB_PSEU8      DCFIANAGISIEEPWEKIS-SSFDEIFDINVKSYFSGISAALPELKKTNGSVVMTXXXXXXXXXXXXXCY
NAHB_PSEPU      DCFIANAGISIEEPWEKIS-SSFDEIFDINVKSYFSGISAALPELKKTNGSVVMTXXXXXXXXXXXXXCY
DHB8_MOUSE      ------------------------------------------------------------------QTNY
XYLL_PSEPU      DILINNVG-------GTIWAKPFEHYQEREIEAEVRRSLFALAPMIEQGSGAIVNVSSVATRGI-HRVPY
SOU1_SCHPO      DVMIANAGIAIPH----LSLEDKNEVVGINLNGAYYTAQAAGHHFKKQGKGSLIFTASMSANWPQQWASY
Y2049_STAEQ     DIVVNSAGQSLSSKITDYNVEQWDTMIDVNIKGTLHVLQATLPYLLKQSSGHIINLASVSGFETKTNAVY
Y2036_STAES     DIVVNSAGQSLSSKITDYNVEQWDTMIDVNIKGTLHVLQATLPYLLKQSSGHIINLASVSGFETKTNAVY
YXEK_CAEEL      DILINNAAGNFIMATERLSPNAYGTIIDIVLKGTLHVTTELGRRIQQKRGASVLSITTLAQSGAPFVVPS
DHB8_CALJA      ------------------------------------------------------------------QTNY
YWFH_BACSU      DVLINNIPGGAPDTFDNCNIEDMTATFTQKTVAYIDAIKRASSLMKQNEFGRIINIVGNLWKEPANMFTN
YQJQ_BACSU      DVLINNAGFGIFETVLDSTLDDMKAMFDVNVFGLIACTKAVLPQMLEQKKGHIINIASQAKIATPKSSLY
Y0419_STAS1     DILVNSAGLMLSSAITEGDVEAWEAMIDVNIKGTLYTINAVLPSMLNQSSGHIINIASISGFEVKKSTLY
YVX3_CAEEL      DILVNNAAGNFIMATERLSPNAHGTIIDIVLKGTMNVTTELGKRIQSKTGASVTSIAAYARSGAPFIVPS
YVAG_BACSU      DILVNNLGIFEPAEYFDIPDDEWFRFFEVNIMSGVRLTRRYLHNMIEKKEGRVIFIASEAIMPSQEMAHY
Y4MP_RHISN      NILINNAGITQPVKTLDISDADWQRIVAVNMTGVLNLSQVFIPNMRQNGGGSIASVSAQRGGGIFGGPHY
LINX_PSEPA      TTLSNTAGIIHPGGFEEESIEGWNKMVAVNQTAILGIKAAIPELVKXXXXXXXXXXXXXXMFPTAGNASY
FABG_SCHPO      DTVVHAAGVLQSSLCVRTSEKEIDSIICTNLVSAIKLSEWFRNKNSERDRL-ILNISSRSTYALPGTSVY
DECR2_RAT       DILINCAAGNFLCPASALSFNAFKTVVDIDTLGTFNVSRVLYEKFFRDHGGVIVNIATLSMRGQVLQLHA
YBBO_ECOLI      YGIFNNAGFGMYGPLSTISRAQMEQQFSANFFGAHQLTMRLLPAMLPHGEGRIVMTSSMGLISTPGRGAY
YBBO_ECOL6      YGIFNNAGFGMYGPLSTISRAQMEQQFSANFFGAHQLTMRLLPAMLPHGEGRIVMTSSMGLISTPGRGAY
HSD_MYCTU       --LVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGRGSIINISSEGLAGTVACHGY
HSD_MYCBO       --LVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGRGSIINISSEGLAGTVACHGY
YWC4_CAEEL      EILVNNAAGNFIMATELLSSNAYGTIIDIVLKGTFNVTTELGKRIQNKTGASITSIAGYARAGAPFIVPS
HCD2_RAT        DVAVNCAGIAVAIKTKKNQVHTLEDVINVNLIGTFNVIRLVAGVMGQNEPDQIINTASVAAFGQVGQAAY
VDLC_HELPY      DVLINSAGYGVFGSVEDTPIEEVKKQFSVNFFALCEVVQFCLPLLKNKPHSKIFNLSS-----IAGRVSY
DECR2_MOUSE     -------------PASALSFNAFKTVVDIDTIGTFNVSSVLYKKFFRDHGGVIVNIATLSMRGQVLQLHA
YGHA_ECOLI      DALVAGKQVAIPD-IADLTSEQFQKTFAINVFALFWLTQEAIPLLP-KGASIITTSSIQAYQPSPHLLDY
YGHA_ECO57      DALVAGKQVAIPD-IADLTSEQFQKTFAINVFALFWLTQEAIPLLP-KGASIITTSSIQAYQPSPHLLDY
YUXG_BACSU      DIVVNNAGLATSSPFDETSLKEWNLNMNVLGTGYFLVAREAFKQMKHQNRGSMVFVGSKSVYAGKNASAY
YJGI_ECOLI      DILVVNAGIGVFGEALELNADDIDRLFKINIHAPYHASVEAARQMPEGGRILIIGSVNGDRMPVXXXXXX
FABI_NEIMB      DGLVHSIGFAPKEALSSISREAFNTAHEISAYSLPALAKAARPMMRGRNSAIVALSYLGAVRAIPNYNVM
DRS7C_HUMAN     DILINNASVKVKGPAHKISLELDKKIMDANYFGPITLTKALLPNMISRRTGQIVLVNNQGKFGIPFRTTY
BZRD_BACSU      ITLINNAGMVTPKRAGEASLDELQRHYQLNLTAPVLLSQLFTKRFASYSGKKVVNITSGAAKNYKGWSAY
THR1_GLOLA      DIVCSNSGVVSFGHVKDVTPEEFDRVFAINTRGQFFVAREAYKHLEVGGRLILMGSITGQAKGVPKHAVY
DRS7C_MOUSE     DILINNASVKVKGPAHKISLELDKKIMDANYFGPITLTKVLLPNMISRRTGQIVLVNNQAKFGIPFRTAY
DHRS4_PONAB     DILVSNAAVPFFGSLMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRXXXXXXXXXXXAAFSPSPGFSY
YR419_MIMIV     ----------------------------------------FALEQKSNIPVSIINMSSRNGVNISDRPIY
SOU1_CANAL      DIFVANAGVAWTDQWKKIVDCDLNGVYYC----AHTVGQIF--KKNKSGSLIITSSMSGTIVNIPQQAPY
PTMA_CAMCO      DGFVNS-SYPVGKDWGKISYEQICESLNLHLGGFILASQEFVKFFKKQSYGNIINLSS--IMGVQSSLEY
FABI_ANASP      DILIHCLAFANRDDLSQTSRAGFATALDISTFSLVQLSG--AAKPLMTEGGSIITLSYLGVRAVPNYNVM
DHRS4_HUMAN     DILVSNAAV---NPFFGSIMDVTEEVWDINVKAPALMTKAVVPEMEKRXXXXXXXXXXXAAFSPSPGFSY
DHG2_BACSU      DVMVNNSGFNGVEAMPEMSLEDWQRVIDVNVTGTFLGAKAALNHM-MKNNIKVLNISSQQIPRPVN-VQY
FOX2_NEUCR      DILINNAGI-----LRDISFKNMKDIFKVHVKGSYKTARAAWPYFRKQKFGRVINTASAALFGNFGQANY
FOX2_CANTR      HVIINNAGILRDASMKKMTEKDYKLVIDVHLNGAFAVTKAAWPYFQKQKYGRIVNTSSPALYGNFGQANY
YM71_YEAST      DILVNNAGKALSDRVGQIATEDIQDVFDTNVTALINITQAVLPIFQAKNSGDIVNLGSIARDAYPTGSIY
SRLD_ECOLI      DLLVYSAGIAKAAFISDFQLGDFDRSLQVNLVGYFLCAREFSRLMXXXXXXXXXXXSKSGKVGSKHNSGY
HCD2_DROME      DLTVNCAGTATAVKFNKNVAHRLEDVININTVGTFNVIRLSAGLMGANEPNQIVNTASVAAFGQIGQAAY
FOX2_YEAST      DVLINNAGILRDVSFAKMTEREFASVVDVHLTGGYKLSRAAWPYMRSQKFGRIINTASPALFGNFGQANY
YTKK_BACSU      DFLINNAGPYIFERK-KLADYTDDEWYGMNLSAVFHLFKAVIPIMRKQQFGRIITYGFQGAAGWLHRSAF
YHXD_BACSU      ---------------------------------------------------------------------Y
VDLC_HELPJ      DVLINSAGYGVFGSVEDTPIEEVKKQFSVNFFALCEVVQLCLPLLKNKPYSKIFNLSS-----IAGRVSY
DHG1_BACME      DVMINNAGMENPVSSHEMSLSDWNKVIDTNLTGAFEAIKYFVENDIKGTVINMSSVHEKIPWPLF--VHY
DHRS7_ANOGA     DILVNNGGISVRGDALSTAIDVDIRIMLVNYFGSVALTKACLPSMMARKEGRIVSISSQGKFAIPHRSAY
DHG_BACME       DVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFEAIKYFVENDIKGTVINMSSVHEKIPWPLF--VHY
DHB1_RAT        DVLVCNAGRGLFGPLEAHELNAVGAVLDVNVLGTIRMLQAFLPDMKRRHSGRVLVTASGGLMGLPFHEVY
PTR1_LEITA      DVLVNNASSFYPTPLLRKDASSVGDKESLEVAAADAIAPYFLIKAFAQRVASIVNMVSQPLLGY---TMY
KDSR_BOVIN      DMLVNCAGMSLSGKFEDLEVSTFERLMSINYLGSVYPSRAVIATMKERRMGRVVFVSSQAQLGLFGYTAY
DHB1_MOUSE      DVLVCNAGRGLFGPLEAHELNAVGAVLDVNVLGTIRMLQAFLPDMKRRHSGRVLVTASGGLMGLPFHEVY
MOAE_KLEAE      ---------------------------------------------------------------------Y
HETN_ANASP      DVLINNAGIEINGTFANYSLAEIQSIFNTNXXXXXXXXXXXXPSMMERGSGRIVNIASLAKKGVAFNSVY
DHB14_BOVIN     DCIVNNAGYHPPPQWPETSAQGFRQXXXXXXXXXXXXXKLALPHLR-KSRGNVINISSLVAIGQSQAVPY
KDSR_HUMAN      DMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAQLGLFGFTAY
HCD2_HUMAN      DVAVNCAGIAVASKLKKGQTHTLEDVLDVNLMGTFNVIRLVAGEMGQNEPDQIINTASVAAFGQVGQAAY
DHK2_STRVN      DVLVNNAGRAIPHALAAATPEVWREILGLNVIGTWQTTVAAMPH--LARXXXXXXXXXXXIAGSRPAGSY
PGDH_CAVPO      DILVNNAGVNNEKNWEKTL-----QINLVSVISGTYLGLDYMSKQHGGEGGVIINMSSLALMPVAQQPVY
HCD2_MOUSE      DVAVNCAGIAVAIKTKKNKIHTLEDVINVNLIGTFNVIRLVAGEMGQNEPDQIINTASVAAFGQVGQAAY
RIDH_KLEAE      DIFHANAGAYIGGPVAEGDPDVWDRVLHLNINAAFRCVRSVLPHLIAQKSGDIIFTAVIAVVPVIWEPVY
FABI_BACSU      HGIAHCIAFANKEELVGEYLNTNRDGFLLNISSYSLTAVVKAARPMMTEGGSIVTLTYLGELVMPNYNVM
DRS7C_BOVIN     DILINNASVKVKGPAHKISLELDKKIMDANYFGPIILTKALLPDMISRRTGQIVLVNNQGKLGIPFRTAY
YQC8_SCHPO      HVVVANAGMPFRRSVLDSPPHEFEKVMNINTNSVYRVAYYMGKIFKKQGFGNLIATASMSVNAPQHIAAY
DHRS2_HUMAN     DFLVCSAGVLVGSTLGT-SEQIWDKILSVNVKSPALLLSQLLPYMENRRGAVILVSSIAAYNPVVALGVY
SDH_RHIRD       DILVNNAGLALTAPAPQVPLKDWQTMVDTNITGLLNVTHHLLPTL-IERKGIVINLSSAAHYPYLGGNVY
SDH_AGRT5       DILVNNAGLALTAPAPQVALKDWQTMVDTNITGLLNITHHLLPTL-IKQKGIVVNLSSAAHYPYLGGNVY
DHB4_HUMAN      DVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASIYGNFGQANY
KDSR_MOUSE      DMLVNCAGTSMSGKFEELEVSSFEKLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAQLGLFGFTAY
DHRS7_DROME     DILINNGGISVRADVASTAVDVDLKVMVVNYFGSVALTKALLPSMVKRGSGHICFISSQGKFAIPQRAAY
BZRD_BACCE      IHLINNAGTVAPKPIEKAESEQFITNVHINLLAPMILTSTFMKHTKWKVDKRVINISSGAYFGWGAYCTT
HCD2_BOVIN      DVAVNCAGIAVASKLKKSQAHTLEDVINVNLIGTFNVIRLVAGEMGQNEPDQIINTASVAAFGQVGQAAY
DRS7C_XENTR     DVLINNASMKMKGPLQSVSLELDKKIMDANYFGPITLVKAILPHMISRRTGQIVLVNTQGKIGVPFRAAY
YB45_SCHPO      DSVILNAGVL--EPIAKIADADINELFDINFFSVVETVKYAIPHLRKTKGTIVIVSSGAAVRVFPAWAAY
Y0585_STAHJ     DIFVNCAGVMRSSKITDYQVESWDSMVDTNIKGLLYSLNAILPKFEAQGSGHVVNLASISANEVSKESAY
RDH8_BOVIN      XXXXXXXXXXXXXXXXELSLAAMQNVFDTNFFGAVRLVKAVLPSMKRRRQGHIVVVSSMGLQGVVFNEVY
DRS7B_MOUSE     DVLINNAGISYRGTISDTIVDVDRKVMEINYFGPVALTKALLPSMVERKQGHIVAISSQGKISIPFRSAY
ACR1_ACIAD      DFLINNAGRSIRRAVHE-SFDRFHDTMQLNYFGAVRLVLNLLPHMIKRKNGQIINISSIGVLANATRSAY
PGDH_MOUSE      DILVNNAGVN-----NEKNWEQTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLALMPVAQQPVY
Y4EL_RHISN      ---------------------------------------------------RIVNITSVDAFKAHPQNAY
DHB4_RAT        DVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHMKKQNYGRIIMTASASIYGNFGQANY
BPHB_PSEPU      DTLIPNAGIALIDLPEESLDAAFDEVFHINVKGYIHAVKACLPALVASRGNVIFTISNAGFYPNGGGPLY
ACR1_ACIBI      DFLINNAGRSIRRAVHE-SFDRFHDTMQLNYFGAVRLVLNLLPHMIKRKNGQIINISSIGVLANATRSAY
Y432_LISMO      DAIFLNAGIMPNSPLSALKEDEWEQMIDINIKGVLNGIAAVLPSFIAQKSGHI--IATSSVAGLKGGAVY
DHB4_MOUSE      DVVVNNAGILRDRSFSRISDEDWDIIHRVHLRGSFQVTRAAWDHMKKQNYGRILMTSSASIYGNFGQANY
FABI_BUCAP      DGLVHSIAYCPKKQMHEDFVES-SSRKSFNICHEISSYSFLSMARECKNMLKFSSLVTLSYLGVSNYNMM
DRS7B_XENTR     DILINNAGISYRGTILDTKVSVDRMVMDTNYFGPVALTKALIPSMIKNRRGHIVVISSQGKISIPFRSAY
DHB1_PANTR      DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRVLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
PTR1_LEIMA      -------------------------------------------------------------------TIY
PGDH_MACFA      DILVNNAGVNNEKNWEKTL-----QINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLALMPVAQQPVY
PGDH_HUMAN      DILVNNAGVNNEKNWEKTL-----QINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLALMPVAQQPVY
FABI_HAEIN      ---------------------------------------------------------------IPNYNVM
TS2_MAIZE       --------------------------------------------------------------------AY
LIMC_RHOER      DIVSANAGIAVPFLSHDIPDNTWRQMIDINLTGVWHTAKVAVPHILAGERGGSIVLTSSALKGYAQISHY
FABI_HELPJ      DFIVHSVAFAPKEALEGSLLETSKSAFN----TAMEISVYSLIELTNTLKPLLNNGASVLTLSYLGSTKY
DLTE_BACSU      NVLVNNAGIEIDFKKGTEELFVDGDEIELNFQAPVHLSALFTPHLMKQPEAAIVQVTSGLAFNLAVYPVY
DHB1_HUMAN      DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
Y452_LISIN      DAIFLNAGIMPNSPLSALKEDEWEQMIDINIKGVLNGIAAVLPSFIAQKSGHI--IATSSVAGLKGGAVY
FABI_PSEAE      DIIVHSVGFAPGDQLGDFTAVTTREAHDISAYSFIALAKAGREMMKGRNGSLLTLSYLGAERTMPNYNVM
YAEB_SCHPO      HYLINNAGAPCSAPAIDLDIEDVSKVMDVNFYGVIRMNKAFQHQL-IRAKGTIVNVNSLVSYPXXXXXXX
PGDH_BOVIN      DILVNNAGVNNEKNWEKTL-----QINLVSVISGTYLGLDYMSKQNGGEGGININMSSLALMPVAQQPVY
FOLM_KLEP7      DAIIHNASDWMAEKPGVPLSTVINRMMQIHVHAPYLLNHALEALLRGHGHADIIHITDYVVRGSDKHIAY
MFEA_DICDI      DILINNAGILRDVSFGKMTDGDWDLVYRVHAKGAYKLSRAAWNHMREKNFGRIIMTSSAALYGNFGQANY
FABI_SHIFL      DGFVHSIGFA---PGDQLDGDYVNAVTREGFKIAHDISSYSFVAMA--KACRSMLNPGSALLAIPNYNVM
FABI_ECOLI      DGFVHSIGFA---PGDQLDGDYVNAVTREGFKIAHDISSYSFVAMA--KACRSMLNPGSALLAIPNYNVM
FABI_ECO57      DGFVHSIGFA---PGDQLDGDYVNAVTREGFKIAHDISSYSFVAMA--KACRSMLNPGSALLAIPNYNVM
DHB2_HUMAN      AAVINNAGVGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLR-KSKGRLVNVSSMGGGAPMERASY
3BHD_COMTE      NVLVNNAGILLPGDMETGRLEDFSRLLKINTESVFIGCQQGIAAMK-ETGGSIINMASSSWLPIEQYAGY
