[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30919.1

[Show Plain Result]


## Summary of Sequence Search
    1::206
    5::202     5e-43  47%  217 aa  GCH1_VIBHB RecName: Full=GTP cyclohydrolase 1;       
    5::202     5e-43  45%  218 aa  GCH1_HAEDU RecName: Full=GTP cyclohydrolase 1;       
    5::202     6e-43  47%  217 aa  GCH1_VIBCH RecName: Full=GTP cyclohydrolase 1;       
    9::202     9e-42  45%  218 aa  GCH1_ACTPJ RecName: Full=GTP cyclohydrolase 1;       
    9::202     9e-42  45%  218 aa  GCH1_ACTP7 RecName: Full=GTP cyclohydrolase 1;       
    9::202     9e-42  45%  218 aa  GCH1_ACTP2 RecName: Full=GTP cyclohydrolase 1;       
    9::202     2e-40  43%  218 aa  GCH1_PASMU RecName: Full=GTP cyclohydrolase 1;       
    9::202     4e-40  43%  218 aa  GCH1_MANSM RecName: Full=GTP cyclohydrolase 1;       
   11::202     7e-40  43%  218 aa  GCH1_HAES2 RecName: Full=GTP cyclohydrolase 1;       
   11::202     7e-40  43%  218 aa  GCH1_HAES1 RecName: Full=GTP cyclohydrolase 1;       
   10::202     1e-39  43%  218 aa  GCH1_HAEIE RecName: Full=GTP cyclohydrolase 1;       
   10::202     1e-39  43%  218 aa  GCH1_HAEI8 RecName: Full=GTP cyclohydrolase 1;       
   11::202     3e-39  45%  216 aa  GCH1_WIGBR RecName: Full=GTP cyclohydrolase 1;       
   10::202     6e-39  42%  218 aa  GCH1_HAEIN RecName: Full=GTP cyclohydrolase 1;       
   11::202     6e-39  43%  221 aa  GCH1_BLOFL RecName: Full=GTP cyclohydrolase 1;       
   10::202     7e-39  42%  218 aa  GCH1_HAEIG RecName: Full=GTP cyclohydrolase 1;       
   62::202     4e-37  50%  217 aa  GCH1_VIBPA RecName: Full=GTP cyclohydrolase 1;       
   11::190     5e-37  44%  221 aa  GCH1_ERWT9 RecName: Full=GTP cyclohydrolase 1;       
   60::202     9e-37  48%  216 aa  GCH1_TOLAT RecName: Full=GTP cyclohydrolase 1;       
    5::188     1e-36  44%  220 aa  GCH1_PECCP RecName: Full=GTP cyclohydrolase 1;       
    5::202     2e-36  42%  217 aa  GCH1_VIBVY RecName: Full=GTP cyclohydrolase 1;       
    5::202     2e-36  42%  217 aa  GCH1_VIBVU RecName: Full=GTP cyclohydrolase 1;       
    5::188     2e-36  44%  220 aa  GCH1_ERWCT RecName: Full=GTP cyclohydrolase 1;       
   62::204     3e-36  48%  217 aa  GCH1_PHOPR RecName: Full=GTP cyclohydrolase 1;       
    5::188     6e-36  43%  221 aa  GCH1_SODGM RecName: Full=GTP cyclohydrolase 1;       
   11::202     6e-36  41%  221 aa  GCH1_BLOPB RecName: Full=GTP cyclohydrolase 1;       
   47::204     2e-35  46%  223 aa  GCH1_FLAJ1 RecName: Full=GTP cyclohydrolase 1;       
   11::204     6e-35  40%  217 aa  GCH1_VIBFM RecName: Full=GTP cyclohydrolase 1;       
   11::204     6e-35  40%  217 aa  GCH1_VIBF1 RecName: Full=GTP cyclohydrolase 1;       
    5::188     6e-35  43%  220 aa  GCH1_EDWI9 RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_SHISS RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_SHIFL RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_SHIF8 RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_SHIDS RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_SHIBS RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_SHIB3 RecName: Full=GTP cyclohydrolase 1;       
