[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30916.1

[Show Plain Result]


## Summary of Sequence Search
    1::106
    1::106     8e-47 100%  106 aa  Y995_FRATM RecName: Full=UPF0145 protein FTM_0995;
    1::106     8e-47 100%  106 aa  Y954_FRATT RecName: Full=UPF0145 protein FTT0954c;
    1::106     8e-47 100%  106 aa  Y954_FRAT1 RecName: Full=UPF0145 protein FTF0954c;
    1::106     8e-47 100%  106 aa  Y852_FRATW RecName: Full=UPF0145 protein FTW_0852;
    1::106     8e-47 100%  106 aa  Y833_FRATN RecName: Full=UPF0145 protein FTN_0833;
    1::106     8e-47 100%  106 aa  Y1322_FRATF RecName: Full=UPF0145 protein FTA_1322;
    1::106     8e-47 100%  106 aa  Y1249_FRATH RecName: Full=UPF0145 protein FTL_1249;
    1::106     8e-47 100%  106 aa  Y1226_FRATO RecName: Full=UPF0145 protein FTH_1226;
    1::106     1e-38  88%  106 aa  Y1786_FRAP2 RecName: Full=UPF0145 protein Fphi_1781;
    3::105     4e-19  42%  105 aa  Y273_LEGPC RecName: Full=UPF0145 protein LPC_0273;
    3::105     4e-19  42%  105 aa  Y197_LEGPH RecName: Full=UPF0145 protein lpg0197;
    3::105     1e-18  41%  105 aa  Y253_LEGPL RecName: Full=UPF0145 protein lpl0253;
    3::105     4e-18  41%  105 aa  Y255_LEGPA RecName: Full=UPF0145 protein lpp0255;
   16::116     3e-17  43%  119 aa  Y595_BURS3 RecName: Full=UPF0145 protein Bcep18194_B0595;
   16::116     7e-17  42%  122 aa  Y4940_BURM1 RecName: Full=UPF0145 protein Bmul_3577/BMULJ_04940;
   16::116     3e-16  43%  120 aa  Y3406_BURVG RecName: Full=UPF0145 protein Bcep1808_3406;
   16::116     1e-15  42%  120 aa  Y5217_BURCC RecName: Full=UPF0145 protein Bcenmc03_5217;
   16::116     2e-15  42%  122 aa  Y5002_BURA4 RecName: Full=UPF0145 protein BamMC406_5002;
   16::116     2e-15  42%  122 aa  Y5745_BURCJ RecName: Full=UPF0145 protein BceJ2315_57450;
   16::116     2e-15  41%  122 aa  Y4477_BURCM RecName: Full=UPF0145 protein Bamb_4477;
    1::102     4e-15  39%  103 aa  Y5168_BACLD RecName: Full=UPF0145 protein BLi01945/BL05168;
    8::110     4e-14  39%  114 aa  Y873_SULIY RecName: Full=UPF0145 protein YG5714_0873;
    6::105     7e-14  37%  111 aa  Y2656_BURTA RecName: Full=UPF0145 protein BTH_I2656;
    8::110     7e-14  37%  114 aa  Y1976_SULSO RecName: Full=UPF0145 protein SSO1976;
    1::101     1e-13  40%  105 aa  Y1283_VIBPA RecName: Full=UPF0145 protein VP1283;
    6::105     2e-13  36%  111 aa  Y904_BURMA RecName: Full=UPF0145 protein BMA0904;
    6::105     2e-13  36%  111 aa  Y3233_BURMS RecName: Full=UPF0145 protein BMASAVP1_A1433;
    6::105     2e-13  36%  111 aa  Y3215_BURM7 RecName: Full=UPF0145 protein BMA10247_0715;
    6::105     2e-13  36%  111 aa  Y2746_BURM9 RecName: Full=UPF0145 protein BMA10229_A0446;
    6::105     2e-13  36%  111 aa  Y2003_BURPS RecName: Full=UPF0145 protein BPSL2003;
    6::105     2e-13  36%  111 aa  Y1822_BURP1 RecName: Full=UPF0145 protein BURPS1710b_1822;
    6::105     2e-13  36%  111 aa  Y1667_BURP0 RecName: Full=UPF0145 protein BURPS1106A_1667;
    6::105     2e-13  36%  111 aa  Y1644_BURP6 RecName: Full=UPF0145 protein BURPS668_1644;
    8::110     2e-13  39%  114 aa  Y1756_PYRFU RecName: Full=UPF0145 protein PF1756;
    1::100     2e-13  38%  111 aa  Y1066_BACA2 RecName: Full=UPF0145 protein RBAM_010660;
    1::101     4e-13  39%  104 aa  Y2090_VIBHB RecName: Full=UPF0145 protein VIBHAR_02090;
    1::104     1e-12  37%  108 aa  Y426_FERNB RecName: Full=UPF0145 protein Fnod_0426;
    1::102     2e-12  38%  106 aa  Y882_CLOPE RecName: Full=UPF0145 protein CPE0882;
    1::104     2e-12  34%  108 aa  Y1434_THEAB RecName: Full=UPF0145 protein THA_1434;
    1::102     2e-12  38%  106 aa  Y876_CLOP1 RecName: Full=UPF0145 protein CPF_0876;
    1::103     2e-12  38%  104 aa  Y1617_DEHE1 RecName: Full=UPF0145 protein DET1617;
    1::104     2e-12  38%  106 aa  Y1264_THELT RecName: Full=UPF0145 protein Tlet_1264;
    6::105     5e-12  36%  117 aa  Y4322_CHRVO RecName: Full=UPF0145 protein CV_4322;
    1::103     5e-12  37%  104 aa  Y1711_DEHSC RecName: Full=UPF0145 protein cbdbA1711;
    1::103     5e-12  37%  104 aa  Y1363_DEHSB RecName: Full=UPF0145 protein DehaBAV1_1363;
    1::103     7e-12  32%  104 aa  Y1985_HAHCH RecName: Full=UPF0145 protein HCH_01985;
    1::104     7e-12  32%  104 aa  Y1015_HALLT RecName: Full=UPF0145 protein Hlac_1015;
    1::105     9e-12  36%  106 aa  Y545_ANATD RecName: Full=UPF0145 protein Athe_0545;
    1::101     9e-12  36%  108 aa  Y1129_THEM4 RecName: Full=UPF0145 protein Tmel_1129;
    5::96      1e-11  38%  108 aa  Y2946_ACIAD RecName: Full=UPF0145 protein ACIAD2946;
    1::103     2e-11  33%  106 aa  Y2732_PARD8 RecName: Full=UPF0145 protein BDI_2732;
    1::105     3e-11  36%  106 aa  Y1325_HYPNA RecName: Full=UPF0145 protein HNE_1325;
    1::105     3e-11  35%  106 aa  Y771_CALS8 RecName: Full=UPF0145 protein Csac_0771;
    5::107     4e-11  32%  111 aa  Y6695_BRASO RecName: Full=UPF0145 protein BRADO6695;
    1::104     6e-11  34%  105 aa  Y381_PSYIN RecName: Full=UPF0145 protein Ping_0381;
   54::108     6e-11  49%  111 aa  Y3680_BURP8 RecName: Full=UPF0145 protein Bphy_3680;
    1::105     6e-11  35%  106 aa  Y208_LISGR RecName: Full=UPF0145 protein;
    7::107     7e-11  34%  112 aa  Y4599_SOLUE RecName: Full=UPF0145 protein Acid_4599;
    1::101     7e-11  35%  107 aa  Y2095_SHEFN RecName: Full=UPF0145 protein Sfri_2095;
    1::104     1e-10  35%  105 aa  Y1624_METVS RecName: Full=UPF0145 protein Mevan_1624;
    1::104     1e-10  33%  112 aa  Y1828_METM6 RecName: Full=UPF0145 protein MmarC6_1828;
   57::110     2e-10  48%  114 aa  Y1080_SULTO RecName: Full=UPF0145 protein ST1080;
   11::112     3e-10  34%  117 aa  Y490_PYRAB RecName: Full=UPF0145 protein PYRAB04900;
    1::105     3e-10  37%  107 aa  Y1658_SERP5 RecName: Full=UPF0145 protein Spro_1658;
    1::107     4e-10  33%  107 aa  Y1668_PASMU RecName: Full=UPF0145 protein PM1668;
    1::103     5e-10  32%  106 aa  Y2504_CLOBB RecName: Full=UPF0145 protein CLL_A2504;
    1::101     5e-10  32%  106 aa  Y165_THEP1 RecName: Full=UPF0145 protein Tpet_0165;
    1::101     5e-10  32%  106 aa  Y163_THESQ RecName: Full=UPF0145 protein TRQ2_0163;
    1::105     6e-10  32%  106 aa  YBG4_VIBVU RecName: Full=UPF0145 protein VV2_1464;
    1::101     6e-10  31%  106 aa  Y763_THEMA RecName: Full=UPF0145 protein TM_0763;
    1::105     6e-10  32%  106 aa  Y4283_VIBVY RecName: Full=UPF0145 protein VVA0283;
    1::104     6e-10  32%  105 aa  Y2458_COLP3 RecName: Full=UPF0145 protein CPS_2458;
    1::105     6e-10  30%  110 aa  Y208_LISWE RecName: Full=UPF0145 protein;
    7::109     6e-10  33%  113 aa  Y1926_PYRKO RecName: Full=UPF0145 protein TK1926;
    1::105     6e-10  30%  110 aa  Y170_LISW6 RecName: Full=UPF0145 protein lwe0170;
    1::104     6e-10  34%  105 aa  Y1349_HAEDU RecName: Full=UPF0145 protein HD_1349;
    1::105     8e-10  30%  110 aa  Y2435_LISMH RecName: Full=UPF0145 protein LMHCC_2435;
    1::105     8e-10  30%  110 aa  Y240_LISIN RecName: Full=UPF0145 protein lin0240;