YUSR_BACSU      ---------------------------------------------------------------------Y
DHRS7_HUMAN     DILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSLGIISVPLSIGY
DCXR_TRIRE      ----------------------------------------------------------------QEQTSY
BPHB_BURXL      DTLIPNAGIALVDLPEESLDAAFDEVFHINVKGYIHAVKACLPALVASRGNVIFTISNAGFYPNGGGPLY
MTDH_CLAHE      DAFIANAGATADSGILDGSVEAWNHVVQVDLNGTFHCAKAVGHHFKERGTGSLVITASMSGHIAQEQTSY
INHA_MYCTU      DGVVHSIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
INHA_MYCBO      DGVVHSIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
FABI_SYNY3      DILIHCLAFADKSGL----TGNYTDIPKEAFSQAMEISTYSLGRLARGAKPLMTNIITLTYFGIPNYNLM
FABI_SALTY      DGFVHSIGFA---PGDQLDGDYVNAVTREGFKVAHDISSYSFVAMA--KACRTMLNPGSALLAIPNYNVM
DHRS7_MOUSE     DILVNNGGRSQRSLVLETNLDVFKELINLNYIGTVSLTKCVLPHMIERKQGKIVTVNSIAIASVSLSSGY
DHB12_XENTR     ESLVNNVGVSYEHPEYFLEINTLDKMININITSVCQMTRLVLPGMLGRGRGVILNISSASMYPVPLLTVY
DHB12_ANAPL     DVLVNNVGISYSYPEYFIDVKTIDKMININIMSVCKMTRLVLPGMLERSKGVILNISSAAMYPTPLLTLY
DH12A_DANRE     KILVNNVGISYSYPEFFLHIPDLENMINVNITSVCQMTRLVLPRMEARAKGVILNISSASMFPVPLLTIY
YUSZ_BACSU      DLLVNNAGTAYGGFIEDVPMEHFRQQFETNVFGVIHVTKTVLPYIRKHGGAKIINVSSSGLTGFPALSPY
RDH10_XENTR     YLLLNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPKMMEMNHGHIVSVASSGLFSTAGVEDY
BPHB_RHOGO      DCYIGNAGVLVEIPEDRLD-EAFDEMYSINVKGYLLGVKAALGALYASRGSVIFTVSNAGFYPAGGGALY
EPHD_MYCTU      DIVVNNAGIGQAGRFLDTPAEQFDRXXXXXXXXXXXXCRAFGQRLERGTGGHIVNVSSMAAYALQSLSAY
EPHD_MYCBO      DIVVNNAGIGQAGRFLDTPAEQFDRXXXXXXXXXXXXCRAFGQRLERGTGGHIVNVSSMAAYALQSLSAY
DRS7B_PONAB     DILVNNAGISYRGTIMDTTVDVDKRVMETNYFGPVALTKALLPSMIKRRQGHIVAISSQGKISIPFRSAY
DRS7B_HUMAN     DILVNNAGISYRGTIMDTTVDVDKRVMETNYFGPVALTKALLPSMIKRRQGHIVAISSQGKMSIPFRSAY
FABI_AQUAE      DIIVHSIAYAPKEEFGVIDTSGFKIAMDISVYSLIALTRELLPLMEGRNGAIVTLSYYGAEKVVPHYNVM
DHB2_RAT        DAVVNNAGVLFPIDGELIPMTVYRKCMAVNFFGAVEVTKVFLPLLR-KSKGRLVNVSSMAMIPFQMVAAY
YL426_YEAST     -LIVNNAGVANFTGFNGMERDNLDKIFKINTFAPLQFIQELAPSRHSTRQCYIVNIAS--ILGILTPXXX
YD114_YEAST     XXXXXXAGVAHIKKLEHMTNKEVEQLIDINLIGAYRIISTFAEDMIDNREGFIINIAS--VLGPARLTSY
Y4EK_RHISN      DVLVNNAGLTASASLVDLSEDDIDAMIDINIRSVFKLTRHVLKQMIERRRGHIFTGSSGGLAPHPNSSVY
Y1627_STAS1     DVLINNAGLMPQSFLEKNKQDEWNQMIDVNIKGVLYGIGAVLPYMRKQKSGHIINLASVAGHVVPGSAVY
MKAR_ASPTN      DVLINNVGKSMPVPFALTSEEEMTDIVTINCMGTLRVTQLVVPGMMQRRRGLILTMGSGGLLPTPLLATY
STDH2_CAEEL     GILINNVGMFFPEMLHKINIDSIANVIIINTLPATLLSAGILPQMVSRKAGIIVNIGSFAVVKLAEWSIY
DS7CA_DANRE     DVLICNSSMKVKAPVQNLSLEMDKTIMDVNYFGPITLAKGVLPLMITRRTGQFVLVNSQGKLALPFRTCY
DRS7B_DANRE     DVLINIAGVSYRGNILDTHVSVQREVMETNYFGPVALTQAILPSMVDRGSGHIVVISSQGKISIPYRSAY
DHB12_MACFA     -ILVNNVGMSYEYPEYFLDVPDLDNVININILSVCKMTQLVLPGMVERSKGAILNISSSGMFPVPLLTIY
RD10B_XENLA     YLLLNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPKMMEMNHGHIVSVASSGLFSTAGVEDY
YI78_SCHPO      DVLLNNAGYSVYSPLESTTEEQIHNIFNTNVFGALEVIKAITPIFRSQHNGMIINVSSKMTFPL--GCLY
DH12A_XENLA     EALVNNVGVSYEYPEYFLEINTLDKMININIMSVCQMTRLVLPGMLGRGKGVILNISSASMYPVPLLTVY
BPHB_PSEPS      DTLIPNAGIALVDLPEESLDAAFDEVFHINVKGYIHAVKA-LPALVASRGNVIFTISNAGFYPNGGGPLY
RD10A_DANRE     DLLINNAGVVSGHHLLECPDELIERTMVVNCHAHFWTTKAFLPKMLEMNHGHIVTVASSGLFSTAGVEDY
DHB12_HUMAN     -ILVNNVGMSYEYPEYFLDVPDLDNVININILSVCKMTQLVLPGMVERSKGAILNISSSGMLPVPLLTIY
YQ53_SCHPO      DIVINNAGYGLVGEFESYNIEEMHRQMNVNFWGVAYITKEALNLMRESKGGRILQISSVAYYPSPCLSMY
YDFG_ECOL6      DILVNNAGLALMEPAHKASIEDWETMIDTNNKGLVYMTRAVLPGMVERNHGHIINIGSTASWPYAGGNVY
RD10A_XENLA     YLLLNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPKMMELNHGHIVSVASSGLFSTAGVEDY
FABI_RICBR      DFLLHGMAFSDRNELGRYIDTSLG-----NFNNSLHISCYSLVELA-REAEKLMNIVTLSYYGIPNYNVM
YDFG_SHIFL      DILVNNAGLALMEPAHKASVEDWETMIDTNNKGLVYMTRAVLPGMVERNHGHIINIGSTASWPYAGGNVY
SOU2_CANAL      DIFVANAGVAWTEEIDVKGVDKWNKVVDVDLNSVYYCAHVVGPIFRKKGKGSFIFTASMSASIVQLQAAY
DHB2_MOUSE      -AVVNNAGVFLPIDGELIPMSIYRKCMAVNFFGTVEVTKAFLPLLR-KSKGRLVNVSSMGTVPLQMTSAY
DHB12_MOUSE     -VLVNNVGMSYEYPEYFLEIPDLDNLININVLSVCKVTRLVLPGMVERSKGVILNISSASMLPVPLLTIY
BPHB_COMTE      DTLIPNAGIALADPEDKID-AAFDDIFHVNVKGYIHAVKACLPALVSSRGSVVFTISNAGFYPNGGGPLY
ABA2_ARATH      DILINNAGLCAPCPIRNYSLSEFEMTFDVNVKGAFLSMKHAARVMPEKKXXXXXXXXXXXXXXXXXXXXX
RD10B_DANRE     DLLINNAGVVSGRHLLDCPDELIERTMMVNCHAHFWTTKAFLPKMLELNHGHIVTVASSGLFTTAGVEDY
MTDH_ALTAL      ----------------------------------------------------------------QEQASY
HSDL1_CHICK     GILVNNVGLTYPDYFTNLSEDMLWDMINVNIASANMMVHIVLPGMVEKRKGAIVNVSSASCCPTPMLTTY
FABI1_RHIME     ----------------------------------------------------------------------
DS7CB_DANRE     DVLVFNSSMKLKAPVHSLSLQMDRLLMDVNYFGPITLVKGFLPSLISRRSGHILLVNSQGKLAMPFRTTY
DRS7B_XENLA     DILINNAGISYRGTILDTKVSVDRMVMDTNYFGPVALTKALLPSMIKNRRGHVVVISSQGKISIPFRSAY
DRS7B_BOVIN     DVLINNAGISYRGAIVDTSPDVDKRVMETNYFGPVALTKALLPAMIRRRQGHVVAISSQGKISLPFRSAY
DHB11_HUMAN     SILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAHVSVPFLLAY
BPHB_PSES1      DCLIPNAGILVDIPDDRID-AAFDEVFHINVKGYLLAVKACLPALVQSRGSVVFTISNAGFYPNGGGPLY
DHB11_PONAB     SILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMMKNNHGHIVTVASAAHVSVPFLLAY
DH12B_XENLA     EALVNNVGISYEYPEYFLEINTLDKMININIMSVCQMTRLVLPGMLGRGKGVVLNISSASMYPVPLLTVY
YDFG_ECO57      DILVNNAGLALMEPAHKASIEDWETMIDTNNKGLVYMTRAVLPGMVERNHGHIINIGSTASWPYAGGNVY
YDFG_ECOLI      DILVNNAGLALMEPAHKASVEDWETMIDTNNKGLVYMTRAVLPGMVERNHGHIINIGSTASWPYAGGNVY
STDH1_CAEEL     GILINNVGMFFPEMLHKINIDSIANVTIINTLPATLLSAGILPQMVPRKAGIIVNIGSVAGLATMAEWSY
FABI_RICFE      DFLLHGMAFADKNELGRYVDTSLENFHNLHISCYXXXXXXXXXXXXMHDGGSIVTLTYYGAEKVPNYNVM
DHI2_MOUSE      TGLVNNAGLNIVVADVELSVATFRKCMEVNFFGALELTKGLLPLLR-HSRGRIVTVGSPADMPYPCLAAY
DHB13_HUMAN     TIVVNNAGTVYPADLLSTKDEEITKTFEVNILGHFWITKALLPSMMERNHGHIVTVASVCGHGIPYLIPY
DR4L2_HUMAN     DILVSNAAVPFFGSLMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRXXXXXXXXXXXAAFSPSPGFSY
DHB12_RAT       -VLVNNVGMSYEYPEYFLEIPDLDNLININVLSICKVTRLVLPGMVERSKGVILNISSASMLPVPLLTVY
YCP8_SCHPO      DVLVNSAVFHSFGPVVNTPDDVWNSHYKTNVLGPIHVYQAFYPLIK-KGRSKIIVFTSSGAFFPSSQSAY
YBPE_SCHPO      FALINAAAIAPKNHLLSISRQELQKCFETNVIGQLAITSALFPLLLQDPNPHVVNIASSAYFSAMGVGAY
RDHE2_MOUSE     SILINNAGIVTGRNFLDCPDDLMEKSFDVNFKAHLWMYKAFLPAMIANNHGHLVCISSSALIGVNGLSDY
RDH13_HUMAN     DILINNAGVMCPHWTTE---DGFEMQFGVXXXXXXXXXXXXXXXXKASAPSRIINLSSLAHVAYNTKAAY
FABI_BRANA      ----------------------------------------------------------------------
DRS7B_RAT       DILINNAGISYRGAISDTIVDVDRKVMEINYFGPVALTKALLPSMVERKRGHIVAISSQGKISIPFRSAY
DHRS1_MOUSE     DVLVNNAYAGVQAILNEVPASIWDDINNVGLRGHYLCSVYGARLMVPAGKGLIVIVSSPGGLQHMFNVPY
RDH10_RAT       SVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSGLFSTAGVEDY
RDH10_MOUSE     SVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSGLFSTAGVEDY
RDH10_HUMAN     SVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSGLFSTAGVEDY
RDH10_BOVIN     SVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSGLFSTAGVEDY
INHA_MYCS2      DGVVHSIGFM---PQSGMGINPFFDAPYEDVSKGIHISAYSYASLA-KAVLPIMNIVGMDFDPTRAMPAY
FABI_RICPR      DFLLHGMAFANKNELGRYVETSLENFHN-----SLHISCYSLLELSRSAETLMHNIVTLTYYGIPNYNIM
FABI_HELPY      DFIVHSVAFAPKEALEGSLLETSKSAFN----TAMEISVYSLIELTNTLKPLLNNGASVLTLSYLGSTKY
FABI2_RHIME     -----------------------------------------------------------------NYNVM
Y5909_MYXXD     DLVVANAGVGGTTNAKRLPWERVRGIIDTNVTGAAATLSAVLPQMVERKRGHLVGVSSLAGFGLAGHAAY
FABG_YEAST      NLLINCAGLTQESLSVRTTASQIQDIMNVNFMSPVTMTNICIKYM-MKSQRRIVNISSILHSGVPGTSVY
DHB13_MOUSE     EIVVNNAGAIYPADLLSAKDEEITKTFEVNILGHFWIIKALLPSMLRRNSGHIVTVASVCGHGVPYLIPY
DHB11_RAT       SILVNNAGVVYTADLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMMKNNHGHVVTVASAAGHTVPFLLAY
DHB11_MOUSE     SILVNNAGVVYTADLFATQDPQIEKTFEVNVLAHFWTTKAFLPVMMKNNHGHIVTVASAAGHTVPFLLAY
YIV6_YEAST      DGIVANAGML--EPVKSISIKQWERLFDVNFFSIVSLVALCLPLLKSSPFVNIVFVSSGASVKPYNGSAY
YCP6_SCHPO      DVLWVNSGIFHSNTVLNTPDDVWNSHYKTNVLGPIHVYQAFYPLVK-KGESKIILVGSMGAFFPFNQSGY
MKAR_NEOFI      VAVINNVGKSIPTPFALTPEDEMTDIVTINCLGTLRTTQLIIPGMMQRKRGLVLTMGSGGLLPTPLLATY
DHRS1_HUMAN     DVLVNNAYAGVQTILNETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVPY
STDH3_CAEEL     GMLINNVGMLFPENLHKTGIDVVANVTILNTLPVTLLSAGILPQMVSRKTGIIVNIGSVAGAAKMAEWSY
S16C6_BOVIN     TILINNAGVVTGREFLKTPDHMVERSFLVNVMSHFWTYKAFLPAMLEANHGHLVCISSFAIVGINELSDY
MKAR_AJECN      SILVNNVGHSIPTPFVLTPLEELENIIMINCTGTLRITQLVAPGMMQRKRGLILTMASFAMIPTPLLATY
LIGD_PSEPA      TLLSNTAGVNSFGPIEKTTYDDFDWIIGVNLNGVINGMVTFVPRMIASGRPHIVTVSSLGGFGSALAGPY
DHI2_RAT        TGLVNNAGLNMVVADVELSVVTFRECMEVNFFGALELTKGLLPLLR-HSRGRIVTVGSPADMPYPCLAAY
DHB13_RAT       EIVVNNAGAIYPADLLSTKDEEITKTFEVNILGHFWIIKALLPSMLRRNSGHIVTVAS--VCGIPYLIPY
DHB11_MACFA     SILVNNAGVVYTSDLFATQDAQIEKTFEVNILAHFWTTKAFLPAMMKNNHGHVVTVASAAHISVPFLLAY
YCIK_ECOLI      DGVLHNAGLLGDVPMSEQNPQVWQDVMQVNVNATFMLTQALLPLLLKSDAGSLVTSSSVGRQGRANWGAY
LE767_CAEEL     GVLINNVGMSYPDVLHKVDIERLAXXXXXXXXXXXXXSAGILPQMVARKAGVIVNVGSSA--GANQMALY
DHRS3_BOVIN     TILVNNAAVVHGKSLMDSDDDALPKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSLALSAIPGAIDY
Y1570_MYCBO     DILINNAGRSIRRSL-ELSYDRIHDTMQLNYLGAVQLILKFIPGMRERHFGHIVNVSS---VGVQTRAAY
Y1543_MYCTU     DILINNAGRSIRRSL-ELSYDRIHDTMQLNYLGAVQLILKFIPGMRERHFGHIVNVSS---VGVQTRAAY
MOMAS_ORYSJ     DVMFNNAGVSGP-PCFRMSECTKEDFER--VLAVNLVGPF----LGTKHAARVMAPARRGXXXXXXXXXY
MKAR_PICST      TVLINNVGQSIPVPFLETENKELQDIITINVTATLKITQTVVSKEKKKVRGLILTMGSGGLLPTPYLATY
FOLM_CITK8      --------------------------------------------------------------GSDKHIAY
FABI_RICTY      DFLLHGMAFANKNELGRYVDTSLENFYN-----SLHISCYSLLELSRSAETLMHDILTLTYYGIPNYNIM
FABI_RICCN      ---------------------------------------------------------------IPNYNVM
DHRS3_HUMAN     TILVNNAAVVHGKSLMDSDDDALLKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSLALSAIPGAIDY
Y945_MYCTU      DRVIVNAGIGKGARLGSGKLWANKATIETNLVAALVQIETALDMFNQRGSGHLVLISS--VLGVKGKAAY
DHRS9_MOUSE     --LINNAGVGVLAPTDWLTVDDYREPIEVNLFGLINVTLNMLPLVK-KARGRVINVSSRLAFG---GGGY
AYR1_YEAST      DLLYNNAGQSCTFPALDATDAAVEQCFKVNVFGHINMCRELSEFL-IKAKGTIVFTGSLAVVSFPFGSIY
S16C6_MOUSE     TILINNAGVVTGKSFLNTPDHLVEKSFLVNAISHFWTCKAFLPAMVKANHGHLVCISSIALVGINGLSDY
Y3820_MYCBO     -------------------------IAEINYTAAVSVGVLLAEKMRAQGFGQIIAMSSAAGERVRRANFY
Y3791_MYCTU     -------------------------IAEINYTAAVSVGVLLAEKMRAQGFGQIIAMSSAAGERVRRANFY
FABI_BUCAI      ---------------------------------------------------------------VPNYNVM
YI13_SCHPO      DVLINNAGLALTDKVIDLNIDDAVTMITTNVLGMMAMTRAVLPIFYSKNKGDILNVGS--IAGRESYVGY