    5::188     1e-34  43%  221 aa  GCH1_SERP5 RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_ESCF3 RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_ECOUT RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_ECOSM RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_ECOSE RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_ECOLU RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_ECOLI RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_ECOLC RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_ECOL6 RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_ECOL5 RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_ECOK1 RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_ECOHS RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_ECODH RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_ECOBW RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_ECO8A RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_ECO81 RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_ECO7I RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_ECO5E RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_ECO57 RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_ECO55 RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_ECO45 RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_ECO27 RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-34  41%  222 aa  GCH1_ECO24 RecName: Full=GTP cyclohydrolase 1;       
   62::204     5e-34  45%  217 aa  GCH1_ALISL RecName: Full=GTP cyclohydrolase 1;       
    5::206     9e-34  41%  220 aa  GCH1_HAMD5 RecName: Full=GTP cyclohydrolase 1;       
    4::201     1e-33  39%  214 aa  GCH1_SHELP RecName: Full=GTP cyclohydrolase 1;       
   29::202     8e-33  41%  218 aa  GCH1_AERHH RecName: Full=GTP cyclohydrolase 1;       
   61::201     2e-32  45%  217 aa  GCH1_SHEDO RecName: Full=GTP cyclohydrolase 1;       
    5::190     2e-32  41%  222 aa  GCH1_ENT38 RecName: Full=GTP cyclohydrolase 1;       
    5::188     4e-32  40%  220 aa  GCH1_YERPY RecName: Full=GTP cyclohydrolase 1;       
    5::188     4e-32  40%  220 aa  GCH1_YERPG RecName: Full=GTP cyclohydrolase 1;       
    5::188     4e-32  40%  220 aa  GCH1_YERPE RecName: Full=GTP cyclohydrolase 1;       
    5::188     4e-32  40%  220 aa  GCH1_YERPB RecName: Full=GTP cyclohydrolase 1;       
    5::188     4e-32  40%  220 aa  GCH1_YERP3 RecName: Full=GTP cyclohydrolase 1;       
    5::190     4e-32  39%  222 aa  GCH1_CITK8 RecName: Full=GTP cyclohydrolase 1;       
    5::190     7e-32  40%  222 aa  GCH1_SALTY RecName: Full=GTP cyclohydrolase 1;       
    5::190     7e-32  40%  222 aa  GCH1_SALTI RecName: Full=GTP cyclohydrolase 1;       
    5::190     7e-32  40%  222 aa  GCH1_SALSV RecName: Full=GTP cyclohydrolase 1;       
    5::190     7e-32  40%  222 aa  GCH1_SALPK RecName: Full=GTP cyclohydrolase 1;       
    5::190     7e-32  40%  222 aa  GCH1_SALPC RecName: Full=GTP cyclohydrolase 1;       
    5::190     7e-32  40%  222 aa  GCH1_SALPB RecName: Full=GTP cyclohydrolase 1;       
    5::190     7e-32  40%  222 aa  GCH1_SALPA RecName: Full=GTP cyclohydrolase 1;       
    5::190     7e-32  40%  222 aa  GCH1_SALNS RecName: Full=GTP cyclohydrolase 1;       
    5::190     7e-32  40%  222 aa  GCH1_SALHS RecName: Full=GTP cyclohydrolase 1;       
    5::190     7e-32  40%  222 aa  GCH1_SALEP RecName: Full=GTP cyclohydrolase 1;       
    5::190     7e-32  40%  222 aa  GCH1_SALDC RecName: Full=GTP cyclohydrolase 1;       