    1::105     8e-10  30%  110 aa  Y219_LISMF RecName: Full=UPF0145 protein LMOf2365_0219;
    2::103     8e-10  36%  108 aa  Y2109_ACIC1 RecName: Full=UPF0145 protein Acel_2109;
    1::105     8e-10  30%  110 aa  Y208_LISMO RecName: Full=UPF0145 protein lmo0208;
    1::105     8e-10  30%  110 aa  Y208_LISIV RecName: Full=UPF0145 protein;
    1::105     8e-10  30%  110 aa  Y206_LISMC RecName: Full=UPF0145 protein Lm4b_00206;
   15::108     1e-09  33%  108 aa  Y869_ARCFU RecName: Full=UPF0145 protein AF_0869;
    1::100     1e-09  33%  103 aa  Y532_ALKMQ RecName: Full=UPF0145 protein Amet_0532;
    1::105     1e-09  31%  106 aa  Y398_CLOTH RecName: Full=UPF0145 protein Cthe_0398;
    1::103     1e-09  28%  106 aa  Y3383_METAC RecName: Full=UPF0145 protein MA_3383;
   17::107     1e-09  35%  120 aa  Y3040_UNCMA RecName: Full=UPF0145 protein UNCMA_30400;
    4::106     1e-09  29%  119 aa  Y182_THEAC RecName: Full=UPF0145 protein Ta0182;
    1::102     1e-09  30%  105 aa  Y1405_GEOKA RecName: Full=UPF0145 protein GK1405;
    2::101     1e-09  35%  103 aa  Y4184_PHOPR RecName: Full=UPF0145 protein PBPRB0184;
    1::105     1e-09  31%  106 aa  Y2433_CLOK5 RecName: Full=UPF0145 protein CKL_2433;
    1::106     1e-09  35%  107 aa  Y2237_CITK8 RecName: Full=UPF0145 protein CKO_02237;
   14::101     1e-09  40%  103 aa  Y1800_HELHP RecName: Full=UPF0145 protein HH_1800;
    1::105     2e-09  30%  107 aa  Y3410_BACTN RecName: Full=UPF0145 protein BT_3410;
    1::103     2e-09  30%  106 aa  Y270_BACFR RecName: Full=UPF0145 protein BF0270;
    1::103     2e-09  30%  106 aa  Y226_BACFN RecName: Full=UPF0145 protein BF0226;
    1::105     2e-09  30%  110 aa  Y208_LISSE RecName: Full=UPF0145 protein;
    5::103     2e-09  33%  158 aa  Y1853_PSYA2 RecName: Full=UPF0145 protein Psyc_1853;
    1::103     3e-09  31%  106 aa  Y2273_CLOBA RecName: Full=UPF0145 protein CLH_2273;
   11::112     3e-09  34%  117 aa  Y1682_PYRHO RecName: Full=UPF0145 protein PH1682;
    4::105     4e-09  29%  118 aa  Y347_PICTO RecName: Full=UPF0145 protein PTO0347;
    5::107     4e-09  31%  120 aa  Y1021_METB6 RecName: Full=UPF0145 protein Mboo_1021;
    1::106     5e-09  30%  106 aa  Y465_ACTP2 RecName: Full=UPF0145 protein APL_0465;
    1::102     5e-09  32%  103 aa  Y170_CLONN RecName: Full=UPF0145 protein NT01CX_0170;
    1::106     7e-09  34%  107 aa  YBJQ_SALTY RecName: Full=UPF0145 protein ybjQ;
    1::106     7e-09  34%  107 aa  YBJQ_SALTI RecName: Full=UPF0145 protein ybjQ;
    1::106     7e-09  34%  107 aa  YBJQ_SALSV RecName: Full=UPF0145 protein ybjQ;
    1::106     7e-09  34%  107 aa  YBJQ_SALPK RecName: Full=UPF0145 protein ybjQ;
    1::106     7e-09  34%  107 aa  YBJQ_SALPB RecName: Full=UPF0145 protein ybjQ;
    1::106     7e-09  34%  107 aa  YBJQ_SALPA RecName: Full=UPF0145 protein ybjQ;
    1::106     7e-09  34%  107 aa  YBJQ_SALNS RecName: Full=UPF0145 protein ybjQ;
    1::106     7e-09  34%  107 aa  YBJQ_SALHS RecName: Full=UPF0145 protein ybjQ;
    1::106     7e-09  34%  107 aa  YBJQ_SALG2 RecName: Full=UPF0145 protein ybjQ;
    1::106     7e-09  34%  107 aa  YBJQ_SALEP RecName: Full=UPF0145 protein ybjQ;
    1::106     7e-09  34%  107 aa  YBJQ_SALDC RecName: Full=UPF0145 protein ybjQ;
    1::106     7e-09  34%  107 aa  YBJQ_SALCH RecName: Full=UPF0145 protein ybjQ;
    1::106     7e-09  34%  107 aa  YBJQ_SALAR RecName: Full=UPF0145 protein ybjQ;
    1::106     7e-09  34%  107 aa  YBJQ_SALA4 RecName: Full=UPF0145 protein ybjQ;
    1::106     7e-09  30%  106 aa  Y542_ACTP7 RecName: Full=UPF0145 protein APP7_0542;
    1::106     7e-09  30%  106 aa  Y492_ACTPJ RecName: Full=UPF0145 protein APJL_0492;
    1::106     9e-09  33%  107 aa  YBJQ_SHISS RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_SHIF8 RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_SHIDS RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_SHIBS RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_SHIB3 RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_ESCF3 RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_ECOUT RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_ECOSM RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_ECOSE RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_ECOLU RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_ECOLI RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_ECOLC RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_ECOL6 RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_ECOL5 RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_ECOK1 RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_ECOHS RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_ECODH RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_ECOBW RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_ECO8A RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_ECO81 RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_ECO7I RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_ECO5E RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_ECO57 RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_ECO55 RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_ECO45 RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_ECO27 RecName: Full=UPF0145 protein ybjQ;
    1::106     9e-09  33%  107 aa  YBJQ_ECO24 RecName: Full=UPF0145 protein ybjQ;
    8::109     9e-09  29%  113 aa  Y544_METTH RecName: Full=UPF0145 protein MTH_544;
    1::103     9e-09  30%  112 aa  Y1711_CLOD6 RecName: Full=UPF0145 protein CD1711;
    1::106     9e-09  35%  107 aa  Y1703_PECCP RecName: Full=UPF0145 protein PC1_1703;
    4::105     9e-09  34%  108 aa  Y1024_HAMD5 RecName: Full=UPF0145 protein HDEF_1024;
    6::106     1e-08  28%  114 aa  YF81_THET2 RecName: Full=UPF0145 protein TT_C1581;
    2::103     1e-08  33%  106 aa  Y3412_STRCO RecName: Full=UPF0145 protein SCO3412;
    1::105     1e-08  30%  105 aa  Y2462_CAUCN RecName: Full=UPF0145 protein CCNA_02462;
    1::105     1e-08  30%  105 aa  Y2377_CAUCR RecName: Full=UPF0145 protein CC_2377;
    6::106     1e-08  28%  114 aa  Y1944_THET8 RecName: Full=UPF0145 protein TTHA1944;
    1::104     2e-08  32%  106 aa  Y572_AZOSB RecName: Full=UPF0145 protein azo0572;
    1::105     2e-08  30%  105 aa  Y338_SPHAL RecName: Full=UPF0145 protein Sala_0338;
    1::106     2e-08  35%  107 aa  Y2666_ERWCT RecName: Full=UPF0145 protein ECA2666;
    1::106     2e-08  33%  107 aa  Y1382_ENT38 RecName: Full=UPF0145 protein Ent638_1382;
    1::106     2e-08  33%  107 aa  YBJQ_SHIFL RecName: Full=UPF0145 protein ybjQ;
    1::105     2e-08  30%  106 aa  Y3855_DESHD RecName: Full=UPF0145 protein Dhaf_3855;
    1::105     2e-08  30%  106 aa  Y2697_DESHY RecName: Full=UPF0145 protein DSY2697;
    1::100     2e-08  32%  103 aa  Y241_ENTFA RecName: Full=UPF0145 protein EF_0241;
    1::102     3e-08  30%  105 aa  Y637_OENOB RecName: Full=UPF0145 protein OEOE_0637;
    1::100     3e-08  34%  105 aa  YY10_ENTFA RecName: Full=UPF0145 protein;AltName: Full=ORF10;