MKAR_ASPFU      VAVINNVGKSIPTPFALTPEDEMTDIVTINCLGTLRTTQLIIPGMMQRKRGLVLTMGSGGLLPTPLLATY
MKAR_ASPFC      VAVINNVGKSIPTPFALTPEDEMTDIVTINCLGTLRTTQLIIPGMMQRKRGLVLTMGSGGLLPTPLLATY
RDHE2_HUMAN     SILINNAGIVTGKKFLDCPDELMEKSFDVNFKAHLWTYKAFLPAMIANDHGHLVCISSSALSGVNGLADY
MKAR_ASPCL      SILINNVGKSIPVPFALTPEDEMTDIVTINCLGTLRATQLVIPGMMQRRRGLVLTMGSGGLLPTPLLATY
DHRS3_MOUSE     TILVNNAAVVHGKSLMDSDDDALLKSQHVNTLGQFWTTKAFLPRMLELQNGHIVCLNSLALSAIPGAIDY
TSC10_YEAST     TQTLCCAGGAVPKLFRGLSGHELNLGMDINYKTTLNVAHQIALAEQTKEHHLIIFSSATALYPFVGYSQY
PATL1_ARATH     ---------------------------------------------------------------VKPAANY
HSDL2_XENLA     DILVNNASAISLTNTLETSMKKVDLMMGINTRGTYLTSKIYLKKSKVAHIXXXXXXXXXXXMWFKNHCAY
DECR2_ARATH     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SAAKSALVGCTKTWALELAKYGICVNAIAPGPVDTELFRKTRPIGSSEEKEVLDSIPMMRIGKPEEIAAT
FABG_VIBHA      AAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDM---TKALNDDQRAATLSNVPAGRLGDPREIASA
FABG_PSEAE      AAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDM---TRELPEAQREALLGQIPLGRLGQAEEIAKV
FABG_MYCS2      AAAKAGLIGMARSISRELAKAGVTANVVAPGYIDTEM---TRALDERIQAGALDFIPAKRVGTAEEVAGA
FABG_THEMA      AASKAGVIGMTKTWAKELAGRNIRVNAVAPGFIETPM---TEKLPEKARETALSRIPLGRFGKPEEVAQV
FABG_CUPLA      SAAKAGVIGFTKTVAREYASRNINVNAVAPGFISSDM---TSKLGDDINKKILETIPLGRYGQPEEVAGL
FABG_MYCAV      AAAKAGLIGMARSISRELSKAGVTANVVAPGYIDTEM---TRALDERIQAGALEFIPAKRVGTAAEVPGA
FABG_BUCBP      SAAKLGLVGFHKSLALELAPKGITVNMIAPGLIKTGM---TNNLSQKQLSKYLSKIPMKRLGTIKEISKI
FABG_SHIFL      AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDM---TRALSDDQRAGILAQVPAGRLGGAQEIANA
FABG_ECOLI      AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDM---TRALSDDQRAGILAQVPAGRLGGAQEIANA
FABG_BUCAP      SASKSGLIGFHKSLALEVAQKGITVNIVSPGFIKTNL---TKNLNVFQYKKHLSKIPMKRIGTAEEIANA
FABG_HAEIN      CAAKAGVVGFSKSLAKEVAARGITVNVVAPGFIATDM---TEVLTDEQKAGILSNVPAGRLGEAKDIAKA
FABG_MYCTU      AASKAGVIGMARSIARELSKANVTANVVAPGYIDTDM---TRALDERIQQGALQFIPAKRVGTPAEVAGV
FABG_MYCBO      AASKAGVIGMARSIARELSKANVTANVVAPGYIDTDM---TRALDERIQQGALQFIPAKRVGTPAEVAGV
FABG_RICPR      CASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDM---TDKLNEKQREAIVQKIPLGTYGIPEDVAYA
NODG_AZOBR      SAAKAGVIGFTKALAAELATKGVTVNAIAPGYIGTDMVMAIR---EDIRQAITDSVPMKRLGRPDEIGGA
FABG_VIBCH      XXXXXXVIGFTKSMAREVASRGVTVNTVAPGFIETDM---TKALNDEQRTATLAQVPAGRLGDPREIASA
FABG_BACSU      VAAKAGVIGLTKSSAKELASRNITVNAIAPGFISTDM---TDKLAKDVQDEMLKQIPLARFGEPSDVSSV
FIXR_BRAJA      ATSKAALASLTRELAHDYAPHGIRVNAIAPGEIRTDM------LSPDAEARVVASIPLRRVGTPDEVAKV
FABG_CHLMU      AAAKAGIIGFSKALSKEVGSKNIRVNCIAPGFIDTDM---TKGLSDNLKNEWLKGVPLGRVGTPEEIAMA
FABG_CHLTR      AAAKAGIIGFSKALSKEVGSKNIRVNCIAPGFIDTDM---TKSLNDNLKNEWLKGVPLGRVGMPEEIAKA
FABG_STAES      VATKAGVIGLTKTAARELASRGITVNAVAPGFIVSDM---TNALSDDLKDQMLEQIPLKRFGEDTDIANT
FABG_STAEQ      VATKAGVIGLTKTAARELASRGITVNAVAPGFIVSDM---TNALSDDLKDQMLEQIPLKRFGEDTDIANT
FABG_AQUAE      STTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDM---TAVLSEEIKQKYKEQIPLGRFGSPEEVANV
YXJF_BACSU      NSAKHGVIGLTKVGALEGAPHGITVNALCPGYVDTQLVRKTRPYDSVLEQVIFPLVPQKRLLSVKEIADY
FABG_BUCAI      SASKSGLIGFHKSLALEVASKGITVNIVSPGLIKTNF---TEKLNSIQYQKYLSNIPMKRFGQKEEVADA
BACC2_BACSU     NASKGGVLQLTRSMAVDYAKHNIRVNCVCPGIIDTPLNEKSNNEGTLEEKEKAKVNPLLRLGKPEEIANV
DCXR_BOVIN      CSTKGALDTLTKVMAVELGPHKIRVNAVNPTVVMTPMGQAAWS-DPQKAKAMLDRIPLGRFAEVENVVDT
LVR_LEIAQ       AAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVENSMKQLDPENEEFIQVNPSKRYGEAPEIAAV
FABG_SALTY      XXXXXXLIGFSKSLAREVASRGITVNVVAPGFIETDM---TRALSDDQRAGILAQVPAGRLGGAQEIASA
FABG_SALTI      XXXXXXLIGFSKSLAREVASRGITVNVVAPGFIETDM---TRALSDDQRAGILAQVPAGRLGGAQEIASA
FABG_RICTY      CASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDM---TDKLNEKQREAIVQKIPLGTYGIPEDVAYA
DHRS4_RABIT     NVSKTALVGLTKNLALELAAQNIRVNCLAPGLIKTS-FSKALWEDKAQEENIIQKLRIRRLGKPEECAGI
DCXR_MOUSE      CSTKGALDMLTKMMALELGPHKIRVNAVNPTVVMTPMGR-TNWSDPHKAKAMLDRIPLGKFAEVENVVDT
PHBB_RHIME      SAAKAGDLGLTKALAQEGAAKGITVNAICPGYIGTEMVRAVPEKVLNER--IIPQIPVGRLGEPEEVARC
NODG_RHIS3      CASKAGMIGFSKSLAQEIATRNITVNCVAPGFIESAM---TDKLNDKQKEAIMAAIPTRRMGTSVEVASA
DCXR_RAT        CSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTPMGRANWS-DPHKAKVMLDRIPLGKFAEVENVVDT
BUDC_KLEPN      SSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIKPLGYG-TAEFAKRITLGRLSEPEDVAAC
FABG_STAAW      VATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDM---TDALSDELKEQMLTQIPLARFGQDTDIANT
FABG_STAAS      VATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDM---TDALSDELKEQMLTQIPLARFGQDTDIANT
FABG_STAAR      VATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDM---TDALSDELKEQMLTQIPLARFGQDTDIANT
FABG_STAAN      VATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDM---TDALSDELKEQMLTQIPLARFGQDTDIANT
FABG_STAAM      VATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDM---TDALSDELKEQMLTQIPLARFGQDTDIANT
FABG_STAAC      VATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDM---TDALSDELKEQMLTQIPLARFGQDTDIANT
DCXR_CAEEL      CASKAALDMVTRCLANELGSQNIRVNSVNPTVVMTDMGRDNWS-DPDKKKKMLDRMPIKRFAEVDEVVNA
FABG_RICBR      CASKAGLIGMTKSLAYEVATRGITVNAVAPGFIKSDM---TDKLNDEQKEAITRKIPKGTYGMPEDIANA
DCXR_CAVPO      CSTKGALYMLTKMMALELGPHKIRVNAVNPTVVMTPMGR-TNWSDPHKAKAMLDRIPLGKFAEVENVVDT
BACC_BACSU      NASKGGVLQLTKSMAVDYAKHQIRVNCVCPGIIDTPLNEKSNNEGTLEEKEKAKVNPLLRLGKPEEIANV
PHAB_ACISR      SASKAGIIGFTKALAQEGARSNICVNVVAPGYTATPMVTAMR---EDVIKSIEAQIPLQRLAAPAEIAAA
KDUD_DICD3      TASKKRVMGITRIVANEWAKHNINVNAIAPGYMATNNTQHVRA-DQDRSKEILDRIPAGRWGLPQDLQGP
CMTB_PSEPU      NAAKGGMHGLTTGLAREFARQGVTVNTVAPCAVNTEVWVRIKNANPELAQRFLDVIPMGRVGEIEEVASM
CMTB_PSEP1      NAAKGGMHGLTTGLAREFARQGVTVNTVAPCAVNTEVWVRIKNANPELAQRFLDVIPMGRVGEIEEVASM
CBR4_DANRE      SASKAGLEGFTRSLAKEVASRNIRVNLVAPGLIHTDM-----TAGLAEEAAV-RTIPLGRFGEPAEVAQA
TRNH_DATST      AASKGAINQVTKSLACEWAKDSIRVNAVAPWIINTPIIEAACQVPSQKKESLIGRAPMKRAGEPSEVSSL
TRN2_HYONI      GATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSMVEMT--IQDPEQKENLDKLALRRMGEPKELAAV
TRN2_DATST      GATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMT--IQDPEQKELIDRCALRRMGEPKELAAM
DCXR_MESAU      CSTKGALDMLTKMMALELGPHKIRVNAVNPTVVMTSMGR-TNWSDPHKAKVMLDRIPLGKFAEVENVVDA
BACC_BACAM      NASKGGVLQTDAFYRPSIAKHNIRVNCVCPGIIDTPLNEKSNNEGTLEEKEKAKVNPLLRLGKPEEIANV
Y325_THEMA      SVSKAALLGLTRSLAVDYVDYGIRVNAVCPGTTQSELMARVKASPNPEEKKMTSRIPMKRLGKXXXXXXX
FABG1_SYNY3     SAAKAGVIGFTKTVAKELASRGVTVNAVAPGFIATDMTE------NLNAEPILQFIPLARYGQPEEVAGT
PHBB_ZOORA      SAAKAGDLGFTKALAQEGAAKGITVNAICPGYIGTEMVRAIPEKVLNER--IIPQIPVGRLGEPDEIARI
PHAB_PARDE      SAAKAGDLGFTKALAQEGARAGITVNAICPGYIGTEMVRAIDEKVLNE--GIIPQIPVAAWAEPEEIARC
YOHF_ECOLI      TAAKHALGGLTKAMALELVRHKILVNAVAPGAIAT-------PMNGMDDSDVKPSIPLRRFGATHEIASL
YMFI_BACSU      SMAKGAQHSFVKGLAKELAPSGIRVNAVAPGAVDTNMMNQFTP---AEKEEIADEIPIGRLARPQEIADA
TRN1_DATST      SASKGAINQMTKSLACEWAKDNIRVNSVAPGVILTPLVEKKNPHQKEEIDNFIVKTPMGRAGKPQEVSAL
FABG3_BRANA     AAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDM---TAKLGEDMEKKILGTIPLGRYGQPEDVAGL
FABG1_BRANA     AAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDM---TAKLGEDMEKKILGTIPLGRYGQPEDVAGL
DHG2_BACME      AASKGGMKLMTETLALEYAPKGIRVNNIGPGAIDTPI--NAEKFADPEQRADVESIPMGYIGKPEEIASV
FABG2_BRANA     AAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDM---TAKLGEDMEKKILGTIPLGRYGQPEDVAGL
CBR4_XENTR      GASKEGLIGFSKSLAKEVAKRNIRVNVVAPGFIHTDMTL------GLEEDSLTKMVPLGRFGDPEEVAQS
FABG2_SYNY3     SATKAGVIGMMKSLAREGARYGVRANAVAPGFIDTEM---TLAIREDIREKITKEIPFRRFGKPEEIAWA
YVRD_BACSU      SMTKTALISLSRGMAEMTKGTNVTVNSVLPGPTWTEMEGAAQAAGQDTDTFIKDYFKIQRYATAEEVANT
FABG_CHLPN      AAAKAGIIAFTKSLAKEVAARNIRVNCLAPGFIETDM---TSVLNDNLKAEWLKSIPLGRAGTPEDVARV
PHBB_CHRVI      SAAKAGMHGFTMALAQEGASKGVTVNTISPGYVETAM---TLAMNDDVRNSIISGIPMRRMAQPNEIAAA
KDUD_BACSU      TASKHAVAGLTKSFANEWAASGIQVNAIAPGYIST---ANTKPIRDDEKRDILKRIPAGRWGQADDIGGT
BDH2_MOUSE      SATKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQQARDNPKEALKTFLNRQKTGRFASAEEVALL
LINC_PSEPA      VGAKHAVVGLTRVAAADYGKHGIRVNALVPGAVRTPMLQRAMDNDAGLEPYLNSIHPIGRFSEPHEQAQA
KDUD_ECOLI      TASKSGVMGVTRLMANEWAKHNINVNAIAPGYMATN---NTQQLRADEQREILDRIPAGRWGLPSDLMGP
GRDH_ORYSJ      TATKGAIVAFTRALALQLAEEGIRVNGVAPGPIWTPLI----PASFAEEKQFGSQVPMGRAGQPSEVAPS
CPNA_COMTE      EASKGAVRLFTKACAVDLAPFNIRVNSVHPGVIATPMTQQILDAPQS-ARALLGPTLLGRAAQPMEVSQA
CPNA_COMS9      EASKGAVRLFTKACAVDLAPFNIRVNSVHPGVIATPMTQQILDAPQS-ARALLGPTLLGRAAQPMEVSQA
YJDA_BACSU      AATKGAISAFTRSLSQELAPLGITVNAVNPGPTDSTWM-------TDEIRNFLSKFPMGRIGTPDDAARM
Y4VI_RHISN      AASKAGLISITKSLACRWASRGIRVTAVAPGHVRTPMVAELERAGKLDVSAIRRRVPLGRIARPDEIARA
BDHA_RHIME      VAAKHGIMGLTKTVALEVAESGVTVNSICPGYVLTPLVEKARTRGITEEQVILKGQPTKKFITVEQVASL
YKVO_BACSU      GASKAALRALVRNWILDLKGTEIRVNVVSPGGILTPAYDEL--FGDALE-EVLETVPAGKVGTPEEVANA
PHBB_RALEH      STAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIR-------QDVLDTIPVKRLGLPEEIASI
YLX6_SCHPO      SAAKAGLENLTKALAVRYGPLGIRVNVCAPGPAWDERFKKHPDVGDRMKRWY----PVGRLGTPEDVARA
YHXC_BACSU      SATKGAIVTFTRSLSQSLVQQGIRVNAVAPGPIWTPLIPAS---FAAKDVEVFGSVPMERPGQPVEVAPS
YGFF_ECOLI      AASKGAIDTLTTGLSLEVAAQGIRVNCVRPGFIYTEMHASGGEPGRVDR--VKSNIPMQRGGQAEEVAQA
FABG5_BRANA     AAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDM---TAKLGEDMEKKILGTIPLGRYGQPEYVAGL
FABG4_BRANA     AAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDM---TAKLGEDMEKKILGTIPLGRYGQPEDVAGL
DECR_MOUSE      SSAKSGVEAMNKSLAAEWGRYGMRFNIIQPGPIKTKAFSRLDPTGRFE-KEMIDRIPCGRLGTMEELANL
HDHA_ECOLI      ASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSV--ITPEIEQKMLQHTPIRRLGQPQDIANA
HDHA_ECO57      ASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSV--ITPEIEQKMLQHTPIRRLGQPQDIANA
HDHA_CLOSO      GVSKSGVNNITKQIAIQYAKYGIRCNAVLPGLIATDAAMNSMP--DEFRKSFLSHVPLNRIGNPEDIANS
DHKR_STRCM      SASKHGVVGFTKALGNELAPTGITVNAVCPGYVETPMAQRVRAAYDTTEEAILTKIPLGRYSTPEEVAGL
BUTA_STAAW      CSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIA-VATAEEEQFTSQIALGRVSQPEDVSNV
BUTA_STAAS      CSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIA-VATAEEEQFTSQIALGRVSQPEDVSNV
BUTA_STAAR      CSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIA-VATAEEEQFTSQIALGRVSQPEDVSNV
BUTA_STAAN      CSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIA-VATAEEEQFTSQIALGRVSQPEDVSNV
BUTA_STAAM      CSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIA-VATAEEEQFTSQIALGRVSQPEDVSNV