    5::190     7e-32  40%  222 aa  GCH1_SALCH RecName: Full=GTP cyclohydrolase 1;       
    5::190     7e-32  40%  222 aa  GCH1_SALAR RecName: Full=GTP cyclohydrolase 1;       
    5::190     7e-32  40%  222 aa  GCH1_SALA4 RecName: Full=GTP cyclohydrolase 1;       
   29::202     7e-32  40%  218 aa  GCH1_AERS4 RecName: Full=GTP cyclohydrolase 1;       
   61::203     9e-32  45%  220 aa  GCH1_BAUCH RecName: Full=GTP cyclohydrolase 1;       
    5::190     1e-31  40%  222 aa  GCH1_SALG2 RecName: Full=GTP cyclohydrolase 1;       
    5::188     2e-31  40%  220 aa  GCH1_YERE8 RecName: Full=GTP cyclohydrolase 1;       
    5::190     2e-31  39%  222 aa  GCH1_KLEP7 RecName: Full=GTP cyclohydrolase 1;       
   51::188     4e-31  45%  219 aa  GCH1_PHOLL RecName: Full=GTP cyclohydrolase 1;       
    5::190     4e-31  39%  222 aa  GCH1_KLEP3 RecName: Full=GTP cyclohydrolase 1;       
    4::201     1e-30  37%  216 aa  GCH1_SHEAM RecName: Full=GTP cyclohydrolase 1;       
    4::201     5e-30  35%  216 aa  GCH1_SHEB9 RecName: Full=GTP cyclohydrolase 1;       
    4::201     5e-30  35%  216 aa  GCH1_SHEB8 RecName: Full=GTP cyclohydrolase 1;       
    4::201     5e-30  35%  216 aa  GCH1_SHEB5 RecName: Full=GTP cyclohydrolase 1;       
    4::201     5e-30  35%  216 aa  GCH1_SHEB2 RecName: Full=GTP cyclohydrolase 1;       
    4::201     6e-30  37%  216 aa  GCH1_SHESR RecName: Full=GTP cyclohydrolase 1;       
    4::201     6e-30  37%  216 aa  GCH1_SHESM RecName: Full=GTP cyclohydrolase 1;       
    4::201     6e-30  37%  216 aa  GCH1_SHESA RecName: Full=GTP cyclohydrolase 1;       
   60::201     1e-29  41%  216 aa  GCH1_SHEON RecName: Full=GTP cyclohydrolase 1;       
    4::201     2e-29  35%  214 aa  GCH1_SHESW RecName: Full=GTP cyclohydrolase 1;       
    4::201     2e-29  35%  214 aa  GCH1_SHEPC RecName: Full=GTP cyclohydrolase 1;       
    7::170     7e-29  38%  188 aa  GCH1_THETN RecName: Full=GTP cyclohydrolase 1;       
    7::172     7e-29  41%  187 aa  GCH1_DESRM RecName: Full=GTP cyclohydrolase 1;       
   15::204     1e-28  36%  218 aa  GCH1_BUCAP RecName: Full=GTP cyclohydrolase 1;       
   10::171     3e-28  41%  192 aa  GCH1_CARHZ RecName: Full=GTP cyclohydrolase 1;       
    7::170     2e-27  36%  188 aa  GCH1_THEPX RecName: Full=GTP cyclohydrolase 1;       
    7::170     2e-27  36%  188 aa  GCH1_THEP3 RecName: Full=GTP cyclohydrolase 1;       
    9::170     1e-26  38%  187 aa  GCH1_STRA1 RecName: Full=GTP cyclohydrolase 1;       
    7::172     1e-26  40%  188 aa  GCH1_PELTS RecName: Full=GTP cyclohydrolase 1;       
    9::170     2e-26  38%  187 aa  GCH1_STRA3 RecName: Full=GTP cyclohydrolase 1;       
   15::189     2e-26  41%  207 aa  GCH1_THEFY RecName: Full=GTP cyclohydrolase 1;       
   10::172     3e-26  39%  187 aa  GCH1_FUSNN RecName: Full=GTP cyclohydrolase 1;       
    9::170     5e-26  37%  187 aa  GCH1_STRA5 RecName: Full=GTP cyclohydrolase 1;       
   12::174     7e-26  42%  192 aa  GCH1_STRMU RecName: Full=GTP cyclohydrolase 1;       
    7::171     2e-25  39%  188 aa  GCH1_THEYD RecName: Full=GTP cyclohydrolase 1;       
   13::170     2e-25  38%  187 aa  GCH1_STRGC RecName: Full=GTP cyclohydrolase 1;       
    9::175     2e-25  36%  190 aa  GCH1_CLOD6 RecName: Full=GTP cyclohydrolase 1;       