    1::102     3e-08  26%  105 aa  Y1588_ANOFW RecName: Full=UPF0145 protein Aflv_1588;
    1::103     3e-08  31%  104 aa  Y1243_SILST RecName: Full=UPF0145 protein TM1040_1243;
    1::105     4e-08  30%  106 aa  Y3728_DELAS RecName: Full=UPF0145 protein Daci_3728;
    5::105     6e-08  36%  108 aa  YJFJ_LACLA RecName: Full=UPF0145 protein yjfJ;
    1::103     6e-08  30%  106 aa  Y643_BACHD RecName: Full=UPF0145 protein BH0643;
    1::105     6e-08  29%  108 aa  Y3795_TRIEI RecName: Full=UPF0145 protein Tery_3795;
    1::105     8e-08  32%  105 aa  Y2580_AERHH RecName: Full=UPF0145 protein AHA_2580;
    5::105     8e-08  35%  108 aa  Y1596_LACLM RecName: Full=UPF0145 protein llmg_1596;
    5::105     8e-08  35%  108 aa  Y1006_LACLS RecName: Full=UPF0145 protein LACR_1006;
    1::106     1e-07  32%  107 aa  Y2470_ENTS8 RecName: Full=UPF0145 protein ESA_02470;
    1::103     1e-07  33%  103 aa  Y2258_SYNJA RecName: Full=UPF0145 protein CYA_2258;
    1::106     1e-07  25%  108 aa  Y4817_NOSP7 RecName: Full=UPF0145 protein Npun_F4817;
    6::104     2e-07  29%  108 aa  Y711_LACCB RecName: Full=UPF0145 protein LCABL_07110;
    6::104     2e-07  29%  108 aa  Y651_LACC3 RecName: Full=UPF0145 protein LSEI_0651;
    1::83      2e-07  33%  103 aa  Y2690_PELTS RecName: Full=UPF0145 protein PTH_2690;
    1::106     2e-07  27%  108 aa  Y2488_ANASP RecName: Full=UPF0145 protein alr2488;
    1::105     2e-07  30%  106 aa  Y1619_AZOSE RecName: Full=UPF0145 protein AZOSEA16190;
    2::100     2e-07  32%  105 aa  Y1614_LACS1 RecName: Full=UPF0145 protein LSL_1614;
    1::102     2e-07  27%  104 aa  Y1265_GEOTN RecName: Full=UPF0145 protein GTNG_1265;
    1::83      2e-07  37%  103 aa  YA95_BACC1 RecName: Full=UPF0145 protein BCE_1095;
    1::106     2e-07  26%  108 aa  Y420_ANAVT RecName: Full=UPF0145 protein Ava_0420;
   17::118     2e-07  29%  121 aa  Y4080_STRGG RecName: Full=UPF0145 protein SGR_4080;
    1::88      2e-07  32%  113 aa  Y1684_SYNPW RecName: Full=UPF0145 protein SynWH7803_1684;
    1::103     2e-07  30%  103 aa  Y1351_SYNJB RecName: Full=UPF0145 protein CYB_1351;
    5::104     2e-07  29%  108 aa  Y1287_LACJO RecName: Full=UPF0145 protein LJ_1287;
    1::101     2e-07  31%  107 aa  Y1285_METMJ RecName: Full=UPF0145 protein Memar_1285;
    1::83      3e-07  36%  103 aa  Y921_BACHK RecName: Full=UPF0145 protein BT9727_0921;
    1::83      3e-07  36%  103 aa  Y904_BACCZ RecName: Full=UPF0145 protein BCE33L0904;
   56::109     3e-07  41%  122 aa  Y671_THEVO RecName: Full=UPF0145 protein TV0671;
    1::103     3e-07  31%  107 aa  Y465_CARHZ RecName: Full=UPF0145 protein CHY_0465;
    1::105     3e-07  30%  106 aa  Y3751_VIBCH RecName: Full=UPF0145 protein VC_A0951;
    1::105     3e-07  30%  106 aa  Y3711_VIBCM RecName: Full=UPF0145 protein VCM66_A0911;
    1::105     3e-07  30%  106 aa  Y288_VIBC3 RecName: Full=UPF0145 protein VC0395_0288;
    4::99      3e-07  34%  103 aa  Y1413_METJA RecName: Full=UPF0145 protein MJ1413;
    1::83      3e-07  36%  103 aa  Y1012_BACCR RecName: Full=UPF0145 protein BC_1012;
    1::83      3e-07  36%  103 aa  Y1001_BACAN RecName: Full=UPF0145 protein
    5::104     4e-07  29%  107 aa  Y1527_LACBA RecName: Full=UPF0145 protein LVIS_1527;
    1::83      5e-07  36%  103 aa  Y3206_BACHK RecName: Full=UPF0145 protein BT9727_3206;
    1::83      6e-07  35%  103 aa  YGI4_BACC1 RecName: Full=UPF0145 protein BCE_5284;
    1::105     6e-07  31%  106 aa  Y734_NITMU RecName: Full=UPF0145 protein Nmul_A0734;
    1::102     6e-07  31%  112 aa  Y3016_RHOBA RecName: Full=UPF0145 protein RB3016;
    5::104     6e-07  28%  108 aa  Y1099_LACGA RecName: Full=UPF0145 protein LGAS_1099;
    1::105     6e-07  30%  106 aa  Y1032_NITEU RecName: Full=UPF0145 protein NE1032;
    1::83      8e-07  34%  103 aa  Y5181_BACCR RecName: Full=UPF0145 protein BC_5181;
    1::83      8e-07  34%  103 aa  Y4874_BACCZ RecName: Full=UPF0145 protein BCE33L4874;
    1::83      8e-07  34%  103 aa  Y4859_BACHK RecName: Full=UPF0145 protein BT9727_4859;
    1::103     8e-07  31%  108 aa  Y2548_ALTMD RecName: Full=UPF0145 protein MADE_02548;
    1::106     8e-07  26%  106 aa  Y1745_PSEPF RecName: Full=UPF0145 protein Pfl01_1745;
    6::104     8e-07  32%  108 aa  Y1282_LACSS RecName: Full=UPF0145 protein LSA1282;
    1::103     1e-06  27%  106 aa  Y3418_PSEF5 RecName: Full=UPF0145 protein PFL_3418;
   17::118     1e-06  30%  121 aa  Y4658_STRAW RecName: Full=UPF0145 protein SAV_4658;
    1::83      1e-06  34%  103 aa  Y1816_BACCR RecName: Full=UPF0145 protein BC_1816;
    1::83      2e-06  35%  103 aa  Y6552_BACAN RecName: Full=UPF0145 protein
    1::102     2e-06  31%  103 aa  Y324_PERMH RecName: Full=UPF0145 protein PERMA_0324;
    1::104     2e-06  28%  106 aa  Y1500_CLOTE RecName: Full=UPF0145 protein CTC_01500;
    1::106     3e-06  23%  108 aa  Y1337_SYNP2 RecName: Full=UPF0145 protein SYNPCC7002_A1337;
    1::102     4e-06  26%  107 aa  Y1111_BACHD RecName: Full=UPF0145 protein BH1111;
    1::103     5e-06  41%  106 aa  Y2909_PSEPG RecName: Full=UPF0145 protein PputGB1_2909;
    1::103     5e-06  28%  108 aa  Y2194_PSEA6 RecName: Full=UPF0145 protein Patl_2194;
    1::83      5e-06  30%  103 aa  Y2155_DESRM RecName: Full=UPF0145 protein Dred_2155;
    1::100     7e-06  31%  103 aa  Y3965_PARDP RecName: Full=UPF0145 protein Pden_3965;
    2::106     1e-05  26%  110 aa  Y562_BIFLO RecName: Full=UPF0145 protein BL0562;
    1::103     1e-05  40%  106 aa  Y3024_PSEE4 RecName: Full=UPF0145 protein PSEEN3024;
    2::106     1e-05  26%  110 aa  Y1357_BIFLD RecName: Full=UPF0145 protein BLD_1357;
    2::106     1e-05  26%  110 aa  Y093_BIFLI RecName: Full=UPF0145 protein Blon_0093;
    1::105     2e-05  26%  108 aa  Y1048_GLOVI RecName: Full=UPF0145 protein gll1048;
    1::103     2e-05  40%  106 aa  Y2816_PSEP1 RecName: Full=UPF0145 protein Pput_2816;
    1::107     2e-05  24%  108 aa  Y1118_SYNY3 RecName: Full=UPF0145 protein sll118;
    1::103     4e-05  40%  106 aa  Y2873_PSEPK RecName: Full=UPF0145 protein PP_2873;
    1::88      4e-05  28%  105 aa  Y060_CORJK RecName: Full=UPF0145 protein jk0060;
    1::103     5e-05  25%  104 aa  Y4416_HALS3 RecName: Full=UPF0145 protein OE4416R;
    1::103     5e-05  25%  104 aa  Y2432_HALSA RecName: Full=UPF0145 protein VNG_2432C;
    1::105     6e-05  25%  107 aa  Y1882_PSEHT RecName: Full=UPF0145 protein PSHAa1882;
    1::100     1e-04  29%  103 aa  Y2361_RHOS5 RecName: Full=UPF0145 protein Rsph17025_2361;
    4::103     1e-04  25%  115 aa  Y2083_LACPL RecName: Full=UPF0145 protein lp_2083;
    1::100     2e-04  29%  103 aa  YK44_RHOS4 RecName: Full=UPF0145 protein RHOS4_20440;
    1::100     2e-04  29%  103 aa  Y2093_RHOS1 RecName: Full=UPF0145 protein Rsph17029_2093;
    1::100     2e-04  29%  103 aa  Y1772_RHOSK RecName: Full=UPF0145 protein RSKD131_1772;
    1::103     2e-04  39%  106 aa  Y2377_PSEPW RecName: Full=UPF0145 protein PputW619_2377;
    1::106