BUTA_STAAC      CSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIA-VATAEEEQFTSQIALGRVSQPEDVSNV
UCPA_ECOLI      ALTKAAIVGLTKSLAVEYAQSGIRVNAICPGPMAESIARQSNPEDESVLTEMAKAIPMRRLADPLEVGEL
DHRS4_BOVIN     NVSKTALLGLTKNLALELAESNVRVNCLAPGLIRTS-FSRVLWEDPARQESIKATFQIKRIGKPEECAGI
DHR11_HUMAN     SATKYAVTALTEGLRQELAQTHIRATCISPGVVETQFAFK---LHDKDPEKAAATYEQMKCLKPEDVAEA
ACT3_STRCO      SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVRDIWEVSTEEAFDRIPIGRYVQPSEVAEM
PECR_PONAB      GAARAGVYNLTKSLALEWACSGVRINCVAPGVIYSQTVENYGSYGQSFFEESFQKIPAKRIGVPEEVSSV
FADH_BACSU      XXXXXXXLSLTRTLAVEWSKYGIRTNAIAPGPIERKLFESEKAMART-----MNSVPLGRLGTPEEIAAL
FABG_RICFE      CASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDM---TDKLNEKQREAIVQKIPLGTYGMPEDVANA
DECR_RAT        SSAKSGVEAMNKSLAAEWGRYGMRFNIIQPGPIKTKAFSRLDPTGKFE-KDMIERIPCGRLGTVEELANL
Y1385_MYCBO     SAAKAGIVGMTKAAAKELAHLGIRVNAIAPGLIRSAM---TEAMPQRIWDQKLAEVPMGRAGEPSEVASV
Y1350_MYCTU     SAAKAGIVGMTKAAAKELAHLGIRVNAIAPGLIRSAM---TEAMPQRIWDQKLAEVPMGRAGEPSEVASV
UCPA_ECO57      ALTKAAIVGLTKSLAVEYAQSGIRVNAICPGPMAESIARQSNPEDESVLTEMAKAIPLRRLADPLEVGEL
BDH2_BOVIN      STTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARPNPEEALSDFLKRQKTGRAEEVALL
NODG_RHIME      CASKAGMIGFSKSLAQEIATRNITVNCVAPGFIESAM---TDKLNHKQKEKIMVAIPIHRMGTGTEVASA
GNO_GLUOX       TATKGAVKNLTKGMATDWGRHGLQINGLAPGYFATEMTE--RLVADEEFTDWLKRTPAGRWGQVEELVGA
UCPA_SALTY      ALSKAAIVGLTKSLAVEYAQSGIRVNAICPGPMAESIARQSNPDDESVLTEMAKAIPLRRLADPLEVGEL
UCPA_SALTI      ALSKAAIVGLTKSLAVEYAQSGIRVNAICPGPMAESIARQSNPDDESVLTEMAKAIPLRRLADPLEVGEL
DER_CHICK       CSTKSALDMLSKVMAMELGPHKIRVNTVNPTVVMTDMGR----INWSDPQKMINRIPLGKFAEVDDVVNS
YXBG_BACSU      NAAKGGITNLTKAMAIDYARNGIRVNSISPGTIETPLIDK---LAGTKEQEMGEQFPLGRLGQPKEMATV
YHDF_BACSU      SSTKGAIVSFTRSMAKSLADKGIRVNAVAPGPIWTPLIPATFP-EEKVKQHGLDT-PMGRPGQPVEHAGA
IDNO_ECOLI      AASKGAVKMLTRGMCVELARHNIQVNGIAPGYFKTEM---TKALVEDETAWLCKRTPAARWGDPQELIGA
IDNO_ECOL6      AASKGAVKMLTRGMCVELARHNIQVNGIAPGYFKTEM---TKALVEDETAWLCKRTPAARWGDPQELIGA
FABG_ACTAC      XXXXXXXXXXXXXLAVELAKRKITVNCVAPGLIDTDILDENVPID-----EILKMIPAGRMGDPEEVAHA
CBR2_MOUSE      SSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGKK---VSADPERKLKERHPLRKFAEVEDVVNS
BAIA1_EUBSP     PTSKAGVIGLTHGLGREIIRKNIRVVGVAPGVVDTDM---TKGLPPEILEDYLKTLPMKRMLKPEEIANV
PECR_HUMAN      GAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTVENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSV
DCXR_HUMAN      CSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWS-DPHKAKTMLNRIPLGKFAEVEHVVNA
DHG_BACSU       AASKGGIKLMTETLALEYAPKGIRVNNIGPGAINTPI-NAEKFADPKQKADVESMIPMGYIGEPEEIAAV
BDH2_HUMAN      STTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTSLQERIQARGNPEENDFLKRQKTGRFATAEEIAML
DHR11_MOUSE     SATKYAVTALTEGLRQELAQTHIRATCISPGLVETQFAFKLHDKDPGEAAATYEHIKCLR---PEDVAEA
CBR4_XENLA      GASKEGLIGFSKSLAKEVAKRNIRVNVVAPG------FIRTDMTSDLKEDSLNKMIPLGRFGEPEEVAQS
FABG_RICCN      CASKAGLIGMTKSLSYEVATRGITVNTVAPGFIKSDM---TDKLNEKQREAIVQKIPLGTYGMPEDVAHA
HCDS_XANP2      CAAKGAVVNLTRQMAADYSGRGIRVNVVCPGTVGTDMGRQLLGTDCDPELEALAKYPMGRFGTPEDIAEA
FABL_BACSU      GVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDAL-KHFPNREDLLEDARQNTPAGRMVEIKDMVDT
SORD_KLEPN      AATKAALNSFTRSWSKELGKYGIRVVGVAPGPEYEEALAWTRNITVEQLRETKNAIPIGRAGKLSEVADF
PECR_RAT        GAARAGVYNLTKTMALTWASSGVRINCVAPGTIYSQTVDNYGELGQTMFEMAFENIPAKRVGLPEEISPL
PECR_MOUSE      GAAREGVYNLTKSMALAWASSGVRINCVAPGTIYSQTVDNYGEMGQTLFEMAFDSIPAKRLGVPEEISPL
CBR2_PIG        SSTKGAMTMLTKSMAMELGPHKIRVNSVNPTVVLTAM---GRSVTSDPERKLKERHPMRKFAEVEDVVNS
DHRS4_RAT       NVSKTALLGLTKNFAAELAPKNIRVNCLAPGLIKTH-FSSVLWKEKAREEMIKETMQIRRLGKPEDCVGI
DECR_HUMAN      ASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKAFSRLDPTGTFE-KEMIGRIPCGRLGTVEELANL
YGCW_ECOLI      SATKHALAGFTKAYCDELGQYNIQVNGIAPGYYATDITLATRSNPETNQR-VLDHIPANRWGDTQDLMGA
HCDR_XANP2      TTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMWRLDQP---ELRDQVLARIPQKEIGTAAQVADA
DHR11_BOVIN     SATKYAVTALTEGLRQELARSHIRATCISPGVVETQFAFK---LHDKDPEKAAATYEHMKCLKPEDVAEA
BAIA2_EUBSP     PASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTDMTNGNPP---EIMEGYLKALPMKRMLEPEEIANV
DHB8_HUMAN      AASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPM---TQKVPQKVVDKITEMIPMGHLGDPEDVADV
CBR4_MOUSE      SATKGGLVGFSRSLAKEVARKKIRVNVVAPGFIRTDMTRHLK------EEHFKKNIPLGRFGETLEVAHA
CBR4_BOVIN      SASKGGLVGFSRALAKEVAKKKIRVNVVAPGFIHTDMTK------DLNEELLKKNIPLGRFGDALDVAQA
FABG_ARATH      AAAKGGVISFSKTAAREGASRNINVNVVCPGFIASDM---TAELGEDMEKKILGTIPLGRYGKAEEVAGL
BUTA_STAEQ      SATKHSVRSFTQTAAKELADKGITVNAYCPGVAKTEMWDRIEMVKLDDSLEIGDAIKLGRYQEPSDVANL
DHRS4_MOUSE     NVSKTALLGLTKNFAAELAPKNIRVNCLAPGLIKTR-FSSVLWEEKAREDFIKEAMQIRRLGKPEDCAGI
GRDH2_ARATH     TATKGAIVSFTRGLALQLAPKGIRVNGVAPGPVWTPLI----PASFSEEKQFGSETPMKRAAQPVEVAPS
DHB8_CANFA      AASKAGVIGLTQTAARELGRHGIRCNSVLPGFITTPM---TQKVPQKVLDKVIGMIPMGHLGDPEDVADA
Y3106_PSEAE     AASKXXXXXXXXXXXXXXXP-DIRVNALSPGWIDTRAEREAAPLTELDHDQHL----VGRVGTVEDVASL
GRDH1_ARATH     TATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLI----PASFNEEKNFGSEVPMKRAGQPIEVAPS
DHRS4_PIG       NVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKTN-FSQVLWMDKARKEYMKESLRIRRLGNPEDCAGI
BDHA_RALEH      VAAKHGIVGFTKVTALETAQTGVTANAICPGWVLTPLVQKQIPVEQAKRELVLEKQPSGQFVTPDELGAL
Y4LA_RHISN      AVSKAAMNMLSASLATQYGHAQIRCNAVAPGLIMTE--RLLAKLDKCMQRHLSRHQLLPRVGHPEDVAAL
Y2146_BRAJA     AASKAAMNMLSSSLATQYGHAQIRCNAVAPGLIMTE--RLLAKLDACMQTHLRRHQLLPRVGRPEDVAAL
GS39_BACSU      TATKGAINAFTRTMAQALVKDGIRVNAVAPGPIWTPLIPATFP--EETVAQFGQDTPMGRPGQPVEHVGC
DHGB_BACME      AASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPI--NAEKFADPEQRADVESIPMGYIGEPEEIAA-
MTDH_AGABI      NSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTD---QTAHMDKKIRDHQASNIPLNRFAQPEEMTGQ
BUTA_STAES      SATKHSVRSFTQTAAKELADKGITVNAYCPGVAKTEMWDRIEMVKLDDSLEIGDAIKLGRYQEPSDVANL
YAY8_SCHPO      TSTKGAITAFTRGLSNQYAQHGIRVNAVAPGPIYTPLVSSTFP---KEKIELSDQVPLGRMGQPVEVASC
VER1_ASPPA      SGSKGAIDTFVRCMAIDCGDKKITVNAVAPGAIKTDMFREYIPNGETFTDEQVDECPLNRVGLPVDVARV
T4HR_MAGGR      SGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYREYIPNGENLSNEEVDEYPLHRVGLPIDIARV
HSD_STREX       GASKWGVRGLSKLAAVELGTDRIRVNSVHPGMTYTPMTAET---GIRQGEGNYPNTPMGRVGEPGEIAGA
BEND_ACIAD      SASKGGVNALTASLAFEHAQHGIRVNAVATGGTKAKIPRNAQPLSKSEQDQTIDRSFLGRYGSIDEQVNA
Y019_THEMA      SASKGGLVALTHSLAVSLSRYHIRVVSISPGWIETSEWKK-KSLRKKPDLRPIDQHPAGRVGNPLDIAHL
GRDH_DAUCA      TATKGAIVAFTRGLSLQLISKGIRVNGVAPGPVWTPLIPSS--FDEEEVKQFGSEVPMKRAGQPYEIATA
FABG6_BRANA     AAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASEM---TAKLGEDMEKKILGTIPLGRYGQPEDVAGL
DHR11_CHICK     SATKYAVTALTEGLRQELAKTHIRATCISPGLVETGFAFK---LHDNDPERAAATYESIRCLKAEDMANA
PECR_CAVPO      GAARGGVYNLTKSLALGWARSGIRINCVAPGTVYSQTAMDNYDMGKTLFADAFQKIPAKRLGVPEEVSSL
VIBA_VIBCH      GASKAALHMLVKCIGMELAPYGIRCNLVSPGSTRTAMQQQTEQYGEAQAAQFRLGIPLNKIAEPADIAQA
RHLG_PSEAE      APSKAALHQLSRMLAKELVGEHINVNVIAPGRFPS---RMTRHIANDPQALEADSIPMGRWGRPEEMAAL
NOG4_RHIME      CASKAGMIGFSKSWRRRSTR-NITVNCVAPGFIESAM---TDKLNHKQKEKIMVAIPIHRMGTGTEVASA
STCU_EMENI      SGSKGAIDTFVRCLAIDCGDKKITVNAVAPGAIKTDMFREYIPNGETFTDEQVDECPLNRVGLPVDVARV
DECR2_DANRE     GSAKAANDAMTRHLAVEWGPSGVRVNTVAPGPISTEGYRR---LGGSETAGAFHSIPLQRAGNKTEMAHA
ENTA_ECOLI      GXXXXXXXXXXXXVGLELAGSGVRCNVVSPGSTDTDMQRTLWVSDDAEEQRIRGGIPLGKIARPQEIANT
DHK1_STRVN      SASKHGVVGLTKALGLELARTGITVNAVCPGFVETPMAERVREIWQVSEEETFDRIPLGRYVETREVAAM
CBR4_HUMAN      SASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLK------EEHLKKNIPLGRFGETIEVAHA
ARDH_PICST      NMSKAGVIHLVRSLACEWAKYNIRVNTLSPGYILTPLTRNVIS-GHTEMKEAWESIPMKRMAEPKEFVGS
CBR4_RAT        SATKGGLIGFSRSLAKEVARKKIRVNVVAPGFIHTDMTKHLK------EEHFKKNIPLGRFGEALEVAHA
SPS19_YEAST     GAAKAGIDALAKNLAVELGPLGIRSNCIAPGAIDNTEGLK-RLAGKKYKEKALAKIPLQRLGSTRDIAES
DHGA_BACME      AASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPI--NAEKFADPEQRADVESIPMGYIGKPEEVXXX
Y2478_STAAM     SATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAAYNP----SDRKKLD---------PQDIAEA
Y2266_STAAN     SATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAAYNP----SDRKKLD---------PQDIAEA
Y182_METEA      SGTKGALNAISGVLANELAPRKIRVNVVSPGYVVTEGTHTAGIAGSEMEAGLVAQTPLGRSGQPDDIAGV
DHG3_BACME      AASKGGMKQMTETLALEYAPKGIRVNNIGPGAMNTPI-NAEKFADPVQRADVESMIPMGYIGKPEEVXXX
DHG4_BACME      AASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPI-NAEKFADPVQRADVESMIPMGYIGKPEEVXXX
Y2778_STAA8     SATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAI---TAAYNPTDRKKL----------EPQDIAEA
Y2488_STAAC     SATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAI---TAAYNPTDRKKL----------EPQDIAEA
Y2422_STAA3     SATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAI---TAAYNPTDRKKL----------EPQDIAEA
Y2403_STAAW     SATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAAYNP----SDRKKLD---------PQDIAEA
Y2370_STAAS     SATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAAYNP----SDRKKLD---------PQDIAEA
Y048_HAEIN      SGAKAAISNFTQWLAVYFSKVGIRCNAIAPGFLNLALLFDTEGKPTDRANKILTNTPMGRFGESEELLGA
DHB14_HUMAN     VATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELMPDPRATIREGMLAQPLGRMGQPAEVGAA
DHBA_BACSU      XXXXXXXVMFTKCLGLELAEYNIRCNIVSPGSTETDMQWSLWADENGAEQVIKGSIPLKKLAKPSDIADA
TRNH1_ARATH     XXTKGALNQLARNLACEWASDGIRANAVAPAVIATPLAEAV--YDDEFKKVVISRKPLGRFGEPEEVSSL
DHSO_RHOSH      CATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEKFADYENLPRGEKKQVGAAVPFGRMGRAEDLTGM
BUDC_KLETE      SSSKFAVRGLTQTAARDLAPLGITVNGFCPGIVKTPMW--------------------------------
ARDH_CANTR      NMSKAGVIHLARSLACEWAKYNIRVNTLSPGYILTPLTRNVISGHTEMKTEWESKIPMKRMAEPKEFVGS
Y2567_STAAR     SATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAI---TATYNPTDRKKL----------EPQDIAEA
ARDH_CANAL      NMSKAGVIHLARSLACEWAKYNIRVNTLSPGYILTPLTRNVISGHTEMKTEWESKIPMKRMAEPKEFVGS
SDR1_PICAB      TASKAAVEMMTRILAQELRGTQITANCVAPGPVATDMFFAGKSEAAVEAG--VKSNPFERLGKVEDVAPL
RDH8_HUMAN      AASKFALEGFFESLAIQLLQFNIFISLVEPGPVVTE----------------------------------
MTDH_UROFA      NSSKAAVSNLGKCLAAEWAEKSIRVNMLSPGYVKTD---QTSHMDQKLRDFQADGVPLKRFAEPEEMAGQ
DHB8_RAT        ASSKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPM---TQKMPEKVKDKVTAMIPLGHMGDPEDVADV
DHB8_PIG        AASKAGVIGLTQAVARELGRYRIRCNSVLPGFIKTPMAQK---VPQKVLDKVVGMIPMGHLGGPPDVADV
DECR2_PONAB     GSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISTEGLRRLGGPQASLSTKVTAS-PLQRLGNKTEIAHS