   31::175     2e-25  42%  190 aa  GCH1_RICTY RecName: Full=GTP cyclohydrolase 1;       
   10::173     2e-25  38%  189 aa  GCH1_LACPL RecName: Full=GTP cyclohydrolase 1;       
   31::175     3e-25  43%  190 aa  GCH1_RICFE RecName: Full=GTP cyclohydrolase 1;       
    8::167     4e-25  39%  185 aa  GCH1_PERMH RecName: Full=GTP cyclohydrolase 1;       
    9::172     4e-25  39%  189 aa  GCH1_LISMO RecName: Full=GTP cyclohydrolase 1;       
    9::172     4e-25  39%  189 aa  GCH1_LISMH RecName: Full=GTP cyclohydrolase 1;       
    9::172     4e-25  38%  190 aa  GCH1_BACA2 RecName: Full=GTP cyclohydrolase 1;       
    6::168     5e-25  39%  185 aa  GCH1_CLOK5 RecName: Full=GTP cyclohydrolase 1;       
    6::168     5e-25  39%  185 aa  GCH1_CLOK1 RecName: Full=GTP cyclohydrolase 1;       
    3::174     5e-25  38%  187 aa  GCH1_BREBN RecName: Full=GTP cyclohydrolase 1;       
    9::172     5e-25  39%  190 aa  GCH1_BACSU RecName: Full=GTP cyclohydrolase 1;       
   24::183     8e-25  39%  201 aa  GCH1_STRGG RecName: Full=GTP cyclohydrolase 1;       
   53::164     8e-25  47%  183 aa  GCH1_LEPBP RecName: Full=GTP cyclohydrolase 1;       
   53::164     8e-25  47%  183 aa  GCH1_LEPBA RecName: Full=GTP cyclohydrolase 1;       
    9::172     1e-24  38%  189 aa  GCH1_LISMF RecName: Full=GTP cyclohydrolase 1;       
    9::172     1e-24  38%  189 aa  GCH1_LISMC RecName: Full=GTP cyclohydrolase 1;       
    9::172     1e-24  38%  189 aa  GCH1_LISIN RecName: Full=GTP cyclohydrolase 1;       
    9::173     1e-24  39%  188 aa  GCH1_BACHD RecName: Full=GTP cyclohydrolase 1;       
   19::182     1e-24  38%  196 aa  GCH1_CORA7 RecName: Full=GTP cyclohydrolase 1;       
    9::172     2e-24  38%  189 aa  GCH1_LISW6 RecName: Full=GTP cyclohydrolase 1;       
    7::169     2e-24  35%  187 aa  GCH1_CLOTH RecName: Full=GTP cyclohydrolase 1;       
   16::179     2e-24  41%  196 aa  GCH1_CORGL RecName: Full=GTP cyclohydrolase 1;       
    1::170     3e-24  36%  187 aa  GCH1_STRT2 RecName: Full=GTP cyclohydrolase 1;       
    1::170     3e-24  36%  187 aa  GCH1_STRT1 RecName: Full=GTP cyclohydrolase 1;       
   58::164     3e-24  46%  183 aa  GCH1_LEPBL RecName: Full=GTP cyclohydrolase 1;       
   58::164     3e-24  46%  183 aa  GCH1_LEPBJ RecName: Full=GTP cyclohydrolase 1;       
   24::183     4e-24  40%  201 aa  GCH1_STRCO RecName: Full=GTP cyclohydrolase 1;       
   31::175     4e-24  43%  190 aa  GCH1_RICPR RecName: Full=GTP cyclohydrolase 1;       
    9::172     4e-24  36%  189 aa  GCH1_LYSSC RecName: Full=GTP cyclohydrolase 1;       
   30::170     5e-24  40%  187 aa  GCH1_STRSY RecName: Full=GTP cyclohydrolase 1;       
   30::170     5e-24  40%  187 aa  GCH1_STRS2 RecName: Full=GTP cyclohydrolase 1;       
   24::183     5e-24  40%  201 aa  GCH1_STRAW RecName: Full=GTP cyclohydrolase 1;       
   31::174     5e-24  43%  189 aa  GCH1_RICRS RecName: Full=GTP cyclohydrolase 1;       
   31::174     5e-24  43%  189 aa  GCH1_RICRO RecName: Full=GTP cyclohydrolase 1;       
   31::174     5e-24  43%  189 aa  GCH1_RICPU RecName: Full=GTP cyclohydrolase 1;       
   31::174     5e-24  43%  189 aa  GCH1_RICM5 RecName: Full=GTP cyclohydrolase 1;       
   58::164     5e-24  46%  183 aa  GCH1_LEPIN RecName: Full=GTP cyclohydrolase 1;       
   58::164     5e-24  46%  183 aa  GCH1_LEPIC RecName: Full=GTP cyclohydrolase 1;       