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MILTTADTLGKREIIEYKGLVTGIIVRTPTITQXXXXXXXXXXXXXXTSYTNVCKEARLHAEQEMINQAK
Y995_FRATM      MILTTADTLGKREIIEYKGLVTGIIVRTPTITQXXXXXXXXXXXXXXTSYTNVCKEARLHAEQEMINQAK
Y954_FRATT      MILTTADTLGKREIIEYKGLVTGIIVRTPTITQXXXXXXXXXXXXXXTSYTNVCKEARLHAEQEMINQAK
Y954_FRAT1      MILTTADTLGKREIIEYKGLVTGIIVRTPTITQXXXXXXXXXXXXXXTSYTNVCKEARLHAEQEMINQAK
Y852_FRATW      MILTTADTLGKREIIEYKGLVTGIIVRTPTITQXXXXXXXXXXXXXXTSYTNVCKEARLHAEQEMINQAK
Y833_FRATN      MILTTADTLGKREIIEYKGLVTGIIVRTPTITQXXXXXXXXXXXXXXTSYTNVCKEARLHAEQEMINQAK
Y1322_FRATF     MILTTADTLGKREIIEYKGLVTGIIVRTPTITQXXXXXXXXXXXXXXTSYTNVCKEARLHAEQEMINQAK
Y1249_FRATH     MILTTADTLGKREIIEYKGLVTGIIVRTPTITQXXXXXXXXXXXXXXTSYTNVCKEARLHAEQEMINQAK
Y1226_FRATO     MILTTADTLGKREIIEYKGLVTGIIVRTPTITQXXXXXXXXXXXXXXTSYTNVCKEARLHAEQEMINQAK
Y1786_FRAP2     MILTTADTLGKREIIEYKGLVTGIIVRTPTITQXXXXXXXXXXXXXXTSYTNVCKEARLHAEQEMINQAQ
Y273_LEGPC      MMITTGNSFEGKVIKQYLGIVRGIVVRSPTISQGLMGGLKSIVGGKIGAYSQMCEHAREEAFQLMIEHAQ
Y197_LEGPH      MMITTGNSFEGKVIKQYLGIVRGIVVRSPTISQGLMGGLKSIVGGKIGAYSEMCEHAREEAFQLMIEHAQ
Y253_LEGPL      IMITTGNSFEGKVIKQYLGIVRGIVVRSPTISQGLMGGLKSIVGGKIGAYSQMCEHAREEAFQLMIEHAQ
Y255_LEGPA      MMITTGNSFDGKVIKQCLGIVRGIVVRSPTISQGLMGGLKSIVGGKIGAYSQMCEHAREEAFQLMIEHAQ
Y595_BURS3      --VTTAFDLPGHTTVRSLGVAQGIIVRSRSIVGSFGAALQTIFGGNITLYTSLCEKAREHAFEKMLADAR
Y4940_BURM1     --VTTAFDLPGHTTVRALGVAQGIVVRSRSIVGTFGASLQTLFGGNITLYTSLCEKARQHAFDKMLDDAR
Y3406_BURVG     --VTTAFDLPGHTTVRSLGVAQGIIVRSRSIVGSFGAALQTIFGGNITLYTSLCEKAREQAFEKMLADAR
Y5217_BURCC     --VTTAFDLPGHTTVRSLGVAQGIVVRSRSIVGSFGASLQTIFGGNITLYTSLCEKARQQAFDKMLADAR
Y5002_BURA4     --VTTAFDLAGHTTARSLGVAQGIVVRSRSIVGSFGAALQTIFGGNITLYTSLCEKARQQAFDKMLADAR
Y5745_BURCJ     --VTTAFDLPGHTTVRSLGVAQGIVVRSRSIVGSFGASLQTIFGGNITLYTSLCEKAREQAFDKMLAEAC
Y4477_BURCM     --VTTAFDLAGHTTARSLGVAQGIVVRSRSIVGSFGAGLQTLFGGNITLYTSLCEKARQQAFDKMLADAR
Y5168_BACLD     MIIVTTDTIANQNIVEVKGLVTSSIVQSRNIGKDILSGLKSVIGGELKNYTQMLEDSKKAVRERLVNQAE
Y873_SULIY      VLVTTAETIPGYTIVEVLGIVVGITVRSRGLGGNLMAALRSLVGGEIKEFVEMAEQARMQALIRMIDRAK
Y2656_BURTA     -LITTAFDLPGYRIERSLGVARGIVVRSRSIVGTFGASIQTLFGGNISLYTSLCERARQDAYERMIEEAR
Y1976_SULSO     VLVTNGEQSPGYKIVEIKGLVVGITVRSRGLGKNIIASLRSLLGGEIKEYVELAEQARLQALQRMVDNAK
Y1283_VIBPA     MIYTTTDTIPGKEIAEVRGVVTGNVVQSKHIGRDLMAGLKSIVGGEIRGYTEMMTEARDIAIQRMVEQAN
Y904_BURMA      -LITTAFDIPGYRIERSLGVARGIVVRSRSIVGTFGASIQTLFGGNISLYTSLCERARQDAYERMIDEAR
Y3233_BURMS     -LITTAFDIPGYRIERSLGVARGIVVRSRSIVGTFGASIQTLFGGNISLYTSLCERARQDAYERMIDEAR
Y3215_BURM7     -LITTAFDIPGYRIERSLGVARGIVVRSRSIVGTFGASIQTLFGGNISLYTSLCERARQDAYERMIDEAR
Y2746_BURM9     -LITTAFDIPGYRIERSLGVARGIVVRSRSIVGTFGASIQTLFGGNISLYTSLCERARQDAYERMIDEAR
Y2003_BURPS     -LITTAFDIPGYRIERSLGVARGIVVRSRSIVGTFGASIQTLFGGNISLYTSLCERARQDAYERMIDEAR
Y1822_BURP1     -LITTAFDIPGYRIERSLGVARGIVVRSRSIVGTFGASIQTLFGGNISLYTSLCERARQDAYERMIDEAR
Y1667_BURP0     -LITTAFDIPGYRIERSLGVARGIVVRSRSIVGTFGASIQTLFGGNISLYTSLCERARQDAYERMIDEAR
Y1644_BURP6     -LITTAFDIPGYRIERSLGVARGIVVRSRSIVGTFGASIQTLFGGNISLYTSLCERARQDAYERMIDEAR
Y1756_PYRFU     IIVVTTPTIPGYKIIEVKGIARGGIVMATHLGRDILALLRNIKGGEVKEYTQMMAEAREEALRRMIEHAK
Y1066_BACA2     MIMTTTETIAGKQITEVKGLVTSSIVQSRHIGKDLLAGLKSVVGGELKSYTEMLEDSKKAVKERLIREAE
Y2090_VIBHB     MIYSTTETIPGREIAEIKGVVTGNVVQSKHIGRDLMAGLKSIVGGEIRGYTEMMTEARNIAIQRMVEDAA
Y426_FERNB      MIVVTTDFVPGYEIVETLGIVTGSIVNSKHLGKDIAAAFKTLAGGEIKSYTELLVESRNIALKRMIDEAE
Y882_CLOPE      MLVLTTETIPGKGIKEVKGLVKGSTVRCKNIGKDIASSFKNLVGGEMNSYTEILTEARQIAIGRMVDEAE
Y1434_THEAB     MIITTTENIHGYEIVEILGIVMGNIVQSKHLGKDIAAAFKTLAGGEIKAYTEMMTEARNKAIERMIDEAE
Y876_CLOP1      MLVLTTETIPGKGIKEVKGLVKGSTVRCKNIGKDIASSFKNLVGGEMNSYTEMLTEARQIAIGRMVDEAE
Y1617_DEHE1     MILTNTEDVAGHKIIKNLGLVKGNTIRAKHIGKDILAGLRSIVGGEIEEYTQMLDEARNEAIRRMEAEAK
Y1264_THELT     MVLATTEQIAGYEIIETLGIVLGNTVHSKHLGKDIAAAFKTLAGGEIRSYTELLTEARNIAIQRMIAEAE
Y4322_CHRVO     -MVTTAFELPGYRVSANLGVVRGITVRSRSLVGNFFGGLQSLFGGNITIYTSLCERARSETYAEMCQHAQ
Y1711_DEHSC     MIMTNTEAVAGHKIIKNLGLVKGNTIRAKHIGKDIMASLRSIVGGEIEEYTQMLDEARNEALKRMEADAK
Y1363_DEHSB     MIMTNTEAVAGHKIIKNLGLVKGNTIRAKHIGKDIMASLRSIVGGEIEEYTQMLDEARNEALKRMEADAK
Y1985_HAHCH     MLITNIETIPGKNIVKHLGLVQGSTVRSKHVGRDIMAGLKNIFGGELRGYTELLEDARGEALERMKRQAR
Y1015_HALLT     MELSNTESIAGKEVVETLGLVRGNTVRARNVGRDITQGLRNLAGGELKGYTELMTDARDQAQDRMIEEAE
Y545_ANATD      MIVTTTPSIEGKKIVEYKGIVSSEVIVGVNLVKDFIASITDIFGGRSGTYENELIRAREEALQELQNRAA
Y1129_THEM4     MIISTTDKIPGYKIKEITGIVMGNIVHSKHLGKDIAAAFKTLAGGEIKSYTEMMTEARNKAIERMIDEAE
Y2946_ACIAD     ------------EITQQLDVVYGSTVRSKHVGRDLLAGLKNIVGGELTAYTELLEESRQEAMQRMIAKAQ
Y2732_PARD8     MLLTTTNTIEGKEITQYFGIVSGETIIGANVFKDFFAGIRDIVGGRAGSYESVLREAKETALKEMSDHAA
Y1325_HYPNA     MILTTTHTVQGREIREYKGIVCGEVVIGAHLGKDILASFTNLVGGRSNAYESTLRETRDGAIAEMIEEAQ
Y771_CALS8      MIVTTTPSIEGKKIVDYKGIVSSEVIVGVNLVKDFIASITDIFGGRSGTYENELIRAREEALQELQNRAA
Y6695_BRASO     MIVVTTENVTGYRTVRMLGQCFGVVVRSRGIGGNFIASLRSIVGGEIHEYTQMLEEARRHALDRLVHNAT
Y381_PSYIN      MIYSTTETIPGKEITEIVGVVTGNVVQAKHIGRDIMAGLKSIVGGEIRGYTEMLTEARDLAIQRLVASAN
Y3680_BURP8     -------------------------------------------------YTSLCERARQDAYERMLADAA
Y208_LISGR      MITTTSPTIEGKQIIEYKKIVFGEVITGINVLKDIGAGIRNFFGGRSGGYEEELIQAREAAIEEMENRAE
Y4599_SOLUE     --VTTAYDLPGYRVTRNFGIVRGIVVRSRSILGTLGAGLQTMVGGNISIFSNLCEQTRSDAFELMIQHAG
Y2095_SHEFN     MIYTTTETIPGRDIIEIVGVVTGNVVQSKHIGRDIMAGLKSIVGGEIRGYTEMLSDARDVAINRLVASAA
Y1624_METVS     MLTTTQDKFEDFEIEKTIGLVRGNTIRTKNIGYDLVASLRTIVGGEIPEYTKMMNESREEAFKRMIQEAQ
Y1828_METM6     MNITTQDKFEEMEIEKTLGLVRGSTIRTKNIGYDLIASLRTIVGGEIPEYTKMMDESREEALKRMYREAQ
Y1080_SULTO     -------------------------------------------------YVEMAEQARMQALERMIERAK
Y490_PYRAB      IVVTTSEIPGYR-IVEVKGIARGGVVRATHLGRDIMALLRNIKGGEVKEYTXXXXXXXXXXXXXXXXHAK
Y1658_SERP5     MQLSTTPTLEGFTITEYCGVVTGEAILGANIFRDFFAGVRDIVGGRSGAYEKELRKARLIAFKELEEQAK
Y1668_PASMU     MLITTTPSIEGKQIIEYKEVVFGEVVAGSNFIRDFFAGITDIIGGRSGAYESKIARARKEALEELQQQAK
Y2504_CLOBB     MIITTTPSIEGKNILEYKGVVFGEVISGVNFIKDFAAGLSNFFGGRSNTYEGELIEAREKAMKEMENRAI
Y165_THEP1      MIITTTEQVPGYRVKEILGVVCGNVVMSKHLGKDIAAAFKTLAGGEIKGYTEMLTEARNIALERMIKEAE
Y163_THESQ      MIITTTEQVPGYRVKEILGVVCGNVVMSKHLGKDIAAAFKTLAGGEIKGYTEMLTEARNIALERMIKEAE
YBG4_VIBVU      MIVTTTQHIEGKKIIAYKGVIAGEAILGANLFKDLFAGIRDMVGGRSGTYERELERARTIAFQELEQKAR
Y763_THEMA      MIITTTEQVPGYRVKEILGVVSGNVVMSKHLGRDIAAAFKTLAGGEIKGYTEMLTEARNIALERMMKEAE
Y4283_VIBVY     MIVTTTQHIEGKKIIAYKGVIAGEAILGANLFKDLFAGIRDMVGGRSGTYERELERARTIAFQELEQKAR
Y2458_COLP3     MIYSTTESIPGKEIEEIVGVVTGNVVQAKHIGRDIMAGLKSIVGGEIRGYTEMLTDARDIAIQRLVANAE
Y208_LISWE      MIVTTSPNIEGKQIIEYKKIVFGEVITGVNFMKDIGAGLRNFFGGRSQGYEDELINAREEAIREMESRAK
Y1926_PYRKO     IMVVTTETIPGYRIVEVKGIARGGIVKATHIGRDIMAVLRNIKGGEVREYTQXXXXXXXXXXXXXXXHAK
Y170_LISW6      MIVTTSPNIEGKQIIEYKKIVFGEVITGVNFMKDIGAGLRNFFGGRSQGYEDELINAREEAIREMESRAK
Y1349_HAEDU     MIITTTPTVENRQIIEYKGLVFGEVVAGANIIRDFFASITDMIGGRSGVYEDKLNVARQEALVELQKQAR
Y2435_LISMH     MIVTTSPNIEGKQIIEYKKIVFGEVITGVNFMKDIGAGLRNFFGGRSQGYEDELINAREEAIREMEQRAK
Y240_LISIN      MIVTTSPNIEGKQIIEYKKIVFGEVITGVNFMKDIGAGLRNFFGGRSQGYEDELINAREEAIREMEQRAK
Y219_LISMF      MIVTTSPNIEGKQIIEYKKIVFGEVITGVNFMKDIGAGLRNFFGGRSQGYEDELINAREEAIREMEQRAK