DECR2_HUMAN     GSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISTEGLRRLGGPQASLSTKVTAS-PLQRLGNKTEIAHS
UXUB_BACSU      SAAKASINNFTMWMAVHFAETGLRVNAIAPGKQNHDLLINQDGTFTSRSHKIIAGTPMKRFGKPEDLLGT
DHMA_FLAS1      ----------TRAMAVDLARHGILVNMIAPGPVDVT----GNNTGYSEPRQVLDEVALGRPGLPEEVATA
NAHB_PSEU8      IASKHAVLGMVKALAYELAPE-VRVNAVSPGGTVTSL---CGPASAGFDKMHMKDMPLTPLGKPEDVVAP
NAHB_PSEPU      IASKHAVLGMVKALAYELAPE-VRVNAVSPGGTVTSLFDKMHMKDMPGIDDMIKGLPLGFAAKPEDVVAP
DHB8_MOUSE      ASSKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPM---TQKMPEKVKDKVTAMIPLGHMGDPEDVADV
XYLL_PSEPU      GAAKGGVNALTACLAFETAERGIRVNATAPGGTEARHGGFRNSAEPSEQEKVLDSSLMKRYGSIDEQVEA
SOU1_SCHPO      HATKAAVKHLARALAVEWAPFAR-VNSVSPGYIDTDL---TLYADENLRKKWKEYTPQARIGLPDELPGA
Y2049_STAEQ     GATKAAIHAITQSLEKELARTGVKVTSISPGMVDTPMTEGT-----------------------------
Y2036_STAES     GATKAAIHAITQSLEKELARTGVKVTSISPGMVDTPMTEGT-----------------------------
YXEK_CAEEL      AVSKAGVENMTKSLASEWAKHGLRFNAIAPGPIPTEAFGR---LFAGELKDSGDSVPVGRLGHPEEIANL
DHB8_CALJA      AASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPM---TQKVPQKVMNKITGMIPMGHLGDPEDVADV
YWFH_BACSU      SMMNAALINASKNISIQLAPHNITVNCLNPGFIATDVMKKNSISKQKAEEQIASGIPMKRVGXXXXXXXX
YQJQ_BACSU      SATKHAVLGYSNALRMELSGTGIYVTTVNPGPIQTDFF--------------------------------
Y0419_STAS1     SASKAAVHSITQGLEKELAKTGVRVTSISPGMVDTPL---------------------------------
YVX3_CAEEL      AVSKAGVEIMTKSLATEWSKYGLRFNAVSPGPIPTKLF--SGEMGDVAEK-MKELNPEGRSGTPEEVANL
YVAG_BACSU      SATKTMQLSISRSLAELATGTNVTVNTVMPGSTLTEMLNSLYPVQEAEARFMKENRPIQRLIRPEEIAHF
Y4MP_RHISN      SXXXXXXXXXXXXXXREFGPDSIRVNCVTPGLIQTDITGDK--LSAEMRADIVKGIPLSRLGDARDVANI
LINX_PSEPA      CATKAAVRIMSKAAALEFVDRGVRVNTIVPGGMNTPITANVPP---DVLKQQTSQIPMGKLGDPIDIANG
FABG_SCHPO      AASKAGLESFTKVLAAEVASKGIRVNAISPGYVDT-------PMLSSQIRAIAEKVPIGRLASTDEIVDA
DECR2_RAT       GAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISTEGLRRLGGPKASSKFKYLSS-PIPRLGTKTEIAHS
YBBO_ECOLI      AASKYALEAWSDALRMELRHSGIKVSLIEPGPIRT-----------------------------------
YBBO_ECOL6      AASKYALEAWSDALRMELRHSGIKVSLIEPGPIRT-----------------------------------
HSD_MYCTU       TATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPM--------TDWVPEDIFQTALGRAAEPVEVSNL
HSD_MYCBO       TATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPM--------TDWVPEDIFQTALGRAAEPVEVSNL
YWC4_CAEEL      AVSKAGVETMTKSLATEWSKYGLRFNAVSPGPIPTK--GAWGRLNSGEMGDIAEKMPEGRVGSPEEVANL
HCD2_RAT        SASKGGIVGMTLPIARDLAPIGIRVVTIAPGPLLTTLPDKVRNFLASQ-------VPFSRLGDPAEYAHL
VDLC_HELPY      SASKHALEAYSDALRLELKPFNVQVCLIEPGPVKSNWEKTAFSVENFESEDSL-----------------
DECR2_MOUSE     GAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISTEGLRRLRGSNASSKLKHFSN-PIPRLGTKTEIAHS
YGHA_ECOLI      AATKAAILNYSRGLAKQVAEKGIRVNIVAPGPIWTALQISG---GQTQDKQFGQQTPMKRAGQPAELAPV
YGHA_ECO57      AATKAAILNYSRGLAKQVAEKGIRVNIVAPGPIWTALQISG---GQTQDKQFGQQTPMKRAGQPAELAPV
YUXG_BACSU      SSVKALETHLARCIAAEGGEFGIRVNSVLPDAVLQSSWREERAAAYGIEPDQLEEHYRKRTALPEDIAEA
YJGI_ECOLI      XXXXXXLQGMARGLARDFGPRGITINVVQPGPIDTDANPANGPM-----RDMLHSLAIKRHGQPEEVAGM
FABI_NEIMB      GMAKASLEAGIRFTAACLGKEGIRCNGISAGPIKT-----LAASGIADFGKLLGHVPLRRNVTIEEVGNT
DRS7C_HUMAN     AASKHAALGFFDCLRAEVEEYDVVISTVSP----------------------------------------
BZRD_BACSU      CSSKAGLDMFTRTFGFEQEDEELPVNMISPGVMDTEM----QAVIRSSSKKDFHHIERFRLRSPDFIAGT
THR1_GLOLA      SGSKGTIETFVRCMAIDFGDKKITVNAVAPGGIKTDMYREYIPNGGELDDEGVDEFPMHRVGLPIDIARV
DRS7C_MOUSE     AASKHAVMGFFDCLRAEVEEYDVVVSTVSP----------------------------------------
DHRS4_PONAB     NVSXXXXXXXXXXXXIELAPRNIRVNCLAPGLIKTS-FSRMLWMDKEKEESMKETLRIRRLGEPEDCAGI
YR419_MIMIV     SACKAFIHSMTQTIATQSAKLGIRVNCIAPGPILTPL---EIPIFLPDKKNVFEGVPMKRTGTTNEISPT
SOU1_CANAL      NAAKAACTHLAKSLSVEWASFGARVNSISPGYILTDIADFADP---EMKKKWWQLTPLGREGLPQELVGA
PTMA_CAMCO      SVIKAGINHLGAWLAKELFNTNIRVNTLASGGIQANIFEKYRKCCAS--KGMLDA---------EDICGT
FABI_ANASP      GVAKAGLEASVRYLASELGSQNIRVNAISAGPI--------RTLASSAVGGILDMIPLRRTVTQLEVGNT
DHRS4_HUMAN     NVSXXXXXXXXXXXXIELAPRNIRVNCLAPGLIKTS-FSRMLWMDKEKEESMKETLRIRRLGEPEDCAGI
DHG2_BACSU      STSKGGIKMMTETLALNYADKGIRVNAIAPGTIATESNVDTKKEESRQKQ--LKKIPMKAFGKPXXXXXX
FOX2_NEUCR      SAAKLGMVGFTETLAKEGLKYNIISNVIA-------------PIAASRMTETVMPPDLLALMKPEWVVPL
FOX2_CANTR      ASAKSALLGFAETLAKEGAKYNIKANAIA-------------PLARSRMTESILPPPMLEKLGPEKVAPL
YM71_YEAST      CASKFAVGAFTDSLRKELINTKIRVILIAPGLVETE-FSLVRYRGNEEQAKNVDTTPLM----ADDVADL
SRLD_ECOLI      SAAKFGGVGLTQSLALDLAEYGITVHSLMLGNLKSPMFQSLLPQYATKEQYYIDKVPLKRGCDYQDVLNM
HCD2_DROME      SASKAAVVGMTLPIARDLSTQGIRICTIAPGLFNTPML---AALPEKVRTFLAKSIPFQRLGEPSEYAHL
FOX2_YEAST      SAAKMGLVGLAETLAKEGAKYNINVNSIAP----------------------------------------
YTKK_BACSU      GAAKVGLASLTKTIAIEEAEFGITANMVCPGDIVGDM--KEASIEEARMRIGKEKTPIGRSGTGEDIARI
YHXD_BACSU      AATKNAIIGFTVGLGKQLASKGIRVNSVAPGPIWTPL-----QISGGQPTENIPKFPLNRAGQPVELADV
VDLC_HELPJ      SASKHALEAYSDALRLELKPFNVQVCLIEPGPVKSN-WEKT----AFENDERKDSVYALEV---------
DHG1_BACME      AASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPI--NAEKFADPEQRADVESIPMGYIGEPXXXXXX
DHRS7_ANOGA     SASKHAMQAFCDSLRAEVAKDNIKVTLISPGYINTAL---------------------------------
DHG_BACME       AASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPI--NAEKFADPEQRADVESIPMGYIGEPXXXXXX
DHB1_RAT        CASKFALEGLCESLAILLPLFGVHVSLIECGAVHTAFHEK------------------------------
PTR1_LEITA      TMAKEALEGLTRSAALELASLQIRVNGVSPG---LSVLPDDMPF--SVQEDYRRKVPLQRNSSAEEVSDV
KDSR_BOVIN      SSSKFALRGLAEALQMEVKPYNVYVTVAYPPDTDTPGFAKENQTKPLETRLISET---TSVCKPEQVAKQ
DHB1_MOUSE      CASKFALEGLCESLAILLPLFGVHVSLIECGAVHTAFYEK------------------------------
MOAE_KLEAE      VTAKHALIGLMRSVARDYGPQGVRANAICPGWVTTPMAEEMHPLMQAEGQRVCRDVPLRRPASPEEIAQA
HETN_ANASP      SASKAGLIMWTDAMRQELVGTGVNISVVCPGYV-------------------------------------
DHB14_BOVIN     VATKGAVTAMTKALALDESQYGVRVNCISPGNIWTPLWEESTPDPTATIREGTLAQPLGRMGQP-XXXXX
KDSR_HUMAN      SASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFNRTKPLETRLISETTS------VCKPEQVAKQ
HCD2_HUMAN      SASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPL------LTSLPEKVLASQVPFSRLGDPAEYAHL
DHK2_STRVN      AVSNGGHRAQTRLLANTVGP-AVRVNAVAPGLIETPWTQNSDFFAPIAE-HVRQTTPLRRTGRPEDVAEA
PGDH_CAVPO      CASKHGIIGFTRSAAMKLMNSGVRMNAICPGFVNTSILQKEENMGPYIEGHIKDMMKCYGILDPEMIANG
HCD2_MOUSE      SASKGGIDGMTLPIARDLAPTGIRVVTIAPGPLLTTLPEKVRNFLASQ-------VPFSRLGDPAEYAHL
RIDH_KLEAE      TASKFAVQAFVHTTRRQVAQYGVRVGAVLPGPVVTAL------LDDWPKAKMDEALANGSLMQPIEVAES
FABI_BACSU      GVAKASLDASVKYLAADLGKENIRVNSISAGPIRT-LSAKGISDFNSILKDIEERAPLRRTTTPEEVGDT
DRS7C_BOVIN     AASKHAALGFFDCLRAEVEEYDVVVSTVSP----------------------------------------
YQC8_SCHPO      CASKAAVRQLCKALAVEWAEFAR-INSVSPGYFATDM------PGYEFLKQWEPYVPFKRLGLTPELRGT
DHRS2_HUMAN     NVSKXXXXXXXXXXXXXXXPKDIRVNCVVPGIIKTD-FSKVFHGNESLWKNFKEHHQLQRIGESEDCAGI
SDH_RHIRD       GGTKAFLRQFSLGLRSDLHGKGVRVTSIEPGMCETE-FTLVRTGGNQEASDNL-----------------
SDH_AGRT5       GGTKAFLRQFSLGLRSDLHGKGVRVTSIEPGMCETE-FTLVRTGGNQEASDNL-----------------
DHB4_HUMAN      SAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGS----RMTQTVMPEDLVEAL---------KPEYVAPL
KDSR_MOUSE      SSSKFAIRGLAEALQMEVKPYNVYVTVAYPPDTDTPGLNKTKPLETRLISET------TAICKPEQVAKQ
DHRS7_DROME     SASKHAMQAFADSLRAEVANKNINVSCVSPGYIRTQL---------------------------------
BZRD_BACCE      KAGVNMFTQCVATEEVE-KEYPVKIVAFAPGVVDTNMQAQIRETAKEDFTNLDRFIALKEEGKPEYVAKA
HCD2_BOVIN      SASKGGIVGMTLPIARDLAPMGIRVMTIA---XXXXXXXXXXXXXDKVRNFLASQVPFSRLGDPAEYAHL
DRS7C_XENTR     AASKHAIQGFFDCLRAEVEEFDVSVSTVSP----------------------------------------
YB45_SCHPO      CCSKAAINMLVMNLGSE--EPDIMSVAVRPGVVDTPMQVSIRNDSNKEAKELKTSGQLV---APQDIAKA
Y0585_STAHJ     SATKSAVLMIFNGLEKELAKTGIKTTSILPGMVDTPMTERSDFGG----RKKLD---------PENIADA
RDH8_BOVIN      AASKFAMEGFFESLAVQLLQFNIFISLVEPGPVVTE----------------------------------
DRS7B_MOUSE     SASKHATQAFFDCLRAEMEEANIKVTVISPGYIHTNL---------------------------------
ACR1_ACIAD      VASKAALDAFSRCLSAEVLKHKISITSIYMPLVRTPMIAPTKYVPTLSPEEAADLIVYAIVKRPKRIATH
PGDH_MOUSE      CASKHGIIGFTRSAAMNLMKSGVRLNVICPGFVDT-------PILESIEKE-------------------
Y4EL_RHISN      AATKAAVVSLTRSFAHAFAKDQVLINSVAPAGMATEKAKSLGFLG-----ELAAANPLGRAAEPAEIAEF
DHB4_RAT        SAAKLGLLGLANTLVIEGRKNNIHCNTIAPNAGS----RMTETVMPEDLVEAL---------KPEYVAPL
BPHB_PSEPU      TAAKHAVVGLVRELAFELAPY-VRVNGVGPGGINSDLRGPSKAISTVPLADMLKSVPIGRMPEAEETGAY
ACR1_ACIBI      VASKAALDAFSRCLSAEVLKHKISITSIYMPLVRTPMIAPTKYVPTLSPEEAADLIVYAIVKRPTRIATH
Y432_LISMO      GATKWAVRDLMEVLRMESAQEGTNIRTVTPAAINTELL---ETITDKETEQGMTSLYKQYGITPDRIASI
DHB4_MOUSE      SAAKLGILGLCNTLAIEGRKNNIHCNTIAPN------------AGSRMTETVLPE-DLVEALKPEYVAPL
FABI_BUCAP      GLAKSSLEANVRYMANSLGKNNIRVNAISSGPIKTTSSYQIKNFNKIQKIHKLFSLTKNHVSS-EEIGNV
DRS7B_XENTR     SASKHATQAFFDCLRAEMSPYEIDVTVVNPGYIKTNL-SLNAVTGDGSNYGVMDN-NTAEGRTPEEVAQT
DHB1_PANTR      CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKV--LGSPE--EVLD----------------
PTR1_LEIMA      TMAKGALEGLTRSAALELAPLQIRVNGVGPG---LSVLVDDMPPAVWEGHR--SKVPLQRDSSAAEVSDV
PGDH_MACFA      CASKHGIVGFTRSAALNLMNSGVRLNAICPGFVNTESIEKEENMGQYIEDHIKDMIKYYGILDPPLIANG
PGDH_HUMAN      CASKHGIVGFTRSAALNLMNSGVRLNAICPGFVNTESIEKEENMGQYIEDHIKDMIKYYGILDPPLIANG
FABI_HAEIN      CLAKASLEAATRVMAADLGKEGIRVNAISAGPI-----RTLAASGIKNFKKMLSTFALRRTVTIEDVGNS
TS2_MAIZE       TASKHAIVGLTKNAACELRAHGVRVNCVSPFGVATPMLINAWRQGSDQEVEKMEEVPTLR---PRDIAEA
LIMC_RHOER      SAAKHGVVGLMRSLALELAPHRVRVNSLHPTQVNTPMYRIFSPDLENPTRETTNALPIPWV-ESVDVSNA
FABI_HELPJ      MAAKAALESAVRYLAVDLGKHNIRVNALSAGPI-----RTLASSGIADFRMILKNAPLRKNVSLEEVGNA
DLTE_BACSU      CATKAALHSFSLTLRHQLRDTSVEVIEMAPPMVDTGLNQKSRDRGISSEEYVQYFLDGLKEGKQE-----
DHB1_HUMAN      CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKV--LGSPE--EVLD----------------
Y452_LISIN      GATKWAVRDLMEVLRMESAQEGIRTATIYPAAINTELL---ETITDKETEQGMTNLYKQYGVTPDRIASI
FABI_PSEAE      GMAKASLEAGVRYLAGSLGAEGTRVNAVSAGPIRTLAIKSFRKMLAANERQT----PLRRNVTIEEVGNA
YAEB_SCHPO      XXXXXXXXXXXNTLRIELAPFGVQVTSIMTGGVQTKI--QSKPLGTMTEAAI------------------
PGDH_BOVIN      CASKHGIVGFTRSAAMNLMNSGVRLNAICPGFVDT-------PILKSIEKE-------------------
FOLM_KLEP7      AASKAALDNMTRSFARKLAP-EVKVNAIAPSLIDDEAYR----------QQALDKSLMKIAPGEKEISDL
MFEA_DICDI      GSMKMALVGLSNTLAQEGKSKNIHCNTIAP-------IAASRLTESVMPPEILEQM------KPDYIVPL
FABI_SHIFL      GLAKASLEANVRYMANAMGPEGVRVNAISAGPI-----RTLAASGIKDFRKMLAHCPIRRTVTIEDVGNS