   19::178     5e-24  42%  194 aa  GCH1_BACFR RecName: Full=GTP cyclohydrolase 1;       
   19::178     5e-24  42%  194 aa  GCH1_BACFN RecName: Full=GTP cyclohydrolase 1;       
   10::174     7e-24  41%  189 aa  GCH1_RICAE RecName: Full=GTP cyclohydrolase 1;       
    8::173     7e-24  37%  189 aa  GCH1_BACP2 RecName: Full=GTP cyclohydrolase 1;       
    9::172     9e-24  40%  188 aa  GCH1_GEOKA RecName: Full=GTP cyclohydrolase 1;       
   66::207     9e-24  42%  223 aa  GCH1_CHLCH RecName: Full=GTP cyclohydrolase 1;       
  137::334     9e-24  34%  349 aa  FOLKE_LACLA RecName: Full=Bifunctional protein folKE;Includes:
   10::175     1e-23  39%  190 aa  GCH1_RICAH RecName: Full=GTP cyclohydrolase 1;       
   26::187     1e-23  38%  204 aa  GCH1_MYCA1 RecName: Full=GTP cyclohydrolase 1;       
    7::173     1e-23  36%  189 aa  GCH1_DEHSC RecName: Full=GTP cyclohydrolase 1;       
    7::173     1e-23  36%  189 aa  GCH1_DEHSB RecName: Full=GTP cyclohydrolase 1;       
   16::179     1e-23  40%  196 aa  GCH1_CORGB RecName: Full=GTP cyclohydrolase 1;       
    7::169     1e-23  34%  185 aa  GCH1_CLOP1 RecName: Full=GTP cyclohydrolase 1;       
   42::220     1e-23  39%  236 aa  GCH1_CHICK RecName: Full=GTP cyclohydrolase 1;       
   30::197     1e-23  40%  216 aa  GCH12_ANASP RecName: Full=GTP cyclohydrolase 1 2;       
    6::168     1e-23  35%  184 aa  GCH1_STRZT RecName: Full=GTP cyclohydrolase 1;       
   31::174     1e-23  42%  189 aa  GCH1_RICCN RecName: Full=GTP cyclohydrolase 1;       
   33::177     1e-23  43%  192 aa  GCH1_RICBR RecName: Full=GTP cyclohydrolase 1;       
   33::177     1e-23  43%  192 aa  GCH1_RICB8 RecName: Full=GTP cyclohydrolase 1;       
   26::187     1e-23  38%  204 aa  GCH1_MYCPA RecName: Full=GTP cyclohydrolase 1;       
  137::334     1e-23  35%  349 aa  FOLKE_LACLM RecName: Full=Bifunctional protein folKE;Includes:
    7::169     2e-23  34%  185 aa  GCH1_CLOPE RecName: Full=GTP cyclohydrolase 1;       
    6::168     3e-23  35%  184 aa  GCH1_STRZP RecName: Full=GTP cyclohydrolase 1;       
    6::168     3e-23  35%  184 aa  GCH1_STRZJ RecName: Full=GTP cyclohydrolase 1;       
    6::168     3e-23  35%  184 aa  GCH1_STRPS RecName: Full=GTP cyclohydrolase 1;       
    6::168     3e-23  35%  184 aa  GCH1_STRPN RecName: Full=GTP cyclohydrolase 1;       
    6::168     3e-23  35%  184 aa  GCH1_STRPJ RecName: Full=GTP cyclohydrolase 1;       
    6::168     3e-23  35%  184 aa  GCH1_STRPI RecName: Full=GTP cyclohydrolase 1;       
    6::168     3e-23  35%  184 aa  GCH1_STRP7 RecName: Full=GTP cyclohydrolase 1;       
    6::168     3e-23  35%  184 aa  GCH1_STRP4 RecName: Full=GTP cyclohydrolase 1;       
   66::207     3e-23  42%  223 aa  GCH1_PROVI RecName: Full=GTP cyclohydrolase 1;       
    4::176     3e-23  38%  193 aa  GCH1_PORGI RecName: Full=GTP cyclohydrolase 1;       
    4::176     3e-23  38%  193 aa  GCH1_PORG3 RecName: Full=GTP cyclohydrolase 1;       
   44::188     3e-23  40%  202 aa  GCH1_PELUB RecName: Full=GTP cyclohydrolase 1;       
   26::189     3e-23  39%  204 aa  GCH1_MYCA9 RecName: Full=GTP cyclohydrolase 1;       
    7::169     3e-23  34%  185 aa  GCH1_CLOPS RecName: Full=GTP cyclohydrolase 1;       
   55::197     3e-23  40%  213 aa  GCH1_BRUSU RecName: Full=GTP cyclohydrolase 1;       