Y2109_ACIC1     LIVTTNEIPGYR-IDEILGSVWGLTVRSRNIVSQFGAGLKSIFGGELRGMTTVLIDSRNQAMQRLVEEAT
Y208_LISMO      MIVTTSPNIEGKQIIEYKKIVFGEVITGVNFMKDIGAGLRNFFGGRSQGYEDELINAREEAIREMEQRAK
Y208_LISIV      MIVTTSPNIEGKQIIEYKKIVFGEVITGVNFMKDIGAGLRNFFGGRSQGYEDELINAREEAIKEMEQRAK
Y206_LISMC      MIVTTSPNIEGKQIIEYKKIVFGEVITGVNFMKDIGAGLRNFFGGRSQGYEDELINAREEAIREMEQRAK
Y869_ARCFU      ----------QREVAEILGVVFGNTVRAKHVGKDILAGLKNIVGGEIEEYTEMLRDARMEALNRMIKEAK
Y532_ALKMQ      MILVNTDYISKKEL-ETLTIVKGSTIQSKHLGKDILSGFKTLVGGELTAYSDMMNEARAIATKRMVAEAQ
Y398_CLOTH      MIITTTNGIEGKRVVEYKGIVCGEVISGVDFIKDFAAGLTNFFGGRSKSYEGELIEAREGAIREMKERAI
Y3383_METAC     MIIATTDTIAGKEITKTLGMARGSTIQAKHLGKDIMSGLRSVVGGELTEYSKMLEEAREKAINRMVEDAE
Y3040_UNCMA     ------------KITKTYGFTWGLIVRSRGIGGNIIASLRTIFGGEIHEYTELLNQSRQYALDRMKQHAR
Y182_THEAC      VIMVNTEYIPGKRIVKVFGTIWGITVRSRGLGGNLVAGLRSLAGGEIKEYTKMLSDARNTAMERLQSAAE
Y1405_GEOKA     MIVTTTNTIEGKEIEEYLGIVAGEVILGANVVRDFLASITDIIGGRSGTYESKLAEGREMAIKEMVNKAR
Y4184_PHOPR     LCVTTSDIIG-REITETLGVVTGNVVQSKHVGRDIMAGFKTIFGGEIRGYTEMLTEAREEALNRAIADAQ
Y2433_CLOK5     MIVTTTNCIEGKKVLEYKGIVFGEVISGVDAIKDIAAGFTNFFGGRSKSYEGELIQAREEALEELKNRAY
Y2237_CITK8     MQFSTTPTLEGQNIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGSYEKELRKAREIAFQELGEQAK
Y1800_HELHP     ---------------EVLGLVKGSMVQSKHIGRDIMAGLKGIVGGEIKGYTEMLNDARNIATDRMIEEAH
Y3410_BACTN     MLVTTTPIIEGKRIVKYYGIVSGETIIGANVFRDLFASIRDIVGGRSGAYEEVLRMAKDTALQEMQAQAA
Y270_BACFR      MLLATTPIIEGKRITTYYGIVSGETIIGANVFRDFFASIRDIVGGRSGSYEEVLREAKDTALKEMSEQAR
Y226_BACFN      MLLATTPIIEGKRITTYYGIVSGETIIGANVFRDFFASIRDIVGGRSGSYEEVLREAKDTALKEMSEQAR
Y208_LISSE      MIVTTSPNIEGKQIIEYKKIVFGEIITGVNFMKDIGAGLRNFFGGRSQGYEDELINAREEAIKEMEQRAQ
Y1853_PSYA2     --LSNLEHLPNYQITERLDVVYGSTVRSKHVGKDLFAGLKNIVGGELTAYTELLEESRQEAIDRMIVKAE
Y2273_CLOBA     MIITTTPAIEGKNILEYKGVVFGEVISGVNFIKDFAAGLSNFFGGRSNTYEDELIGAREKAMKEMENRAI
Y1682_PYRHO     IVVTTPEIPGYK-VVEVKGVARGGTVRATHIGRDIMALLRNLKGGEVKEYTXXXXXXXXXXXXXXXXHAK
Y347_PICTO      VIVVTSDYVPGHRIVKILGVTWGLTVRSRGLGGNLVAGLRTIAGGEIKEYVTLLNDARETALQRLISSAK
Y1021_METB6     IIVVSTPYLPGHKITKTLGFTWGLIVRSRGLGRNITAGLRSLAGGEIHEYTQLLNQSRQEALDRLKEHAA
Y465_ACTP2      MIITTTPTIDGHQITEYKGLVFGEVVSGANFIRDFFASITDVIGGRSGAYESKLNSARQXXXXXXXXXXX
Y170_CLONN      MILVNTDFISGKEI-ETISLVKGSTIQSKNVGKDFLSGLKTLVGGELKAYSEMMNEAREIATNRMVEEAK
YBJQ_SALTY      MQFSTTPTLEGQSIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFQELGEQAK
YBJQ_SALTI      MQFSTTPTLEGQSIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFQELGEQAK
YBJQ_SALSV      MQFSTTPTLEGQSIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFQELGEQAK
YBJQ_SALPK      MQFSTTPTLEGQSIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFQELGEQAK
YBJQ_SALPB      MQFSTTPTLEGQSIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFQELGEQAK
YBJQ_SALPA      MQFSTTPTLEGQSIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFQELGEQAK
YBJQ_SALNS      MQFSTTPTLEGQSIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFQELGEQAK
YBJQ_SALHS      MQFSTTPTLEGQSIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFQELGEQAK
YBJQ_SALG2      MQFSTTPTLEGQSIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFQELGEQAK
YBJQ_SALEP      MQFSTTPTLEGQSIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFQELGEQAK
YBJQ_SALDC      MQFSTTPTLEGQSIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIALQELGEQAK
YBJQ_SALCH      MQFSTTPTLEGQSIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFQELGEQAK
YBJQ_SALAR      MQFSTTPTLEGQSIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFQELGEQAK
YBJQ_SALA4      MQFSTTPTLEGQSIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFQELGEQAK
Y542_ACTP7      MIITTTPTIDGHQITEYKGLVFGEVVSGANFIRDFFASITDVIGGRSGAYESKLNSARQXXXXXXXXXXX
Y492_ACTPJ      MIITTTPTIDGHQITEYKGLVFGEVVSGANFIRDFFASITDVIGGRSGAYESKLNSARQXXXXXXXXXXX
YBJQ_SHISS      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
YBJQ_SHIF8      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
YBJQ_SHIDS      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
YBJQ_SHIBS      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
YBJQ_SHIB3      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
YBJQ_ESCF3      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGDQAR
YBJQ_ECOUT      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
YBJQ_ECOSM      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGDQAR
YBJQ_ECOSE      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
YBJQ_ECOLU      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
YBJQ_ECOLI      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
YBJQ_ECOLC      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
YBJQ_ECOL6      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
YBJQ_ECOL5      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
YBJQ_ECOK1      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
YBJQ_ECOHS      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
YBJQ_ECODH      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
YBJQ_ECOBW      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
YBJQ_ECO8A      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
YBJQ_ECO81      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
YBJQ_ECO7I      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGDQAR
YBJQ_ECO5E      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
YBJQ_ECO57      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
YBJQ_ECO55      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
YBJQ_ECO45      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
YBJQ_ECO27      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
YBJQ_ECO24      MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
Y544_METTH      VIYVTSNYVPGYRAVEVLGFVYGLTVRSRRLG-GQIDRFKSILGGEIKEYVTMMEHSRQEALERMLDHAR
Y1711_CLOD6     MLIVTTEKVEGKKISKVLGLVRGSTIRAKHVGKDIGASFKNLVGGELTGYNEMLTEARQIAIGRMVEDAE
Y1703_PECCP     MQLSTTPTLEGFTITEYCGVVTGEAILGANIFRDFFASIRDVVGGRSGAYEKELRKARQIAFKELQEQAA
Y1024_HAMD5     ---TTTPTLQGYDIREYLGIVTGEAILGANIFKDLFAGIRDFVGGRSNAYEKELIKARKIAFNEMNSTAE
YF81_THET2      ILVSTLEAVPGYRVAQVLGVVKGSTVRSKHLGKDLLAGLRTLVGGELPEYTEMLQEAREVAEARMLEEAR
Y3412_STRCO     LVVTTNDLPGHR-VQEVLGEVFGLTVRSRHLGSQIGAGLKSLVGGELRGLTKTLVETRNQAMERLVEQAR
Y2462_CAUCN     MLITTTPFIEGRPVQEYKGAIYAQSILGANVVLDLLAAIRDFIGGHSKSYERVLARAREDAMKNLIKEAE
Y2377_CAUCR     MLITTTPFIEGRPVQEYKGAIYAQSILGANVVLDLLAAIRDFIGGHSKSYERVLARAREDAMKNLIKEAE
Y1944_THET8     ILVSTLEAVPGYRVAQVLGVVKGSTVRSKHLGKDLLAGLRTLVGGELPEYTEMLQEAREVAEARMLEEAR
Y572_AZOSB      MLMTTTPTLEGKPVQQYLGVVTGEAIIGANIFKDLFASIRNIVGGRAGAYERSLADAREVAMAEMAEQAL
Y338_SPHAL      MFSTTTNNIEGHPVREYLGIVTGEVIVGANLFRDLFASITDIVGGRSGKYEDVLARARKEALGEMEAEAA
Y2666_ERWCT     MQLSTTPNLEGFTITEYCGVVTGEAILGANIFRDFFASIRDVVGGRSGAYEKELRKARQIAFKELQEQAE
Y1382_ENT38     MQFSTTPTLEGQPIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFKELGEQAK
YBJQ_SHIFL      MQFSTTPTLEGLTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
Y3855_DESHD     MIVTTTPNIDGRKIQNYYGIVTGEAIMGANVVRDIFAGITDIIGGRSGAYEEKLQDARQIALKEMEQNAA