FABI_ECOLI      GLAKASLEANVRYMANAMGPEGVRVNAISAGPI-----RTLAASGIKDFRKMLAHCPIRRTVTIEDVGNS
FABI_ECO57      GLAKASLEANVRYMANAMGPEGVRVNAISAGPI-----RTLAASGIKDFRKMLAHCPIRRTVTIEDVGNS
DHB2_HUMAN      GSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNI-AGTSDKWEKLEKDILDHLP-------------
3BHD_COMTE      SXXXXXXXXXXXXXXXXCRKYAIRVNSIHPDGIYTPMMQASLPKGVSKEM-VLHDPKLNRAGRPERIAQL
YUSR_BACSU      AVSKSAVHGLTKSLAHALAPE-IRVSGVAPGAVATRWWA-----GREEKKSMIGSLLLQCIAEPDDVAKL
DHRS7_HUMAN     CASKHALRGFFNGLRTELATYGIIVSNICPGPVQSNIVENTKTIGNNGDQ--------------------
DCXR_TRIRE      NVAKAGCIHLARSLANEWRDFAR-VNSISPGYIDTGLSEKTQELWRS-------MIPMGRNGDAKELKGA
BPHB_BURXL      TAAKHAIVGLVRELAFELAPY-VRVNGVGSGGINSDLGMGSKAISTVPLADMLKSVPIGRMPEVEETGAY
MTDH_CLAHE      NVAKAGCIHMARSLANEWRDFAR-VNSISPGYIDTGL----SDFVPKETQQLWHSIPMGRDGLAKELKGA
INHA_MYCTU      TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT--LAMSAIVGGALGEEAGAQIQLLEEGWDQRVAKT
INHA_MYCBO      TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT--LAMSAIVGGALGEEAGAQIQLLEEGWDQRVAKT
FABI_SYNY3      GVAKAGLEMTVRYLAAELGPQNIRVNGISAGPI--------RTLASSAVGGILDMIPLKRTVTQTEVGNT
FABI_SALTY      GLAKASLEANVRYMANAMGPEGVRVNAISAGPI-----RTLAASGIKDFRKMLAHCPIRRTVTIEDVGNS
DHRS7_MOUSE     CASKHALRGFFNALHSELGQYGITFCNVYPGPVQSDIVK-------------------------------
DHB12_XENTR     SATKAFVDFFSRGLQAEYRSKGVTVQSVLPFYVATKLAKIRKPTWDKPSPETYVQSALNTVG--------
DHB12_ANAPL     SASKAFVDYFSRGLHAEYKSKGIIVQSVMPYYVATKMSKISKP---------------------------
DH12A_DANRE     SSTKAFVDFFSRGLQTEYKCKGIIIQSVLPFFVATKMTKIRKP---------------------------
YUSZ_BACSU      VSSKHALEGFSESLRIELLPFGIETALIEPGSYKTSIW--------------------------------
RDH10_XENTR     CASKFGVVGFHESLSHELKKDGIKTTLVCPYLVDTGMFR-----GCRIRKEIEPFLPPLK----------
BPHB_RHOGO      TGAKHAIVGMVKQLAYELGPH-IRVNGIAPGGLGGSDLRGLKALDLAEVSMLKDILPTGQMASAEETGAY
EPHD_MYCTU      CTSKAATYMFSDCLRAELDAAGVGLTTICPGVIDTNIVATTHAPGTDEEKGQIDKMFALRSYGPDKVADA
EPHD_MYCBO      CTSKAATYMFSDCLRAELDAAGVGLTTICPGVIDTNIVATTHAPGTDEEKGQIDKMFALRSYGPDKVADA
DRS7B_PONAB     AASKHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNL---------------------------------
DRS7B_HUMAN     AASKHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNL---------------------------------
FABI_AQUAE      GIAKAALESTVRYLAYDIAKHGHRINAISAGPVKTLAAYSITGFHLLME----HTTKVNPFGKPEDVGDT
DHB2_RAT        ASTKAAISMFSAVIRQELAKWGVKVVTIHPGGFQTNI------VGSQDEKEILD----------------
YL426_YEAST     XXXXXXXXXXXQSYSFELQNEGIRTLLVTPGQLNTEMFAGFKP---------------------------
YD114_YEAST     GASKGAMIGFHKSLSTECNKTGIKTLLVCPGKIKTNMF--------------------------------
Y4EK_RHISN      GATKAAVSLFSSALRCDLIGLPIRVTELFPGRVETNLYR-------------------------------
Y1627_STAS1     CGTKYAVRAITEGLRQEEAIVGIRTTILSPGAVSTEL---TDHISDKDMKQDIDELYKNAI-KPDAIARA
MKAR_ASPTN      SGSKAFLQQWSTSLGSELAPYGITVELV------------------------------------------
STDH2_CAEEL     SATKKYVEWLTGCLRKEYSHHGIIFQAITPAMVATKMAGNPNTSFFCPDSDTFARSALNTIGHASETTGY
DS7CA_DANRE     AASKHAVQAFFDCLRAEVEEFGISVSTIS-----------------------------------------
DRS7B_DANRE     AASKHAMQAYYDCLRAEVDSLGLHVSVLSPGYVRTNM---------------------------------
DHB12_MACFA     SATKTFVDFFSQCLHEEYRSKGIFVQSVLPYFVATKLAKIRKPTLDKPTPETFVKSAIKTVGLQSRIHVL
RD10B_XENLA     CASKFGVVGFHESLSHELKKDGIKTTLVCPYLVDTGMFR-----GCRIRKEIEPFLPPLK----------
YI78_SCHPO      YGTKYAIEGISEALTWEMQSIGVKVKIIEPGFTATE-FRVEEGAGNLKQKLYEDLLPKLKTATPPQKIAE
DH12A_XENLA     SATKAFVDFFSRGLHAEYRNKGINVQSVLPFYVATKLAKIRKP---------------------------
BPHB_PSEPS      TAAKQAIVGLVRELAFELAPY-VRVNGVGPGGMNSDLGMGSKAISTVPLADMLKSVPIGRMPEVEETGAY
RD10A_DANRE     CASKFGAIGFHESLSHEIEKDGIKMTLVCPYLVDTGMFR-----GCRIRKEIEPFLPPLR----------
DHB12_HUMAN     SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRIHAL
YQ53_SCHPO      NASKFAVEGLSQTIMRELPNWNIAITIVQPGGMQTE----------------------------------
YDFG_ECOL6      GATKAFVRQFSLNLRTDLHGTAVRVTDIEPGLVGGTEFSNVRFKGDDGKAE-------------------
RD10A_XENLA     CASKFGVVGFHESLSHEIKKDGIKTTLVCPYLVDTGMFR-----GCRIRKEIEPFLPPLK----------
FABI_RICBR      GVAKAALEASVRYLANDMGENNIRVNAISAGPIKT-LSGSVIGDFNSMLRSHAATAPLKRNTLQQDVAGA
YDFG_SHIFL      GATKAFVRQFSLNLRTDLHGTTVRVTDIEPGLVGGTEFSNVRFKGDDGKAE-------------------
SOU2_CANAL      NAAKAGVKHLSKSLSVEWAPFAR-VNSVSPGYIATHLSEFADP---DVKSKWLQLTPLGREAKPRELVGX
DHB2_MOUSE      AATKAALTMFSTIIRQELDKWGVKVVTIKPGGFKTNI-TGSQDIWDKMEKEILD----------------
DHB12_MOUSE     SATKAFVDFFSQCLHEEYKSKGIFVQSVMPYLVATKLAKIQKP---------------------------
BPHB_COMTE      TATKHAVVGLVRQMAFELAPH-VRVNGVAPGGMNTDLXXXXXXXXXVPLADMLKSVPIGRMPALEEYTGA
ABA2_ARATH      XXXKHAVLGLTRSVAAELGQHGIRVNCVSPYAVATKLALAHLP----EEERTEDAFVGFRNFAADDVANA
RD10B_DANRE     CASKFGAIGFHESLSHELKKDGIKMTLVCPFLVDTGMFE-----GCKIRKEMAPFFPPL---KPEYVKQA
MTDH_ALTAL      NVAKAGCIHLAKSLANEWRDFAR-VNSISPGYIDTGL---SDFVPQDIQKLWHSMIPMGRDAKATELKGA
HSDL1_CHICK     GASKAYLDYFSRALYYEYASKGIFVQSLTPFVIATRMVSCSR----------------------------
FABI1_RHIME     --AKAALEASVRYLAVDLGNRGIRVNAISAGPIKT-----LAASGIGDFRYILKNAPLKRTVSIEEVGNS
DS7CB_DANRE     AASKHAVQAFFECLRAEVQEYGITVSTI------------------------------------------
DRS7B_XENLA     SASKHATQAFFDCLRAEMSPYDIDVTVVNPGYIKTNL---------------------------------
DRS7B_BOVIN     AASKHATQAFFDCLRAEVEQHDIEVTVISPGYIHTNL---------------------------------
DHB11_HUMAN     CSSKFAAVGFHKTLTDELAALGVKTTCLCPNFVNTGFIKNSTSLGPTLEPEEVVNRLMHGILTEQKIPSS
BPHB_PSES1      TGAKHAVVGMVRELAYELAPH-VRVNGVAPGGMSTDL-RGPASLGMANQAEMLTSVPVGRMPVRAEYTGA
DHB11_PONAB     CSSKFAAVGFHKTLTDELAALGVKTTCLCPNFVNTGFIKNSTSLGPTLEPEEVVNRLMHGILTEQKIPSS
DH12B_XENLA     SATKAFVDFFSRGLHAEYRSKGVTVQSVLPFFVATKLAKIRKP---------------------------
YDFG_ECO57      GATKAFVRQFSLNLRTDLHGTAVRVTDIEPGLVGGTEFSNVRFKGDDGKAE-------------------
YDFG_ECOLI      GATKAFVRQFSLNLRTDLHGTAVRVTDIEPGLVGGTEFSNVRFKGDDGKAE-------------------
STDH1_CAEEL     SATKKYVEWITGCLQKEYGHQGIIFQAITPAMVATKM---------------------------------
FABI_RICFE      GISKAALEASVKYLATDLGENNIRVNAISAGPIKT---LASSAIGSTMLKSHAATAPLKRNTTQEDVGGA
DHI2_MOUSE      GTSKAAIALLMDTFGCELLPWGIKVSIIKPGCFKTD----------------------------------
DHB13_HUMAN     CSSKFAAVGFHRGLTSELGKTGIKTSCLCPVFVNT-----------------------------------
DR4L2_HUMAN     NVSKTALLGLNNTLAIELAPRNIRVNCL------------------------------------------
DHB12_RAT       SATKAFVDFFSQCLHEEYKSKGIFVQSVLPFFVATKLAKIRKP---------------------------
YCP8_SCHPO      GQSKAALNYTMKEISFELQDEGFIVISIHPGAVRTDSAQEIVNQHAEKKPEILDLFAKQAL-TPEKSASD
YBPE_SCHPO      SSSKAALVSLHETLEEEVLSQNFKFSLYVLGQIKSTMFEKDTP---------------------------
RDHE2_MOUSE     CASKFAALGFAESMFIELAKWGIKTTIVCPFFIKTGMF--------------------------------
RDH13_HUMAN     CQSKLAIVLFTKELSRRLQGSGVTVNALHPGVARTELGRHTGIHGSTFSSTTLGPIFWLLVKSPELAAQP
FABI_BRANA      SSAKAALESDTRVLAFEAGKQNIRVNTISAGPLGSRAAKAIGFIDTMIEYSY-NNAPIQKTLTADEVGNA
DRS7B_RAT       AASKHATQAFFDCLRAEMKDSDIEVTVISPGYIHTNL---------------------------------
DHRS1_MOUSE     GVGKAACDRLAADCAHELRRHGVSYVSLWPGLVQTELFKKMKPDFSSAE---------------------
RDH10_RAT       CASKFGVVGFHESLSHELEKDGIKTTLVCPYLVDTGMFR-----GCRIRKEIEPFLPPLK----------
RDH10_MOUSE     CASKFGVVGFHESLSHELEKDGIKTTLVCPYLVDTGMFR-----GCRIRKEIEPFLPPLK----------
RDH10_HUMAN     CASKFGVVGFHESLSHELEKDGIKTTLVCPYLVDTGMFR-----GCRIRKEIEPFLPPLK----------
RDH10_BOVIN     CASKFGVVGFHESLSHELEKDGIKTTLVCPYLVDTGMFR-----GCRIRKEIEPFLPPLK----------
INHA_MYCS2      NVAKSALESVNRFVAREAGKVGVRSNLVAAGPIRT--LAMSAIVGGALGDEAGQQMQLLEEGDPTPVAKT
FABI_RICPR      GVAKAALEASVKYLANDMGENNIRVNAISAGPIKT-LASSAISDFSTMLKSHAATAPLKRNITQEDVGGA
FABI_HELPY      MAAKAALESAVRYLAVDLGKHHIRVNALSAGPI-----RTLASSGIADFRMILKNAPLRKNVSLEEVGNA
FABI2_RHIME     GVAKAALEASVRYLAADYGSRGIRVNAISAGPI-----RTLAGAGISDARAMLSNSPLRRTVTIEDVGSS
Y5909_MYXXD     SASKAFLSTFMESLRVDLRGTGVRVTCIYPGFVKSEL---------------------------------
FABG_YEAST      SASKAALSRFTEVLAAEMEPRNIRCFTISPGLVKGTDMIQNLPV---EAKEMLETIGASGTSAPAEIAEE
DHB13_MOUSE     CSSKFAAVGFHRALTAELGKTGIKTSCLCPVFVNT-----------------------------------
DHB11_RAT       CSSKFAAVGFHRALTDELAALGLCPNFINTG---------------------------------------
DHB11_MOUSE     CSSKFAAVGFHRALTDELARTGVRTSCLCPNFINT-----------------------------------
YIV6_YEAST      GCSKAALNHFAMDIASEEPSDKVRAVCIAPGVVDTQMQKDIR----------------------------
YCP6_SCHPO      GQSKAALNFTMKEISFELQDEGFIVISIHPGMVRTDSAQEAVNQHAEAKPEILDIFAKQALA-PDQSASD
MKAR_NEOFI      SGSKAFLQQWSTSLGSELEPYGITVELVQAYLITSAMSKVRRTSATIPDPRAFVKAVLSKIGR-------
DHRS1_HUMAN     GVGXXXXXXXXXXXXHELRRHGVSCVSLWPGIVQTELLKE------------------------------
STDH3_CAEEL     SASKKYVEWLTGCLRKEYEHQGIIIQAITPALVATKL---------------------------------
S16C6_BOVIN     CASKFAAYGFAESLHFELQKSKINTTIVCPYFIKTGMF--------------------------------
MKAR_AJECN      CGSKAFLQYWSIALGAELQPYGVQVELVQSHLVTSAMSKIRRPTVTVPIPRDLVRAVLSKIGRGSGLSA-
LIGD_PSEPA      SAAKAASINLMEGYRQGLEKYGIGVSVCTPANIKSNIAEASRTSGYVENEESIASLHSIHQHEPEKLAEA
DHI2_RAT        GTSKAAIALLMDTFSCELLPWGIKVSIIQPGCFKTE----------------------------------
DHB13_RAT       CSSKFAAVGFHRALTAELGKTGIKTSCLCPVFVNT-----------------------------------
DHB11_MACFA     CSSKFSAVGFHKALTDELAALGVKTTCLCPNFVNTGFIKNSTSLGPALEPE-------------------
YCIK_ECOLI      AASKFATEGMMQVLADEY-QQRLRVNCINPGGTRTAMRASAFPTEDPQKKTPADIMPL------------
LE767_CAEEL     SATKKYVSWLTAILRKEYEHQGITVQTIAPMMVATKMSKVKRPDGAVFAKSALNTV--------------
DHRS3_BOVIN     CTSKASAFAFMESLTLGLLDCGVSATTVLPFHTSTEMFQGMR----------------------------
Y1570_MYCBO     IASKAAL---------------------------------------------------------------
Y1543_MYCTU     IASKAAL---------------------------------------------------------------
MOMAS_ORYSJ     TTSKHALVGFTENAAGELGRHGIRVNCVSPAGVATPLAR-------------------------------
MKAR_PICST      SGSKSFLQAWSAALAGELQSQGVDVELV------------------------------------------
FOLM_CITK8      AASKAALDNMTRSFARKLAPE-VKVNAIAPSLI---LFNENDD--AEYRQQALNKSLMKTAPGEKEVIDL
FABI_RICTY      GVAKAALEASVKYLANDMGENNIRVNAISAGPIKT-LASSAISDFSTMLKFHASTAPLKRNITQEDVGGA
FABI_RICCN      GVAKAALEASIKYLANDMGENNIRVNAISAGPIKT---LASSAIGSTMLKSHAATAPLKRNTTQEDVGGA
DHRS3_HUMAN     CTSKASAFAFMESLTLGLLDCGVSATTVLPFHTSTEMFQGMR----------------------------
Y945_MYCTU      AASKAGVRSLGESLRAEYAQRPIRVTVLEPGYIESEMTAKS-----------------------------
DHRS9_MOUSE     TPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTEL---ADPIKTTEKK--------------------
AYR1_YEAST      SASKAAIHQYARGLHLEMKPFNVRVINAITGGVATDIADK-RPL--------------------------