   55::197     3e-23  40%  213 aa  GCH1_BRUSI RecName: Full=GTP cyclohydrolase 1;       
   55::197     3e-23  40%  213 aa  GCH1_BRUO2 RecName: Full=GTP cyclohydrolase 1;       
   55::197     3e-23  40%  213 aa  GCH1_BRUME RecName: Full=GTP cyclohydrolase 1;       
   55::197     3e-23  40%  213 aa  GCH1_BRUMB RecName: Full=GTP cyclohydrolase 1;       
   55::197     3e-23  40%  213 aa  GCH1_BRUC2 RecName: Full=GTP cyclohydrolase 1;       
   55::197     3e-23  40%  213 aa  GCH1_BRUAB RecName: Full=GTP cyclohydrolase 1;       
   55::197     3e-23  40%  213 aa  GCH1_BRUA2 RecName: Full=GTP cyclohydrolase 1;       
   55::197     3e-23  40%  213 aa  GCH1_BRUA1 RecName: Full=GTP cyclohydrolase 1;       
   20::182     3e-23  35%  199 aa  GCH1_BIFLO RecName: Full=GTP cyclohydrolase 1;       
    6::168     3e-23  35%  184 aa  GCH1_STRR6 RecName: Full=GTP cyclohydrolase 1;       
    6::168     3e-23  35%  184 aa  GCH1_STRP2 RecName: Full=GTP cyclohydrolase 1;       
   19::179     3e-23  42%  196 aa  GCH1_PARD8 RecName: Full=GTP cyclohydrolase 1;       
    9::174     3e-23  39%  189 aa  GCH1_LACSS RecName: Full=GTP cyclohydrolase 1;       
   19::180     3e-23  38%  197 aa  GCH1_COREF RecName: Full=GTP cyclohydrolase 1;       
   24::185     4e-23  39%  202 aa  GCH1_MYCTU RecName: Full=GTP cyclohydrolase 1;       
   24::185     4e-23  39%  202 aa  GCH1_MYCTA RecName: Full=GTP cyclohydrolase 1;       
   24::185     4e-23  39%  202 aa  GCH1_MYCBT RecName: Full=GTP cyclohydrolase 1;       
   24::185     4e-23  39%  202 aa  GCH1_MYCBP RecName: Full=GTP cyclohydrolase 1;       
   24::185     4e-23  39%  202 aa  GCH1_MYCBO RecName: Full=GTP cyclohydrolase 1;       
    5::168     4e-23  41%  186 aa  GCH11_PSEAE RecName: Full=GTP cyclohydrolase 1 1;       
   37::178     6e-23  41%  197 aa  GCH1_RHILO RecName: Full=GTP cyclohydrolase 1;       
    9::171     6e-23  38%  189 aa  GCH1_BACCN RecName: Full=GTP cyclohydrolase 1;       
    9::172     7e-23  38%  188 aa  GCH1_GEOSW RecName: Full=GTP cyclohydrolase 1;       
   38::216     7e-23  35%  232 aa  GCH1_DICDI RecName: Full=GTP cyclohydrolase 1;       
    8::179     7e-23  38%  195 aa  GCH1_CLOAB RecName: Full=GTP cyclohydrolase 1;       
   15::207     7e-23  35%  224 aa  GCH1_CHLTE RecName: Full=GTP cyclohydrolase 1;       
   24::185     1e-22  38%  202 aa  GCH1_MYCVP RecName: Full=GTP cyclohydrolase 1;       
    9::172     1e-22  33%  186 aa  GCH1_ENTFA RecName: Full=GTP cyclohydrolase 1;       
    7::171     1e-22  38%  185 aa  GCH1_CLONN RecName: Full=GTP cyclohydrolase 1;       
    6::168     1e-22  36%  184 aa  GCH1_FINM2 RecName: Full=GTP cyclohydrolase 1;       
    9::171     1e-22  38%  189 aa  GCH1_BACWK RecName: Full=GTP cyclohydrolase 1;       
    9::171     1e-22  38%  189 aa  GCH1_BACHK RecName: Full=GTP cyclohydrolase 1;       
    9::171     1e-22  38%  189 aa  GCH1_BACCZ RecName: Full=GTP cyclohydrolase 1;       
    9::171     1e-22  38%  189 aa  GCH1_BACCR RecName: Full=GTP cyclohydrolase 1;       
    9::171     1e-22  38%  189 aa  GCH1_BACCQ RecName: Full=GTP cyclohydrolase 1;       
    9::171     1e-22  38%  189 aa  GCH1_BACC7 RecName: Full=GTP cyclohydrolase 1;       
    9::171     1e-22  38%  189 aa  GCH1_BACC4 RecName: Full=GTP cyclohydrolase 1;       