Y2697_DESHY     MIVTTTPNIDGRKIQNYYGIVTGEAIMGANVVRDIFAGITDIIGGRSGAYEEKLQDARQIALKEMEQNAA
Y241_ENTFA      MLVTTTERISGQEY-EIIGEVFGLTTRSKNMFKDLGAGLKSVVGGEIKGYTDMQREARDQAIERLKAEAS
Y637_OENOB      MIVCTTENIAGYRIDKTFGEVFGLTTRSRNLVRTFGAGLKTLVGGEVVTWTQLQDQARLEAIERLKNNAD
YY10_ENTFA      MLITTSEKLYG---VEYETLVFGVTTHSKNIVKNIGAGLKNLVGGEIKAYTEMQQEARKIAMDRLKEEAK
Y1588_ANOFW     MIVTTTNSIEGKQIEQYLGLVSGEVILGANVVRDFLASITDIIGGRSGTYESKLAEGREMAVQEMVKKAR
Y1243_SILST     MIVTTTNSVEGYQISEYKGIVVGEAIMGANVVRDVFAQITDIVGGRSGAYESKLQDARETALSELEDRAR
Y3728_DELAS     MIITTTPQIEGRRITRYCGVVAGEAILGANVFKDLFAGLRDIVGGRSATYERELQRAREIALKELEERAQ
YJFJ_LACLA      LIVTTNEVAGYR-ITEVYGEVFGLTTRSRNLFSSAGQQMKTVVGGEINGYTKLQHETRETSIDRMREEAK
Y643_BACHD      MMIVTTDRIDGYNVKAVKGYVKGSTVQTKHIGRDITAGLKGLVGGEIKGYSEMMDEARKLAIHRMAQDAE
Y3795_TRIEI     MIITTTDVIQGSEVEEYLGIVTAEVVYGSNALRDFFAGIRDIIGGRTGSYEELFKQGQEEAIAELEKRAR
Y2580_AERHH     MILSTTPTLEGKTIREYRGIVVGEAILGANVFKDLFAGIRDIIGGRSGAYEKELARAREIAFDELKERAA
Y1596_LACLM     LIVTTNEVAGYR-IVEVYGEVFGLTTRSRNLFSSAGQQMKTVVGGEINGYTKLQHDTRETSIGRMKEEAK
Y1006_LACLS     LIVTTNEVAGYR-IVEVYGEVFGLTTRSRNLFSSAGQQMKTVVGGEINGYTKLQHDTRETSIGRMKEEAK
Y2470_ENTS8     MQFSTTPTLEGQVIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFRELGDQAA
Y2258_SYNJA     MLLTTTDVLQGREVERYLGIVTAEVVYGTNVLRDFLASLRNIIGGRTRTYEEVLENAQKKVLEELEQRAK
Y4817_NOSP7     MIITTTDVIQGAVIESYLGIVTAEVVYGSNFLRDFLAGIRDIIGGRTASYERLFEQGQRKALEELEQRAQ
Y711_LACCB      LITTTENIPGKK--YEVIGEVFGLTTQSKNVISNIGAGLKNIVGGEIKAYSDMLHESREKAIERLRDEAQ
Y651_LACC3      LITTTENIPGKK--YEVIGEVFGLTTQSKNVISNIGAGLKNIVGGEIKAYSDMLHESREKAIERLRDEAQ
Y2690_PELTS     MILTTTPNIEGKPVLEYLGIVTGEAIMGANIVRDFFAAVTDIVGGRSGAYEQKLSHARQIALNEMAEEAR
Y2488_ANASP     MIVTTTDVIQGAVIDSYLGIVTAEIVYGSNFLRDFLAGIRDVIGGRTGSYERLFEQGQRKAIEELELRAQ
Y1619_AZOSE     MLMTTTPTIEGRTIRSYHGVVAGEAIIGANVFKDMFAAVRDIVGGRSGSYEKTLRSARETAFEDLAEAAG
Y1614_LACS1     LVVTTENIPGKK--YEVLGEVFGVTTQSKNFVRNIGAGLKNIVGGEIKDYTKMLHEARMVAIERMKQEAT
Y1265_GEOTN     MIVTTTNTVEGKEIEAYLGIVAAEVILGANVVRDFLASITDIIGGRSGTYESKLAEGRELAIREMVNKAT
YA95_BACC1      MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGSYESKLKEARDIAMDEMKELAK
Y420_ANAVT      MIVTTTDVIQGAVIDSYLGIVTAEVVYGSNFLRDFLAGIRDVIGGRTGSYERLFEQGQRKAIEELELRAQ
Y4080_STRGG     LVVTTNDVPGY-QVTQVIGEVFGLTVRSRHLGSQIGAGLKSMIGGELKGLTKTLVETRNQAMERLVEQAR
Y1684_SYNPW     MLITTTPTIEGRKILHYRGLVTGETIIGANIFRDILASITDVIGGRSKAYEDALMTARDNAIEEMKNRAT
Y1351_SYNJB     MLLTTTDVLQGREVERYLGIVTAEVVYGTNVLRDFLATLRNIIGGRTRTYEEVFENAQKKVLEELEQRAK
Y1287_LACJO     ILVTTTENIPGRKY-EIIGEVFGVTTQSKNAIRDFGAGLKSIVGGEIKAYTSMLTESRDQSIARLRQNAS
Y1285_METMJ     MILTTTEEVPGYAVGEVLGVVSGNTVRAKNVGRDITAGLKSLVGGELEEYTAMLADARTEAYNRMANAAR
Y921_BACHK      MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGSYESKLKEARDIAMDEMKELAK
Y904_BACCZ      MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGSYESKLKEARDIAMDEMKELAK
Y671_THEVO      -------------------------------------------------YSKMLSDTRNTAMERLRDAAE
Y465_CARHZ      MLLATSGRLDGFKVTKYLGIVTGEAIMGTNFIRDLLASISDIIGGRSGAYEQQLEEARNIVLNEMSERAK
Y3751_VIBCH     MIVTTTPNIEGKRIVRYCGVIAGEAILGANIFKDLSAGIRDIVGGRSGTYERELEKARAIALEELQQHAV
Y3711_VIBCM     MIVTTTPNIEGKRIVRYCGVIAGEAILGANIFKDLFAGIRDIVGGRSGTYERELEKARAIALEELQQHAV
Y288_VIBC3      MIVTTTPNIEGKRIVRYCGVIAGEAILGANIFKDLFAGIRDIVGGRSGTYERELEKARAIALEELQQHAV
Y1413_METJA     MITTTTPYIEGKKIIKYLGFVHGVASVYVTVKYYEDVKD---------AYERALRESEDTALIRMVDNAK
Y1012_BACCR     MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGSYESKLKEARDIAMDEMKELAK
Y1001_BACAN     MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGSYESKLKEARDIAMDEMKELAK
Y1527_LACBA     LLVTTTEHIPGKEY-EVIGEVFGLTTQSKNVLRNMGAALKNVVGGEIKDYTKMLDEARNISVDRLRKNAR
Y3206_BACHK     MIVTTTSGIQGKEIIDYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGSYESKLKEARDIAMDEMKELAK
YGI4_BACC1      MIVTTTSTIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGAYESKLKEARDIAMEEMKTFAR
Y734_NITMU      MQLTTTPGIDGKRITRYCGVVAGEAVLGANIFKDLFAGIRDLVGGRSGTYEKELQRARDIALEELQQRAH
Y3016_RHOBA     MPMTTTSTFETHIIEAYRGPVFGETIYGANVLRDISAVFTDVVGGRAGDYEKVLIRGRNAALAEMSERAK
Y1099_LACGA     LLVTTTENIPNQKY-EIIGEVFGVTTQSKNALRDLGAGLKSIVGGEIKAYTSMLTESRDQAINRLCENAA
Y1032_NITEU     MLLTTTPVIEGKRITHYYGIVAGEAVLGANVLKDLFAGIRDFVGGRSGTYEKELQHAREIALEELQENAH
Y5181_BACCR     MIVTTTSTIQGKEIIDYVDIVNGEAIMGANIVRDLFASVRDVVGGRSGAYESKLKEARDIAMEEMKTLAR
Y4874_BACCZ     MIVTTTSTIQGKEIIDYVDIVNGEAIMGANIVRDLFASVRDVVGGRSGAYESKLKEARDIAMEEMKTLAR
Y4859_BACHK     MIVTTTSTIQGKEIIDYVDIVNGEAIMGANIVRDLFASVRDVVGGRSGAYESKLKEARDIAMEEMKTLAR
Y2548_ALTMD     MIVSTTPTLEGHKIDAYYGIVVGEAVMGANVFKDLFASIRDIVGGRSGSYEEELTTARKLAFTELEHEAR
Y1745_PSEPF     MIISTTHSIEGRQITAYLDIVSAESVQGVNVIRDMFAGMRDFFGGRSQTLERALKEARVQATDEIKERAR
Y1282_LACSS     LITTTESIPGKH--YEVLGEVFGLTTQSKNVFKNIGASLKNVVGGEIRAYTEMMTESRDVAIDRLRQNAI
Y3418_PSEF5     MIVTTTAHIEGREIASYLDIVSAESVHGINVVRDLFAGMRDFFGGRSQTLERALKEARIQATNEIKERAR
Y4658_STRAW     LVVTTNDVPGYR-VQHVIGEVFGLTVRSRHLGSQIGAGLKSMIGGELKGLTKTLVETRNQAMERLVEQAR
Y1816_BACCR     MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGAYESKLKDARDIAMDEMKELAK
Y6552_BACAN     MIVTTTAEIQGKEIIEYIDIVNGEAIMGANIVRDVFASVRDVVGGRAGAYESKLKEARDIAMDEMKELAK
Y324_PERMH      MIITTTDFIEGKKIRDYKGVVSKEAVIGVNIIRDVFAKVRDIVGGRSAAYEKELTNARNQILEELKEEAR
Y1500_CLOTE     MILSNLSYIDNKEL-ETINIVEGVCVFSKNVGKDIMASFKNVVGGEIKSYSEMVRDVKDTAVKKMVEEAK
Y1337_SYNP2     MILSTTNTIEGATITSYQGVVTAEVVYGTNALRDFFAGIRDMIGGRTASYERIFEKGHQEALRELESNAQ
Y1111_BACHD     MISTTTHSVEGHEITDYVGIVNGEAIMGANVVRDFLAGISDVIGGRSAAYEDKLAEGRQIAVREMEDRAA
Y2909_PSEPG     MIISTTSQLEGRPIAEYLGVVSSESVQGINXXXXXXXXXXXXXXXXSQTLESALREAREQATEELMARAR
Y2194_PSEA6     MIMTTTPSIEGKKIERYCGIVVGEAVMGANVFRDIFAAIRDVVGGRSGAYEDELTNARQIGFRELEAEAR
Y2155_DESRM     MIITTTGIIEGKPIRQYFGLVNGEAIMGANVVRDIFASITDIVGGRSGAYESKLAHAREIALEEMTEQAR
Y3965_PARDP     MIVTTTPGIEGRRISAYHGVVTGETIIGANIFRDIFAGIRDIVGGRAGAYESALASARETALSEMQDRAR
Y562_BIFLO      ILVTTTPSVDGYTITNYQGIVFGEVVSGVNMFKDLGAGLRNMFGGRSQGYEEELMRARNEAIAEMQQRAE
Y3024_PSEE4     MIISTTSQLEGRPVAEYLGVVSAESVQGINXXXXXXXXXXXXXXXXSQTLESALKEAREQATEELKARAR
Y1357_BIFLD     ILVTTTPSVDGYTITNYQGIVFGEVVSGVNMFKDLGAGLRNMFGGRSQGYEEELMRARNEAIAEMQQRAE
Y093_BIFLI      ILVTTTPSVDGYTITNYQGIVFGEVVSGVNMFKDLGAGLRNMFGGRSQGYEEELMRARNEAIAEMQRRAE
Y1048_GLOVI     MIISTTTAIEGRPVQGYLGVVTGEAILGANVFADFFAKIRDIVGGRSAAYERELRKARQIAMDEMTREAR
Y2816_PSEP1     MIISTTSQLEGRPIAEYLGVVSSESVQGINXXXXXXXXXXXXXXXXSQTLESALREAREQATEELKARAR
Y1118_SYNY3     MLTSTTDIVQGRTIARYHGIVTAEVVYGTNALRDFFAGIRDLIGGRTGSYEQIFEKGHREAIAELTERAQ
Y2873_PSEPK     MIISTTSQLEGRPIAEYLGVVSSESVQGIYXXXXXXXXXXXXXXXXSQTLESALREAREQATEELKARAR
Y060_CORJK      MIVTTTNNVEGHTIGQYLRIVSGETVAGINMFKDIGAGFRNITGGRSSAYEGEILQARETALKEMVDRAL
Y4416_HALS3     MEFVTTETVPGREITESLGVARGNTVKARNVGRDITQSIRNITGGELKAYSEXXXXXXXXXXXXXXXXXX
Y2432_HALSA     MEFVTTETVPGREITESLGVARGNTVKARNVGRDITQSIRNITGGELKAYSEXXXXXXXXXXXXXXXXXX
Y1882_PSEHT     --MLTTETASNLKVLKRLDVITAECVYGMNIFKDILASLSDTFGGRNKSIQNTLRDARRTALTELRKEAY
Y2361_RHOS5     MIVTTTPSVEGHQIATYHGIVTGEAILGANVIRDLFAGITDFIGGRSGAYEKELGRARETALSEMEQAAR
Y2083_LACPL     LLVTTTENIPGHPY-EVIGEVFGLTTQSKNLVRNIGAGLKGLVGGEIKDYTKMLEESRDVAVNRLRDNAS