S16C6_MOUSE     SSSKFAAFGFAESLFLEL----------------------------------------------------
Y3820_MYCBO     GSTKAGLDGFYLGLSEALREYGVRVLVIRPGQVRTRMSAHLKEAPLTVDKEYVANLAVTASAKGKEL---
Y3791_MYCTU     GSTKAGLDGFYLGLSEALREYGVRVLVIRPGQVRTRMSAHLKEAPLTVDKEYVANLAVTASAKGKEL---
FABI_BUCAI      GLAKASLEASVRYMASSLGKENIRVNAISSSPIKTISSYKITNFNKIRNCSYASSFLKNSVTS-ENIGNV
YI13_SCHPO      CSTKSALAQFTSALRKETIDTRIRIMEVDPGLVETE-FSVVRFHGDKQKADNVNSEPL----TPEDIAEV
MKAR_ASPFU      SGSKAFLQQWSTSLGSELEPYGITVELVQAYLITSAMSKVRRTSATIPDPRAFVKAVLSKIGR-------
MKAR_ASPFC      SGSKAFLQQWSTSLGSELEPYGITVELVQAYLITSAMSKVRRTSATIPDPRAFVKAVLSKIGR-------
RDHE2_HUMAN     CASKFAAFGFAESVFVETKQKGIKTTIVCPFFIKTGMF--------------------------------
MKAR_ASPCL      SGSKAFLQQWSTSLGSELEPYGITVELVQAYLITSAMSKVRRTSALIPSPRAFVSSVLSKIGR-------
DHRS3_MOUSE     CTSKASAFAFMESLTLGLLDCGVSATTVLPFHTSTEMFQGMR----------------------------
TSC10_YEAST     APAKAAIKSLVAILRQELTNFRI--SCVYPGNFESEGF--------------------------------
PATL1_ARATH     TIELPASEACTLSWELRVVSYGAQFEPTTEGSYAV-IVSKTRKIGSTDEPVITDS---FKVGEPGKIVIT
HSDL2_XENLA     TIAKYGMSMCALGMSEEY-KGEIAVNALWP----------------------------------------
DECR2_ARATH     SAAKAAVDATTRNLALEWGTYDIRVNXXXXXXXXXXXXM-SKLVPEEIENKTREYMPLYKVGEKWDIAMA


                         .         .         .         +         .         .         .:280
query           IAFLLSNEASFITGQVICVDGGGSL
FABG_VIBHA      VVFLASPEAAYITGETLHVNGG---
FABG_PSEAE      VGFLASDGAAYVTGATVPVNGG---
FABG_MYCS2      VSFLASEDASYIAGAVIPVDGG---
FABG_THEMA      ILFLASDESSYVTGQVIGIDGG---
FABG_CUPLA      VEFLAINPASYVTGQVFTIDGG---
FABG_MYCAV      VSFLASEDASYIAGAVIPVDGG---
FABG_BUCBP      TLFLISNDANYITGQVIHVNGG---
FABG_SHIFL      VAFLASDEAAYITGETLHVNGG---
FABG_ECOLI      VAFLASDEAAYITGETLHVNGG---
FABG_BUCAP      VIFLSSEKASYITGQTIHVNGG---
FABG_HAEIN      VAFLASDDAGYITGTTLHVNGG---
FABG_MYCTU      VSFLASEDASYISGAVIPVDGG---
FABG_MYCBO      VSFLASEDASYISGAVIPVDGG---
FABG_RICPR      VAFLASNNASYITGQTLHVNGG---
NODG_AZOBR      VSYLASEIAGYVTGSTLNINGG---
FABG_VIBCH      VAFLASPEAAYITGETLHVNGG---
FABG_BACSU      VTFLASEGARYMTGQTLHIDGG---
FIXR_BRAJA      IFFLCSDAASYVTGAEVPINGGQHL
FABG_CHLMU      ALFLASNQSSYITGQVLSVDGG---
FABG_CHLTR      ALFLASDGSSYITGQVLSVDGG---
FABG_STAES      VAFLASDKAKYITGQTIHVNGG---
FABG_STAEQ      VAFLASDKAKYITGQTIHVNGG---
FABG_AQUAE      VLFLCSELASYITGEVIHVNGG---
YXJF_BACSU      AVFLASEKAKGVTGQAVVLDGG---
FABG_BUCAI      VIFLASKKASYITGHTLHVNGG---
BACC2_BACSU     MLFLASDLSSYMTGSAITADGG---
DCXR_BOVIN      ILFLLSDRSSMTTGSTVPVDGG---
LVR_LEIAQ       VAFLLSDDASYVNATVVPIDGGQS-
FABG_SALTY      VAFLASDEASYITGETLHVNGG---
FABG_SALTI      VAFLASDEASYITGETLHVNGG---
FABG_RICTY      VAFLASNHASYITGQTLHVNGG---
DHRS4_RABIT     VSFLCSEDASYITGETVVVAGG---
DCXR_MOUSE      ILFLLSNRSGMTTGSTLPVDGG---
PHBB_RHIME      VVFLASDDAGFITGSTISANGG---
NODG_RHIS3      VAYLASNEAAYVTGQTIHVNGG---
DCXR_RAT        ILFLLSNRSSMTTGSALPVDGG---
BUDC_KLEPN      VSYLASPDSDYMTGQSLLIDGG---
FABG_STAAW      VAFLASDKAKYITGQTIHVNGG---
FABG_STAAS      VAFLASDKAKYITGQTIHVNGG---
FABG_STAAR      VAFLASDKAKYITGQTIHVNGG---
FABG_STAAN      VAFLASDKAKYITGQTIHVNGG---
FABG_STAAM      VAFLASDKAKYITGQTIHVNGG---
FABG_STAAC      VAFLASDKAKYITGQTIHVNGG---
DCXR_CAEEL      VLFLLSDNASMTTGSTLPVDGGFS-
FABG_RICBR      VAFLASKQSSYITGQTLHVNGG---
DCXR_CAVPO      ILFLLSNRSGMTTGSTLPVDGG---
BACC_BACSU      MLFLASDLSSYMTGSAITADGG---
PHAB_ACISR      VMYLVSEHGAYVTGETLSINGG---
KDUD_DICD3      AVFLASSASDYVNGYTIAVDGG---
CMTB_PSEPU      VGYLAQPEAAFVTGQVISVNGGSTM
CMTB_PSEP1      VGYLAQPEAAFVTGQVISVNGGSTM
CBR4_DANRE      MLFLL--ESPYITGQILLVDGG---
TRNH_DATST      VTYLCLPTASYITGQIICVDGG---
TRN2_HYONI      VAFLCFPAASYVTGQIIYVDGG---
TRN2_DATST      VAFLCFPAASYVTGQIIYVDGG---
DCXR_MESAU      ILFLLSHRSNMTTGSTLPVDGG---
BACC_BACAM      MLFLASDLSSYMTGSAITADGG---
Y325_THEMA      XXXXXCDEAGFMTGSIINIDGGST-
FABG1_SYNY3     IRFLATDAAAYITGQTFNVDGG---
PHBB_ZOORA      VVFLASDEAGFITGSTISANGG---
PHAB_PARDE      VVFLASEDAGFITGSTHQAPNGG--
YOHF_ECOLI      VVWLCSEGANYTTGQSLIVDGG---
YMFI_BACSU      TAFLLSEKASYITGQILSVNGG---
TRN1_DATST      IAFLCFPAASYITGQIIWADGG---
FABG3_BRANA     VEFLLSPAASYITGQAFTIDGG---
FABG1_BRANA     VEFLLSPAASYITGQAFTIDGG---
DHG2_BACME      AAFLASSQASYVTGITLFADGG---
FABG2_BRANA     VEFLLSPAASYITGQAFTIDGG---
CBR4_XENTR      VLFLL--ESPYITGHVLVVDGG---
FABG2_SYNY3     VAFLLSPVASYVTGEVLRVNG----
YVRD_BACSU      IVFLASDAASAINGTAQRVEGG---
FABG_CHLPN      ALFLASQLSSYMTAQTLVVDGG---
PHBB_CHRVI      IAFLAGDESGYMTGANLPVNGG---
KDUD_BACSU      AVFLASRASDYVNGHILAVDGG---
BDH2_MOUSE      CVYLASDESAYVTGNPVIIDGGWSL
LINC_PSEPA      AVWLLSDAASFVTGSCLAADGG---
KDUD_ECOLI      IVFLASSASDYVNGYTIAVDGG---
GRDH_ORYSJ      FVFLASDDASYMSGQMLHVNGG---
CPNA_COMTE      VLFLVSDEASFVHGSELVVDGG---
CPNA_COMS9      VLFLVSDEASFVHGSELVVDGG---
YJDA_BACSU      IAFLASDEAEWITGQIIHSEGG---
Y4VI_RHISN      VRFLASAQASYITGSTLVVDGG---
BDHA_RHIME      ALYLAGDDAAQITGTHVSMDGG---
YKVO_BACSU      VSFLASDESSYLTGVELFVDGG---
PHBB_RALEH      CAWLSSEESGFSTGADFSLNGG---
YLX6_SCHPO      VIFLADSKNSFITGTTLYVDGG---
YHXC_BACSU      YLYLASDDSTYVTGQTIHVNGG---
YGFF_ECOLI      IVWLLSDKASYVTGSFIDLAGG---
FABG5_BRANA     VEFLLSPASSYITGHTFSIHGG---
FABG4_BRANA     VEFLLSPAASYITGQTFTIDGG---
DECR_MOUSE      ATFLCSDYASWINGAVIRFDGG---
HDHA_ECOLI      ALFLCSPAASWVSGQILTVSGGG--
HDHA_ECO57      ALFLCSPAASWVSGQILTVSGGG--
HDHA_CLOSO      VLFFVSEDSSYITGSILEVSGGYNL
DHKR_STRCM      IGYLASDTAASITSQALNVCGG---
BUTA_STAAW      VSFLAGKDSDYITGQTIIVDGG---
BUTA_STAAS      VSFLAGKDSDYITGQTIIVDGG---
BUTA_STAAR      VSFLAGKDSDYITGQTIIVDGG---
BUTA_STAAN      VSFLAGKDSDYITGQTIIVDGG---
BUTA_STAAM      VSFLAGKDSDYITGQTIIVDGG---
BUTA_STAAC      VSFLAGKDSDYITGQTIIVDGG---
UCPA_ECOLI      AAFLASDESSYLTGTQNVIDGGSTL
DHRS4_BOVIN     VSFLCSEDASYITGETVVVAGG---
DHR11_HUMAN     VIYVLSTPAHIQIGDI---------
ACT3_STRCO      VAYLIGPGAAAVTAQALNVCGG---
PECR_PONAB      VCFLLSPAASFITGQSVDVDGGRSL
FADH_BACSU      AAFLLSDEASYINGDCITMDGG---
FABG_RICFE      VAFLASDQASYITGQTIHVNGG---
DECR_RAT        ATFLCSDYASWINGAVIRFDGG---
Y1385_MYCBO     AVFLASDLSSYMTGTVLDVTGG---
Y1350_MYCTU     AVFLASDLSSYMTGTVLDVTGG---
UCPA_ECO57      AAFLASDESSYLTGTQNVIDGGSTL
BDH2_BOVIN      CVYLASDESAYITGNPVIIDGGWSL
NODG_RHIME      VAYLASDHAAYVTGQTIHVNGG---
GNO_GLUOX       AVFLSSRASSFVNGQVLMVDGG---
UCPA_SALTY      AAFLASDESSYLTGTQNVIDGGSTL
UCPA_SALTI      AAFLASDESSYLTGTQNVIDGGSTL
DER_CHICK       ILFLLSDKSAMTTGSSLMVDGG---
YXBG_BACSU      ALFLASDDSSYVTGEDITADGG---
YHDF_BACSU      YVLLASDESSYMTGQTIHVNGG---
IDNO_ECOLI      AVFLSSKASDFVNGHLLFVDGG---
IDNO_ECOL6      AVFLSSKASDFVNGHLLFVDGG---
FABG_ACTAC      VNFLMGEKAAYVTRQVIAVNGG---
CBR2_MOUSE      ILFLLSDRSASTSGGGILVDAG---
BAIA1_EUBSP     YLFLASDLASGITATTISVDG----
PECR_HUMAN      VCFLLSPAASFITGQSVDVDGGRSL
DCXR_HUMAN      ILFLLSDRSGMTTGSTLPVEGG---
DHG_BACSU       AAWLASKEASYVTGITLFADGG---
BDH2_HUMAN      CVYLASDESAYVTGNPVIIDGGWSL
DHR11_MOUSE     VIYVLSTPPHVQVGDI---------
CBR4_XENLA      VLFLL--ESPYITGHVLVVDGG---
FABG_RICCN      VAFLASDQASYITGQTIHVNGG---
HCDS_XANP2      AVFLLSTKAAFVTGSVLAVDGG---
FABL_BACSU      VEFLVSSKADMIRGQTIIVDGGRSL
SORD_KLEPN      VCYLLSARASYITGVTTNIAGG---
PECR_RAT        VCFLLSPAASFITGQLINVDGGQAL
PECR_MOUSE      VCFLLSPAASYITGQLINVDGGQAL
CBR2_PIG        ILFLLSDRSASTSGSSIFVDAG---
DHRS4_RAT       VSFLCSEDASYINGETVVVGGG---
DECR_HUMAN      AAFLCSDYASWINGAVIKFDGG---
YGCW_ECOLI      AVFLASPASNYVNGHLLVVDGG---
HCDR_XANP2      VMFLAGEDATYVNGAALVMDG----
DHR11_BOVIN     VIYVLSTPPHVQIGDI---------
BAIA2_EUBSP     YLFLASDLASGITATTVSVDG----
DHB8_HUMAN      VAFLASEDSGYITGTSVEVTGG---
CBR4_MOUSE      VVFLL--ESPYITGHVLIVDGG---
CBR4_BOVIN      AVFLL--ESPYVTGHVLVVDGG---
FABG_ARATH      VEFLLSPAASYITGQAFTIDGG---
BUTA_STAEQ      VSFLASNDSDYITGQSILTDGG---
DHRS4_MOUSE     VSFLCSEDASYINGETVVVGGG---
GRDH2_ARATH     YVFLACNHSSYYTGQILHPNGG---
DHB8_CANFA      VTFLASEDSGYITGASVEVTGG---
Y3106_PSEAE     VAWLLSEDAGFVTGQEFLVDGG---
GRDH1_ARATH     YVFLACNHSSYFTGQVLHPNGG---
DHRS4_PIG       VSFLCSEDASYI-------------
BDHA_RALEH      AVFLSSEAARQVRGAIWNMDGG---
Y4LA_RHISN      VAFLLSDDASFITGQVVCIDGG---
Y2146_BRAJA     VAFLLSDDAAFITGQVVCIDGG---
GS39_BACSU      YVLLASDESSYMTGQTLHVNGG---
DHGB_BACME      VAWLASSEASYVTGITLFADGG---
MTDH_AGABI      AILLLSDHATYMTGGEYFIDGG---
BUTA_STAES      VSFLASNDSDYITGQSILTDGG---
YAY8_SCHPO      YLFLACSDGGYMTGQTLHPNGG---
VER1_ASPPA      VSFLASDTAEWVSGKIIGVDGG---
T4HR_MAGGR      VCFLASNDGGWVTGKVIGIDGGACM
HSD_STREX       VVKLLSDTSSYVTGAELAVDGG---
BEND_ACIAD      ITFLASDESSYITGSVLPVGGG---
Y019_THEMA      CVFLADDEAGFITGTNFIVDGG---
GRDH_DAUCA      YVFLASCDSSYYSGQVLHPNGG---
FABG6_BRANA     VEFLLSPAASYITGQTFTIDGG---
DHR11_CHICK     VIYVLS-------------------
PECR_CAVPO      VCFLLSPAASFITGQLVNVDGGQSL
VIBA_VIBCH      VLFLLSDNAGHITLHDLRVDGGATL
RHLG_PSEAE      AISLAGTAGAYMTGNVIPIDGG---
NOG4_RHIME      VAYLASDHAAYVTGQTIHVNGG---
STCU_EMENI      VSFLASDAAEWISGKIIGVDGG---
DECR2_DANRE     VLFLASRASSYVTGSVLVADGGAWL
ENTA_ECOLI      ILFLASDLASHITLQDIVVDGGSTL
DHK1_STRVN      VEYL---------------------
CBR4_HUMAN      VVFLL--ESPYITGHVLVVDGG---
ARDH_PICST      ILYLASETASYTTGHNLVVDGG---
CBR4_RAT        VVFLL--ESPYITGHVLIVDGG---
SPS19_YEAST     TVYIFSPAASYVTGTVLVVDGG---
DHGA_BACME      XXXXXXXXXXYVTGITLFADGG---
Y2478_STAAM     VLYALT-------------------
Y2266_STAAN     VLYALT-------------------
Y182_METEA      VAFLASDDARWVTGEVINASGG---
DHG3_BACME      XXXXXXXXXXYVTGITLFADGG---
DHG4_BACME      XXXXXXXXXXYVTGITLFADGG---
Y2778_STAA8     VLYALT-------------------
Y2488_STAAC     VLYALT-------------------
Y2422_STAA3     VLYALT-------------------
Y2403_STAAW     VLYALT-------------------
Y2370_STAAS     VLYALT-------------------
Y048_HAEIN      LLFLIENYSAFVNGVVLPVDGGFS-
DHB14_HUMAN     AVFLAS-EANFCTGIELLVTGGAEL
DHBA_BACSU      VLFLVSGQAGHITMHNLCVDGGATL
TRNH1_ARATH     VAFLCMPAASYITGQTICVDGG---
DHSO_RHOSH      AIFLATPEADYIVAQTYNVDGG---
BUDC_KLETE      -------------------------
ARDH_CANTR      ILYLASDSASYTTGHNLVVDGG---
Y2567_STAAR     VLYALT-------------------
ARDH_CANAL      ILYLASESASYTTGHNLVVDGG---
SDR1_PICAB      VAFLASDEGEWVNAQVVRVNGG---
RDH8_HUMAN      -------------------------
MTDH_UROFA      AILLLSPKASYMTGGEYFVDGG---
DHB8_RAT        VAFLASEDSGYITGASVEVSGG---
DHB8_PIG        VAFLASEDSGYITGASVEVTGG---
DECR2_PONAB     VLYLASPLASYVTGAVLVADGGAWL