    9::171     1e-22  38%  189 aa  GCH1_BACC3 RecName: Full=GTP cyclohydrolase 1;       
    9::171     1e-22  38%  189 aa  GCH1_BACC2 RecName: Full=GTP cyclohydrolase 1;       
    9::171     1e-22  38%  189 aa  GCH1_BACC1 RecName: Full=GTP cyclohydrolase 1;       
    9::171     1e-22  38%  189 aa  GCH1_BACC0 RecName: Full=GTP cyclohydrolase 1;       
    9::171     1e-22  38%  189 aa  GCH1_BACAN RecName: Full=GTP cyclohydrolase 1;       
    9::171     1e-22  38%  189 aa  GCH1_BACAH RecName: Full=GTP cyclohydrolase 1;       
    9::171     1e-22  38%  189 aa  GCH1_BACAC RecName: Full=GTP cyclohydrolase 1;       
    9::171     1e-22  38%  189 aa  GCH1_BACAA RecName: Full=GTP cyclohydrolase 1;       
   17::177     2e-22  37%  194 aa  GCH1_STRP8 RecName: Full=GTP cyclohydrolase 1;       
   17::177     2e-22  37%  194 aa  GCH1_STRP6 RecName: Full=GTP cyclohydrolase 1;       
   17::177     2e-22  37%  194 aa  GCH1_STRP1 RecName: Full=GTP cyclohydrolase 1;       
   24::210     2e-22  36%  229 aa  GCH1_RHOBA RecName: Full=GTP cyclohydrolase 1;       
   59::201     2e-22  39%  219 aa  GCH1_METS4 RecName: Full=GTP cyclohydrolase 1;       
   42::182     2e-22  36%  199 aa  GCH1_BIFLD RecName: Full=GTP cyclohydrolase 1;       
   17::177     2e-22  37%  194 aa  GCH1_STRPZ RecName: Full=GTP cyclohydrolase 1;       
   17::177     2e-22  36%  194 aa  GCH1_STRPY RecName: Full=GTP cyclohydrolase 1;       
   17::177     2e-22  35%  194 aa  GCH1_STRPG RecName: Full=GTP cyclohydrolase 1;       
   46::187     2e-22  38%  205 aa  GCH1_SINMW RecName: Full=GTP cyclohydrolase 1;       
   37::195     2e-22  38%  216 aa  GCH1_DEIRA RecName: Full=GTP cyclohydrolase 1;       
   37::178     2e-22  42%  196 aa  GCH1_BACTN RecName: Full=GTP cyclohydrolase 1;       
    5::168     2e-22  39%  185 aa  GCH1_ALHEH RecName: Full=GTP cyclohydrolase 1;       
   17::177     3e-22  35%  194 aa  GCH1_STRP3 RecName: Full=GTP cyclohydrolase 1;       
   44::185     3e-22  40%  202 aa  GCH1_MYCUA RecName: Full=GTP cyclohydrolase 1;       
   44::185     3e-22  40%  202 aa  GCH1_MYCMM RecName: Full=GTP cyclohydrolase 1;       
   13::180     3e-22  37%  195 aa  GCH1_CLOCE RecName: Full=GTP cyclohydrolase 1;       
    8::167     4e-22  38%  187 aa  GCH1_SULSY RecName: Full=GTP cyclohydrolase 1;       
   52::194     4e-22  35%  213 aa  GCH1_BEII9 RecName: Full=GTP cyclohydrolase 1;       
   40::214     4e-22  41%  235 aa  GCH11_ANASP RecName: Full=GTP cyclohydrolase 1 1;       
   54::225     5e-22  37%  241 aa  GCH1_RAT RecName: Full=GTP cyclohydrolase 1;       
    3::188     5e-22  38%  205 aa  GCH1_MYCLE RecName: Full=GTP cyclohydrolase 1;       
    3::188     5e-22  38%  205 aa  GCH1_MYCLB RecName: Full=GTP cyclohydrolase 1;       
   47::190     5e-22  37%  206 aa  GCH1_BARHE RecName: Full=GTP cyclohydrolase 1;       
   45::173     6e-22  40%  204 aa  GCH1_RHIME RecName: Full=GTP cyclohydrolase 1;       
    8::167     6e-22  40%  193 aa  GCH1_HYPBU RecName: Full=GTP cyclohydrolase 1;       
   52::194     6e-22  41%  214 aa  GCH1_GLOVI RecName: Full=GTP cyclohydrolase 1;       
   28::173     6e-22  35%  189 aa  GCH1_DEHE1 RecName: Full=GTP cyclohydrolase 1;       
   54::170     6e-22  43%  190 aa  GCH1_CAMJJ RecName: Full=GTP cyclohydrolase 1;       
   54::170     6e-22  43%  190 aa  GCH1_CAMJE RecName: Full=GTP cyclohydrolase 1;       