YK44_RHOS4      MIVTTTPNIEGYQIATYHGIVTGEAILGANVIRDLFAGITDFIGGRSGAYEKELGRARETALSEMEEAAR
Y2093_RHOS1     MIVTTTPNIEGYQIATYHGIVTGEAILGANVIRDLFAGITDFIGGRSGAYEKELGRARETALSEMEEAAR
Y1772_RHOSK     MIVTTTPNIEGYQIATYHGIVTGEAILGANVIRDLFAGITDFIGGRSGAYEKELGRARETALSEMEEAAR
Y2377_PSEPW     MIISTTSQLEGRPIAEYLGVVSSESVQGINXXXXXXXXXXXXXXXXSQTLEGALRLAREQATEELKARAR


                         .         .         *         .         .         .         .:140
query           ELGANAIVAIRYDSSSLGGNTSGTEVFCYGTAVVVR
Y995_FRATM      ELGANAIVAIRYDSSSLGGNTSGTEVFCYGTAVVVR
Y954_FRATT      ELGANAIVAIRYDSSSLGGNTSGTEVFCYGTAVVVR
Y954_FRAT1      ELGANAIVAIRYDSSSLGGNTSGTEVFCYGTAVVVR
Y852_FRATW      ELGANAIVAIRYDSSSLGGNTSGTEVFCYGTAVVVR
Y833_FRATN      ELGANAIVAIRYDSSSLGGNTSGTEVFCYGTAVVVR
Y1322_FRATF     ELGANAIVAIRYDSSSLGGNTSGTEVFCYGTAVVVR
Y1249_FRATH     ELGANAIVAIRYDSSSLGGNTSGTEVFCYGTAVVVR
Y1226_FRATO     ELGANAIVAIRYDSSSLGGNTSGTEVFCYGTAVVVR
Y1786_FRAP2     ELGANAIVAIRYDXXXXXXXXXXXEVFCYGTAVVIR
Y273_LEGPC      ALNANGIIAMRYDTGEIG--QAGTEVLCYGTAVII-
Y197_LEGPH      ALNANGIIAMRYDTGEIG--QAGTEVLCYGTAVII-
Y253_LEGPL      ALNANGIIAMRYDTGEIG--QAGTEVLCYGTAVII-
Y255_LEGPA      ALNANGIIAMRYDTGEIG--QAGTEVLCYGTAVII-
Y595_BURS3      KVGANAIVAMRYDSTEIGSGV--TEVICYGTAVIV-
Y4940_BURM1     RLGANAVVAMRYDSTEIGSGV--TEVICYGTAVQV-
Y3406_BURVG     KLGANAIVAMRYDSTEIGSGV--TEVICYGTAVCV-
Y5217_BURCC     KLGANAIVAMRYDSTEIGSGV--TEVICYGTAVRV-
Y5002_BURA4     KLGANAIVAMRYDSTEIGSGI--TEVICYGTAVQV-
Y5745_BURCJ     KLGANAIVAMRYDSTEIGSGV--TEVICYGTAVQV-
Y4477_BURCM     KLGANAVVAMRYDSTEIGSGI--TEVICYGTAVQV-
Y5168_BACLD     ELGANAIVGLRFELSA-GQGTS--ELIGYGTAVVI-
Y873_SULIY      ELGANAVVNIRFDSNEL--NQSMDEIIAYGTAVKV-
Y2656_BURTA     QMGGNAIVGMRYDATEIASGV--TEVLCYGTAV---
Y1976_SULSO     ALGANAVVNVRFDSNEL--SEAMDEIIAYGTAVVV-
Y1283_VIBPA     QKGADAIVGIRFTTSSIVDGSS--EILAFGTAV---
Y904_BURMA      RMGGNAIVGMRYDATEIASGV--TEVLCYGTAV---
Y3233_BURMS     RMGGNAIVGMRYDATEIASGV--TEVLCYGTAV---
Y3215_BURM7     RMGGNAIVGMRYDATEIASGV--TEVLCYGTAV---
Y2746_BURM9     RMGGNAIVGMRYDATEIASGV--TEVLCYGTAV---
Y2003_BURPS     RMGGNAIVGMRYDATEIASGV--TEVLCYGTAV---
Y1822_BURP1     RMGGNAIVGMRYDATEIASGV--TEVLCYGTAV---
Y1667_BURP0     RMGGNAIVGMRYDATEIASGV--TEVLCYGTAV---
Y1644_BURP6     RMGGNAIVGMRYDATEIASGV--TEVLCYGTAV---
Y1756_PYRFU     KLGANAVVNFRFATSNVGGGMA--EVYAYGTAVVV-
Y1066_BACA2     QLGANAIVGLRFELTA-GQNTS--ELIGYGTAV---
Y2090_VIBHB     NLGADAVVGIRFTTSSIVDGSS--EILAFGTAV---
Y426_FERNB      KLGADAVIGLRFGSSSV--MQSAAEILAYGTAVKLR
Y882_CLOPE      SLGANAIIEMRLVSSSLAAGAA--EMVAYGTAVI--
Y1434_THEAB     KIGADAVVNVRFSSSSV--MSGAAEMLAYGTAVKIK
Y876_CLOP1      SLGANAIIGMRLVSSSLAAGAA--EMVAYGTAVI--
Y1617_DEHE1     EKGANAIICVRFSTSAVMQNAS--EVMAYGTAVIV-
Y1264_THELT     KLGADAIVGIKFGSSSV--MQSAAEVLAYGTAVKIK
Y4322_CHRVO     ALGADAVIGMRYDATEV--MTGLTEVLCYGTAV---
Y1711_DEHSC     EKGANAIICVRFSTSAVMQNAS--EVMAYGTAVIV-
Y1363_DEHSB     EKGANAIICVRFSTSAVMQNAS--EVMAYGTAVIV-
Y1985_HAHCH     GMGANAVINVRFATSSVA--QGAAELFVYGTAVVM-
Y1015_HALLT     ALGADGVINVRFTTSSIA--DSGAEILAYGTAVRLR
Y545_ANATD      MLGANAVVGIDIDYEVLGANGSMLMVSVTGTAVVV-
Y1129_THEM4     KLGADAIVSVRFSSSAI--MSGAAEILVYGTAV---
Y2946_ACIAD     QLGANAIVGIRFSTSNIAQGAS--ELFVYGTAVIVQ
Y2732_PARD8     RMGANAVIAVDLDYETVGGSGSMLMVTAAGTAV---
Y1325_HYPNA     RLRADAIVGVKFDYSVIGQGGSMMMVAVSGTAVTL-
Y771_CALS8      MLGANAVVGIDIDYEVLGTNGSMLMVSVTGTAVVV-
Y6695_BRASO     SMGANAIVMMRFDSAEIGQTMS--EIVAYGTAAVI-
Y381_PSYIN      EKGADAVVGIRFTTSAIMDGSS--EIMAFGTAVKLK
Y3680_BURP8     MLGANAVIGMRYDATEIGAGV--TEVLCYGTAVHAR
Y208_LISGR      ALGANAIIAVDVDYEVLGADNGMLMVSVSGTAVVV-
Y4599_SOLUE     QLGANAVIGMQYDATEIMQGV--TEVLAYGTAVEV-
Y2095_SHEFN     QKGADAIVGIRFTTSAIMDGSS--EIMAFGTAV---
Y1624_METVS     MLGADAVVGLRFGTSSV--LPGSAEFLCYGTAVTLK
Y1828_METM6     RRGADAVVGVRFETSSILAGSA--EFLCYGTAVKLK
Y1080_SULTO     ALGANAVISVRFDSNELAQNMD--EIIAYGTAVVV-
Y490_PYRAB      ELGANAVVNMRFATSNLGG--SMAEIYAYGTAVVI-
Y1658_SERP5     ELGANAVVGIDIDYETVGKDSSMLMVTVSGTAVKV-
Y1668_PASMU     RLGANAVVGVEVNYTSINGGKSMFMIVASGTAVVVR
Y2504_CLOBB     QIGANAVVGVDIDYEVLGADNGMLMVTASGTAV---
Y165_THEP1      KLGADAVIGFRYSSSTI--MSGAAEILAYGTAV---
Y163_THESQ      KLGADAVIGFRYSSSTI--MSGAAEILAYGTAV---
YBG4_VIBVU      ELGANAIVGVDIDYEVLGQSNGMLMVSASGTAVVI-
Y763_THEMA      KLGADAVIGFRYSSSTI--MSGAAEILAYGTAV---
Y4283_VIBVY     ELGANAIVGVDIDYEVLGQSNGMLMVSASGTAVVI-
Y2458_COLP3     EKGADAVVGIRFTTSAIMDGSS--EIMVFGTAVKLK
Y208_LISWE      DIGANAVIGVDIDYEVLGADNGMLMVTASGTAVVI-
Y1926_PYRKO     ELGANAVVNVRFATSNVG--SSVAEVYAYGTAVVV-
Y170_LISW6      DIGANAVIGVDIDYEVLGADNGMLMVTASGTAVVI-
Y1349_HAEDU     NIGANAVIGVSIQYQSMGKKDMFI-IVATGTAVVI-
Y2435_LISMH     DIGANAVIGVDIDYEVLGADNGMLMVTASGTAVVI-
Y240_LISIN      DIGANAVIGVDIDYEVLGADNGMLMVTASGTAVVI-
Y219_LISMF      DIGANAVIGVDIDYEVLGADNGMLMVTASGTAVVI-
Y2109_ACIC1     ARGANAILAMRFDTSEIGG--MWTEICAYGTAARV-
Y208_LISMO      DIGANAVIGVDIDYEVLGADNGMLMVTASGTAVVI-
Y208_LISIV      DIGANAVIGVDIDYEVLGADNGMLMVTASGTAVVI-
Y206_LISMC      DIGANAVIGVDIDYEVLGADNGMLMVTASGTAVVI-
Y869_ARCFU      KLGADAVVNVRFTTSQT--MAGAAELLAYGTAVRLR
Y532_ALKMQ      GVGADAIINIRYASSAVMGGAA--EIMVYGTAV---
Y398_CLOTH      QMGANAIIGVDIDYEVLGQGGNMLMVTASGTAVVI-
Y3383_METAC     KMGADAVVNVRFMTSMV--MAGAAEILAYGTAVKI-
Y3040_UNCMA     EMGANAVVSVGFDSSDIGQNMS--EVLAFGTAVTV-
Y182_THEAC      QIGANAVINVRFDSSDIG--QVMTEIVAYGTAVLV-
Y1405_GEOKA     SLGANAVIGVDLDFETLRDGM----MMCIATGTAVR
Y4184_PHOPR     SQGADAIVNLRFTTSAIMQGAS--EILAYGTAV---
Y2433_CLOK5     AVGANAVIGIDIDYEVLGQGGNMLMVTASGTAVVV-
Y2237_CITK8     ALGADAVVGIDIDYETVGKDSSMLMVSVSGTAVKTR
Y1800_HELHP     ALGANGIIGISYVTSSLMSNTS--EVLVYGTAVKI-
Y3410_BACTN     KLGANAVIGVDLDYETVGGSGSMLMVTANGTAVTI-
Y270_BACFR      QMGANAVIGVDLDYETVGGSGSMLMVTASGTAV---
Y226_BACFN      QMGANAVIGVDLDYETVGGSGSMLMVTASGTAV---
Y208_LISSE      DIGANAVIGVDIDYEVLGADNGMLMVTASGTAVVI-
Y1853_PSYA2     ALGADAVVGLRFSTSSIAQGAS--ELFVYGTAV---
Y2273_CLOBA     QMGANAVVGVDIDYEVLGSDNGMLMVTASGTAV---
Y1682_PYRHO     ELGANAVVNFRFATSNLGG--SMAEIYAYGTAVVV-
Y347_PICTO      AMGATAVINMRFDTSDMA--QAMTEIVAYGTAVV--
Y1021_METB6     TMGANAVIGVSFDSSETGGVM--TEVLAYGTAVVV-
Y465_ACTP2      RVGANAVVGVSMEYQSMGGDKGMFIVVATGTAVVIR
Y170_CLONN      SLGADAVINIRYATSAI--MQGAAEVIVYGTAVKI-
YBJQ_SALTY      ALGADAVVGIDIDYETVGKDGSMLMVSVSGTAVKTR
YBJQ_SALTI      ALGADAVVGIDIDYETVGKDGSMLMVSVSGTAVKTR
YBJQ_SALSV      ALGADAVVGIDIDYETVGKDGSMLMVSVSGTAVKTR
YBJQ_SALPK      ALGADAVVGIDIDYETVGKDGSMLMVSVSGTAVKTR
YBJQ_SALPB      ALGADAVVGIDIDYETVGKDGSMLMVSVSGTAVKTR
YBJQ_SALPA      ALGADAVVGIDIDYETVGKDGSMLMVSVSGTAVKTR
YBJQ_SALNS      ALGADAVVGIDIDYETVGKDGSMLMVSVSGTAVKTR
YBJQ_SALHS      ALGADAVVGIDIDYETVGKDGSMLMVSVSGTAVKTR
YBJQ_SALG2      ALGADAVVGIDIDYETVGKDGSMLMVSVSGTAVKTR
YBJQ_SALEP      ALGADAVVGIDIDYETVGKDGSMLMVSVSGTAVKTR
YBJQ_SALDC      ALGADAVVGIDIDYETVGKDGSMLMVSVSGTAVKTR
YBJQ_SALCH      ALGADAVVGIDIDYETVGKDGSMLMVSVSGTAVKTR
YBJQ_SALAR      ALGADAVVGIDIDYETVGKDGSMLMVSVSGTAVKTR
YBJQ_SALA4      ALGADAVVGIDIDYETVGKDGSMLMVSVSGTAVKTR
Y542_ACTP7      RVGANALVGVSMEYQSMGGDKGMFIVVATGTAVVIR
Y492_ACTPJ      RVGANALVGVSMEYQSMGGDKGMFIVVATGTAVVIR