DECR2_HUMAN     VLYLASPLASYVTGAVLVADGGAWL
UXUB_BACSU      LLWLADESYSFVTGITVPVDGG---
DHMA_FLAS1      AVFLAEDGSSFITGSTITIDGG---
NAHB_PSEU8      YLLLASRQGKFITGTVISIDGGMAL
NAHB_PSEPU      YLLLASRQGKFITGTVISIDGGMAL
DHB8_MOUSE      VAFLASEDSGYITGASVEVSGG---
XYLL_PSEPU      ILFLASDAASYITGITLPVAGG---
SOU1_SCHPO      YLYLASDASSYCTGSDIIVDGG---
Y2049_STAEQ     -------------------------
Y2036_STAES     -------------------------
YXEK_CAEEL      AAFMSSDFMSWMNGAIIDFDGG---
DHB8_CALJA      VAFLASEDSGYITG-----------
YWFH_BACSU      XXXXXXXXXXYITGQQISADGG---
YQJQ_BACSU      -------------------------
Y0419_STAS1     -------------------------
YVX3_CAEEL      VAFISSDHMSFMNGVIIDLDGG---
YVAG_BACSU      VTFLSSPLSSAINGAALRADGG---
Y4MP_RHISN      YLFLASDLSAYVTGAVIDVNGG---
LINX_PSEPA      ALFLASDEAKYITGVDLPIDGGWSV
FABG_SCHPO      CTFLLDN------------------
DECR2_RAT       VLYLASPLASYVSGIVLVVDGG---
YBBO_ECOLI      -------------------------
YBBO_ECOL6      -------------------------
HSD_MYCTU       VVYLASDESSYSTGAEFVVDGG---
HSD_MYCBO       VVYLASDESSYSTGAEFVVDGG---
YWC4_CAEEL      VAFISSDHMSFLNGAIIDLDGG---
HCD2_RAT        VQMVIEN--PFLNGEVIRLDG----
VDLC_HELPY      -------------------------
DECR2_MOUSE     VLYLASPLASYVSGIVLVVDGG---
YGHA_ECOLI      YVYLASQESSYVTAEVHGVCGGEHL
YGHA_ECO57      YVYLASQESSYVTAEVHGVCGGEHL
YUXG_BACSU      IAFFASSKAEKTTGCMITVDGG---
YJGI_ECOLI      VAWLAGPEASFVTGAMHTIDG----
FABI_NEIMB      AAFLLSDLSSGITGEITYVDGGYSI
DRS7C_HUMAN     -------------------------
BZRD_BACSU      LLSLL--------------------
THR1_GLOLA      VCFLASQD-----------------
DRS7C_MOUSE     -------------------------
DHRS4_PONAB     VSFLCSEDASYI-------------
YR419_MIMIV     VLFLADNQSSYITGSTITIDGG---
SOU1_CANAL      YLYLASNASTYTTGSNIAVDGG---
PTMA_CAMCO      LVFLLSDESKFVTGQTLVVDDGWGL
FABI_ANASP      AAFLASDLASGITGQVLYVDAG---
DHRS4_HUMAN     VSFLCSEDASYI-------------
DHG2_BACSU      XXXXXXXXXXYVTGATLFVDGGMTL
FOX2_NEUCR      VAVLVHKNNTSETGSIFEVGGG---
FOX2_CANTR      VLYLSSAE-NELTGQFFEVAAG---
YM71_YEAST      IVYATSRKQNTVIADTL--------
SRLD_ECOLI      LLFYASPKASYCTGQSINVTGG---
HCD2_DROME      VQAIYEN--PLLNGEVIRIDG----
FOX2_YEAST      -------------------------
YTKK_BACSU      IAFLCEENSDLVTGTVIEATGG---
YHXD_BACSU      YVFLASENSSYVTSQVYGITGG---
VDLC_HELPJ      -------------------------
DHG1_BACME      XXXXXXXXXXYVTGITLFADGG---
DHRS7_ANOGA     -------------------------
DHG_BACME       XXXXXXXXXXYVTGITLFADGG---
DHB1_RAT        -------------------------
PTR1_LEITA      VIFLCSPKAKYITGTCIKVDGGYSL
KDSR_BOVIN      I------------------------
DHB1_MOUSE      -------------------------
MOAE_KLEAE      CQFLCSPQAAIISGATLVADGGASI
HETN_ANASP      -------------------------
DHB14_BOVIN     XXXXXXXXXTFCTGTELLVTGGAEL
KDSR_HUMAN      I------------------------
HCD2_HUMAN      VQAIIEN--PFLNGEVIRLDG----
DHK2_STRVN      VLGLV--RATYTTGQVLLVDGGAHL
PGDH_CAVPO      LITLIEDD-----------------
HCD2_MOUSE      VQTIIEN--PFLNGEVIRLDG----
RIDH_KLEAE      VLFMVTRSKNVTVRDIV--------
FABI_BACSU      AAFLFSDMSRGITGENLHVDSG---
DRS7C_BOVIN     -------------------------
YQC8_SCHPO      YLYLASNASSFVTGLDLIVDGG---
DHRS2_HUMAN     VSFLCSPDASYVNGENIAVAG----
SDH_RHIRD       -------------------------
SDH_AGRT5       -------------------------
DHB4_HUMAN      VLWL---------------------
KDSR_MOUSE      I------------------------
DHRS7_DROME     -------------------------
BZRD_BACCE      IRNLLETE-EFPQGEVIRID-----
HCD2_BOVIN      VQAIIEN--SFLNGEVIRLDG----
DRS7C_XENTR     -------------------------
YB45_SCHPO      LSFLALNNNPKLTGQFV--------
Y0585_STAHJ     IIYALTQPAHVNVNEV---------
RDH8_BOVIN      -------------------------
DRS7B_MOUSE     -------------------------
ACR1_ACIAD      LGRLAS-------------------
PGDH_MOUSE      -------------------------
Y4EL_RHISN      VVMVAGPKNTYMTGEQVIVLGG---
DHB4_RAT        VLWL---------------------
BPHB_PSEPU      VFFATRGDAAPATGALLNYDGG---
ACR1_ACIBI      LGRLAS-------------------
Y432_LISMO      VAYAI--------------------
DHB4_MOUSE      VLWL---------------------
FABI_BUCAP      AAFLCSDLSIGITGSIINVDHGFNL
DRS7B_XENTR     V------------------------
DHB1_PANTR      -------------------------
PTR1_LEIMA      VIFLCSSKAKYITGTCVKVDGGYSL
PGDH_MACFA      LITLIEDDA----------------
PGDH_HUMAN      LITLIEDDA----------------
FABI_HAEIN      AAFLCSDLASGITGEIVHVDAGFSI
TS2_MAIZE       VLFLASDEARYISGHNLVVDGG---
LIMC_RHOER      LLFLVSEDARYITGAAIPVDAGTTL
FABI_HELPJ      GMYLLSSLSNGVSGEVHFVDAG---
DLTE_BACSU      -------------------------
DHB1_HUMAN      -------------------------
Y452_LISIN      VAYAI--------------------
FABI_PSEAE      GAFLCSDLASGISGEILYVDGG---
YAEB_SCHPO      -------------------------
PGDH_BOVIN      -------------------------
FOLM_KLEP7      IDYLFTSR--YVTGRSFAVDGGRPL
MFEA_DICDI      VLYLCHQDTT-ETGGVFEVGAG---
FABI_SHIFL      AAFLCSDLSAGISGEVVHVDGGFSI
FABI_ECOLI      AAFLCSDLSAGISGEVVHVDGGFSI
FABI_ECO57      AAFLCSDLSAGISGEVVHVDGGFSI
DHB2_HUMAN      -------------------------
3BHD_COMTE      VLFLASDESSVMSGSELHAD-----
YUSR_BACSU      ICSLIEQES--LTGQIITIDSGQTL
DHRS7_HUMAN     -------------------------
DCXR_TRIRE      YVYLVSDASSYTTGADIVIDGG---
BPHB_BURXL      VFFATRGDAAPATGALLNYDGG---
MTDH_CLAHE      YVYFASDASTYTTGADLLIDGG---
INHA_MYCTU      VCALLSDWLPATTGDIIYADGG---
INHA_MYCBO      VCALLSDWLPATTGDIIYADGG---
FABI_SYNY3      AAFLASDLSSGITGQIIYVDSG---
FABI_SALTY      AAFLCSDLSAGISGEVVHVDGGFSI
DHRS7_MOUSE     -------------------------
DHB12_XENTR     -------------------------
DHB12_ANAPL     -------------------------
DH12A_DANRE     -------------------------
YUSZ_BACSU      -------------------------
RDH10_XENTR     -------------------------
BPHB_RHOGO      VFFATRSETVPLTGSVLNYDGG---
EPHD_MYCTU      I------------------------
EPHD_MYCBO      I------------------------
DRS7B_PONAB     -------------------------
DRS7B_HUMAN     -------------------------
FABI_AQUAE      AVFLCSDWARAITGEVVHVDNG---
DHB2_RAT        -------------------------
YL426_YEAST     -------------------------
YD114_YEAST     -------------------------
Y4EK_RHISN      -------------------------
Y1627_STAS1     INYAIN-------------------
MKAR_ASPTN      -------------------------
STDH2_CAEEL     IAHQIQCE-----------------
DS7CA_DANRE     -------------------------
DRS7B_DANRE     -------------------------
DHB12_MACFA     MGWIISNLPSWI-------------
RD10B_XENLA     -------------------------
YI78_SCHPO      VILQAATDES---------------
DH12A_XENLA     -------------------------
BPHB_PSEPS      VFFATRGDAAPASGALVNYDGG---
RD10A_DANRE     -------------------------
DHB12_HUMAN     MGSIISNLPSWIYLKIV--------
YQ53_SCHPO      -------------------------
YDFG_ECOL6      -------------------------
RD10A_XENLA     -------------------------
FABI_RICBR      AVYLFSQLASGVTGEIHYVDCG---
YDFG_SHIFL      -------------------------
SOU2_CANAL      XXXXXXXXXXXTTGADLAVDGG---
DHB2_MOUSE      -------------------------
DHB12_MOUSE     -------------------------
BPHB_COMTE      YVFFATRGDSLATGALLNYDGG---
ABA2_ARATH      VLFLASDDSRYISGDNLMIDGG---
RD10B_DANRE     MRAILTDQPMICTPRVM--------
MTDH_ALTAL      YVYFASDASSYCTGSDLLIDGG---
HSDL1_CHICK     -------------------------
FABI1_RHIME     ALYLLSDLSSGVTGEVHHVDSG---
DS7CB_DANRE     -------------------------
DRS7B_XENLA     -------------------------
DRS7B_BOVIN     -------------------------
DHB11_HUMAN     IAFLTTLE-----------------
BPHB_PSES1      YVFFATRGDTFTTGALLNHDGG---
DHB11_PONAB     IAFLTTLE-----------------
DH12B_XENLA     -------------------------
YDFG_ECO57      -------------------------
YDFG_ECOLI      -------------------------
STDH1_CAEEL     -------------------------
FABI_RICFE      AVYLFSNLSKGVTGEIHYVDCG---
DHI2_MOUSE      -------------------------
DHB13_HUMAN     -------------------------
DR4L2_HUMAN     -------------------------
DHB12_RAT       -------------------------
YCP8_SCHPO      MLKVVDN------------------
YBPE_SCHPO      -------------------------
RDHE2_MOUSE     -------------------------
RDH13_HUMAN     STYLVAEELADVSGK----------
FABI_BRANA      AAFLVSPLASAITGATIYVDNG---
DRS7B_RAT       -------------------------
DHRS1_MOUSE     -------------------------
RDH10_RAT       -------------------------
RDH10_MOUSE     -------------------------
RDH10_HUMAN     -------------------------
RDH10_BOVIN     -------------------------
INHA_MYCS2      VCALLSDWLPATTGTVIYADGGAS-
FABI_RICPR      AVYLFSELSKGVTGEIHYVDCG---
FABI_HELPY      GMYXXXXXXXGVSGEVHFVDAG---
FABI2_RHIME     ALYLLSDLSRGVTGEIHYVDSG---
Y5909_MYXXD     -------------------------
FABG_YEAST      VWSLYSRTA----------------
DHB13_MOUSE     -------------------------
DHB11_RAT       -------------------------
DHB11_MOUSE     -------------------------
YIV6_YEAST      -------------------------
YCP6_SCHPO      MLKVVDN------------------
MKAR_NEOFI      -------------------------
DHRS1_HUMAN     -------------------------
STDH3_CAEEL     -------------------------
S16C6_BOVIN     -------------------------
MKAR_AJECN      -------------------------
LIGD_PSEPA      IKKGVEDNALYI-------------
DHI2_RAT        -------------------------
DHB13_RAT       -------------------------
DHB11_MACFA     -------------------------
YCIK_ECOLI      -------------------------
LE767_CAEEL     -------------------------
DHRS3_BOVIN     -------------------------
Y1570_MYCBO     -------------------------
Y1543_MYCTU     -------------------------
MOMAS_ORYSJ     -------------------------
MKAR_PICST      -------------------------
FOLM_CITK8      VDYLLTS--CFVTGRSFAVDGGRHL
FABI_RICTY      AVYLFSELSKGVTGEIHYVDCG---
FABI_RICCN      AVYLFSELSKGVTGEIHYVDCG---
DHRS3_HUMAN     -------------------------
Y945_MYCTU      -------------------------
DHRS9_MOUSE     -------------------------
AYR1_YEAST      -------------------------
S16C6_MOUSE     -------------------------
Y3820_MYCBO     -------------------------
Y3791_MYCTU     -------------------------
FABI_BUCAI      ASFLLSDLSLGITGSVIYVDNG---
YI13_SCHPO      ILFALTRRENVVIADTL--------
MKAR_ASPFU      -------------------------
MKAR_ASPFC      -------------------------
RDHE2_HUMAN     -------------------------
MKAR_ASPCL      -------------------------
DHRS3_MOUSE     -------------------------
TSC10_YEAST     -------------------------
PATL1_ARATH     I------------------------
HSDL2_XENLA     -------------------------
DECR2_ARATH     ALYLSCDSGKYVSGLTMVVDGG---