YBJQ_SHISS      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_SHIF8      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_SHIDS      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_SHIBS      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_SHIB3      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_ESCF3      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_ECOUT      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_ECOSM      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_ECOSE      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_ECOLU      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_ECOLI      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_ECOLC      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_ECOL6      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_ECOL5      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_ECOK1      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_ECOHS      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_ECODH      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_ECOBW      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_ECO8A      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_ECO81      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_ECO7I      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_ECO5E      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_ECO57      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_ECO55      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_ECO45      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_ECO27      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
YBJQ_ECO24      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
Y544_METTH      ELGANAVISVRFDSDSISDIMQ--EILAYGTAVIV-
Y1711_CLOD6     AKGANAVIAFRLSSASV--MQGAAEMLAYGTAVVL-
Y1703_PECCP     DLGANAVVGIDLDYETVGKDGSMLMVTVSGTAVKVR
Y1024_HAMD5     SLGANAVVGINIDYEVVGTSNSMLMVSIYGTAVKI-
YF81_THET2      RLGAHAVLGVRYATASV--MQGAAEILVYGTAV---
Y3412_STRCO     ARGANAVLSFRFDVTEAA--DVGTEVCAYGTAVVV-
Y2462_CAUCN     KLGANAILAVDLDYNTVGPQGSMMMVSVSGTAVVL-
Y2377_CAUCR     KLGANAILAVDLDYNTVGPQGSMMMVSVSGTAVVL-
Y1944_THET8     RLGAHAVLGVRYATASV--MQGAAEILVYGTAV---
Y572_AZOSB      KLGANAVIGIDIDYEVLGQDNGMLMVCVSGTAVI--
Y338_SPHAL      KLGGNAVIGVDIDYEVLGQNGSMLMVSASGTAVVI-
Y2666_ERWCT     DLGANAIVGIDLDYETVGKDGSMLMVTVSGTAVKVR
Y1382_ENT38     ALGADAVVGIDIDYETVGKDASMLMVSVSGTAVKTR
YBJQ_SHIFL      ALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVKTR
Y3855_DESHD     RMGANAVVGVDIDYEVVGQSGSMLMVSASGTAVTV-
Y2697_DESHY     RMGANAVVGVDIDYEVVGQSGSMLMVSASGTAVTV-
Y241_ENTFA      KLGADAVVMMRFDSGTIG--TDMQSVVAYGTAV---
Y637_OENOB      KIGANAVTMMRFDSNEANGIMS---VVAYGTAVKV-
YY10_ENTFA      NIGADAIIAMRFDSGSISNDMQ--SVVAYGTAV---
Y1588_ANOFW     NMGANAVIGVDLDFETLRDGM----MMCIATGTAVK
Y1243_SILST     ALGANAVVGVDLDYEVVG--QSMLMVSASGTAVVI-
Y3728_DELAS     ELGANAVVGVDLDYEVLGQGNGMLMVSASGTAVVL-
YJFJ_LACLA      AKGANAIVAMRFDSSTFQNIDS---VAAYGTAVKI-
Y643_BACHD      AKGANAVIGFRLQTSTVMANAA--EIIAYGTAVEV-
Y3795_TRIEI     RMGANAVVGIEIDTGTINVDEKGALITAIGTAV---
Y2580_AERHH     ALGANAVVGIDIDYEVVGQSGSMLMVSISGTAVLV-
Y1596_LACLM     AKGANAIVAMRFDSSTFQNIDS---VAAYGTAVKI-
Y1006_LACLS     AKGANAIVAMRFDSSTFQNIDS---VAAYGTAVKI-
Y2470_ENTS8     SLGADAVVGIDIDYETVGKDGSMLMVSVSGTAVKTR
Y2258_SYNJA     RLGANGILGV-----SIHTNMSATMILAAGTAVKLR
Y4817_NOSP7     RLGANAVIGIEIDTGTINLDQSGVLLLITATGTAVK
Y711_LACCB      KAGGDAVVMMRFDSGSIGGDMQ--SVVAYGTAV---
Y651_LACC3      KAGGDAVVMMRFDSGSIGGDMQ--SVVAYGTAV---
Y2690_PELTS     RLGANAVVGIDID-----------------------
Y2488_ANASP     RLGANAVIGIEIDTGTINVDQSGVLLLITATGTAVR
Y1619_AZOSE     RLGANAVVGVDIDYEVLGEKNGMLMVAVSGTAVTV-
Y1614_LACS1     EKGADAIVMMRFDSGSILQDMQ--SVVAYGTAV---
Y1265_GEOTN     KLGANAVIGVDLDFETLRDGM----MMCIATGTAVK
YA95_BACC1      QKGANAIVGIDVD-----------------------
Y420_ANAVT      RLGANAVIGIEIDTGTINVDQSGVLLLITATGTAVR
Y4080_STRGG     ARGANAVLMMRFDVTEAA--DVGTEVCAYGTAAVI-
Y1684_SYNPW     LMQANAIVGVDLDYEVFG------------------
Y1351_SYNJB     RLGANGILGVSIHTNM---STTMILVTAAGTAVKLR
Y1287_LACJO     EMGANAVVMMRFDSGSIAGDMQ--SVVAYGTAV---
Y1285_METMJ     DLGADAVVNVRFATSQT--MXXXXXXXXYGTAV---
Y921_BACHK      QKGANAIVGVDVD-----------------------
Y904_BACCZ      QKGANAIVGVDVD-----------------------
Y671_THEVO      QVGANAVIELRFDSSDIG--QVMTEIVAYGTAVVV-
Y465_CARHZ      RLGANAVIGISLDYESVG--QSMLMVVATGTAVYI-
Y3751_VIBCH     ALGANAVVGIDLDYETFGKANGMLMVSVSGTAVVV-
Y3711_VIBCM     ALGANAVVGIDLDYETFGKANGMLMVSVSGTAVVV-
Y288_VIBC3      ALGANAVVGIDLDYETFGKANGMLMVSVSGTAVVV-
Y1413_METJA     KLGANAIIGINSNYAMVGEKGDMIMVGIYGTAVVV-
Y1012_BACCR     QKGANAIVGVDVD-----------------------
Y1001_BACAN     QKGANAIVGVDVD-----------------------
Y1527_LACBA     DMGADAVVMMRFDSGSIG--TDMQSVAAYGTAV---
Y3206_BACHK     QKGANAIVGIDVD-----------------------
YGI4_BACC1      QKNANAIVGIDVD-----------------------
Y734_NITMU      DLGANAVVGIDIDYEVLGKENGMLMVSASGTAVIV-
Y3016_RHOBA     QLGANAVIGIRFDYSTVG--RSMLMICSSGTAVI--
Y1099_LACGA     NLGADAVVMMRFDSGSIAGDMQ--SVVAYGTAV---
Y1032_NITEU     RLGANAVIGIDIDYEVLGKENGMLMVSVSGTAVFV-
Y5181_BACCR     QKNANAIVGIDVD-----------------------
Y4874_BACCZ     QKNANAIVGIDVD-----------------------
Y4859_BACHK     QKNANAIVGIDVD-----------------------
Y2548_ALTMD     SMGANAVVGIDLDYQVIGDKGSMLMVSISGTAV---
Y1745_PSEPF     ALQADAVVGVDFEISMPAGKGGMVVVFATGTAVKLR
Y1282_LACSS     EMGADAVVMMRFDSGSIG--TDMQSVAAYGTAV---
Y3418_PSEF5     QCNADAVVGVDFEISMPAGRGGMVVVFATGTAV---
Y4658_STRAW     VRGGNGILMMRFDVTEAA--DVGTEVCAYGTAVVL-
Y1816_BACCR     QKGANAIIGIDVD-----------------------
Y6552_BACAN     QKGVNAIVGIDVD-----------------------
Y324_PERMH      NLGANAVIGINF---SYEMYQSMLLVSVWGTAVVV-
Y1500_CLOTE     NLGADAVINIRYAMTSM-SQGSTLAVIVSGTAVKVK
Y1337_SYNP2     KRGADAVIGISMDTGTINVDDKGVLLLITATGTAVK
Y1111_BACHD     QLGADAVVGVMLDFETLRDGM----LMCVATGTAVK
Y2909_PSEPG     QLQADAIVGVDFEISMPSVQGGMVVVFATGTAV---
Y2194_PSEA6     SMGANAVVGIDIDYEVVGKGGSMLMVSISGTAV---
Y2155_DESRM     RMGANAIVGVDLD-----------------------
Y3965_PARDP     QLGGNAVVGVDLDNNMLMVSASGTAV----------
Y562_BIFLO      AMGAHAVVGVDIDYEVLGADNGMLMVTASGTAVQI-
Y3024_PSEE4     QLQADAVVGVDFEISMPSVQGGMVVVFATGTAV---
Y1357_BIFLD     AMGAHAVVGVDIDYEVLGADNGMLMVTASGTAVQI-
Y093_BIFLI      AMGAHAVVGVDIDYEVLGADNGMLMVTASGTAVQI-
Y1048_GLOVI     ELGADGVIGVDIDYETIAVPEGGSMVSVSGTAV---
Y2816_PSEP1     QLQADAVVGVDFEISMPSVQGGMVVVFATGTAV---
Y1118_SYNY3     KLGANGVIGVAVNTGTINIDDRGALITATGTAVTV-
Y2873_PSEPK     QLQADAVVGVDFEISMPSVQGGMVVVFATGTAV---
Y060_CORJK      EMGAHGIVGVDVDYESLG------------------
Y4416_HALS3     SMGADAVVNVRLESSEIA--NGGSEVIAYGTAVTL-
Y2432_HALSA     SMGADAVVNVRLESSEIA--NGGSEVIAYGTAVTL-
Y1882_PSEHT     SLGANAVIGIDLDYSEIGGKAGMLFIVASGTAVII-
Y2361_RHOS5     AKGANAVVGVDLDNNMLMVSASGTAV----------
Y2083_LACPL     AMGADAVVMMRFDTGSISQDMQ--SVAAYGTAV---
YK44_RHOS4      AKGANAVVGVDLDNNMLMVSASGTAV----------
Y2093_RHOS1     AKGANAVVGVDLDNNMLMVSASGTAV----------
Y1772_RHOSK     AKGANAVVGVDLDNNMLMVSASGTAV----------
Y2377_PSEPW     QLQADAVVGVDFEISMPSVQGGMVVVFATGTAV---