   54::170     6e-22  43%  190 aa  GCH1_CAMJ8 RecName: Full=GTP cyclohydrolase 1;       
   50::191     8e-22  40%  213 aa  GCH1_SYNP6 RecName: Full=GTP cyclohydrolase 1;       
   50::191     8e-22  40%  213 aa  GCH1_SYNE7 RecName: Full=GTP cyclohydrolase 1;       
   46::187     8e-22  37%  205 aa  GCH1_RHISN RecName: Full=GTP cyclohydrolase 1;       
   54::170     8e-22  42%  190 aa  GCH1_CAMJR RecName: Full=GTP cyclohydrolase 1;       
   65::166     8e-22  45%  181 aa  GCH1_AZOVD RecName: Full=GTP cyclohydrolase 1;       
   24::185     1e-21  37%  202 aa  GCH1_MYCGI RecName: Full=GTP cyclohydrolase 1;       
   27::170     1e-21  39%  190 aa  GCH1_CAMC5 RecName: Full=GTP cyclohydrolase 1;       
   27::170     1e-21  39%  190 aa  GCH1_CAMC1 RecName: Full=GTP cyclohydrolase 1;       
   55::186     1e-21  40%  213 aa  GCH1_OCHA4 RecName: Full=GTP cyclohydrolase 1;       
   73::214     1e-21  40%  235 aa  GCH1_NOSP7 RecName: Full=GTP cyclohydrolase 1;       
   54::170     1e-21  43%  190 aa  GCH1_CAMJD RecName: Full=GTP cyclohydrolase 1;       
    8::169     1e-21  38%  184 aa  GCH1_AQUAE RecName: Full=GTP cyclohydrolase 1;       
  108::209     2e-21  46%  229 aa  GCH1_SYNJA RecName: Full=GTP cyclohydrolase 1;       
   42::220     2e-21  32%  235 aa  GCH1_SCHPO RecName: Full=GTP cyclohydrolase 1;       
   26::190     2e-21  35%  206 aa  GCH1_BARBK RecName: Full=GTP cyclohydrolase 1;       
  108::209     2e-21  45%  229 aa  GCH1_SYNJB RecName: Full=GTP cyclohydrolase 1;       
   47::190     2e-21  35%  206 aa  GCH1_BARQU RecName: Full=GTP cyclohydrolase 1;       
   50::211     3e-21  35%  229 aa  GCH1_RHOP2 RecName: Full=GTP cyclohydrolase 1;       
   27::170     3e-21  39%  190 aa  GCH1_CAMLR RecName: Full=GTP cyclohydrolase 1;       
   47::188     4e-21  37%  205 aa  GCH1_MARMM RecName: Full=GTP cyclohydrolase 1;       
   72::213     5e-21  39%  234 aa  GCH1_SYNY3 RecName: Full=GTP cyclohydrolase 1;       
   59::189     5e-21  41%  222 aa  GCH1_MESSB RecName: Full=GTP cyclohydrolase 1;       
   30::206     5e-21  36%  223 aa  GCH1_CAEEL RecName: Full=GTP cyclohydrolase 1;       
   65::166     5e-21  44%  181 aa  GCH12_PSEAE RecName: Full=GTP cyclohydrolase 1 2;       
   50::211     7e-21  35%  229 aa  GCH1_RHOPT RecName: Full=GTP cyclohydrolase 1;       
   50::211     7e-21  35%  229 aa  GCH1_RHOPA RecName: Full=GTP cyclohydrolase 1;       
   70::211     9e-21  37%  229 aa  GCH1_RHOPS RecName: Full=GTP cyclohydrolase 1;       
   67::170     9e-21  42%  185 aa  GCH1_METCA RecName: Full=GTP cyclohydrolase 1;       
    5::166     9e-21  36%  180 aa  GCH1_HELPY RecName: Full=GTP cyclohydrolase 1;       
  108::209     1e-20  41%  229 aa  GCH1_THEEB RecName: Full=GTP cyclohydrolase 1;       
   67::170     1e-20  42%  184 aa  GCH1_COXBU RecName: Full=GTP cyclohydrolase 1;       
   67::170     1e-20  42%  184 aa  GCH1_COXBR RecName: Full=GTP cyclohydrolase 1;       
   67::170     1e-20  42%  184 aa  GCH1_COXBN RecName: Full=GTP cyclohydrolase 1;       
    3::166     2e-20  36%  180 aa  GCH1_HELPJ RecName: Full=GTP cyclohydrolase 1;       
    5::168     2e-20  36%  186 aa  GCH12_PSEPK RecName: Full=GTP cyclohydrolase 1 2;       
  124::225     2e-20  43%  241 aa  GCH1_MOUSE RecName: Full=GTP cyclohydrolase 1;       
   22::166     2e-20  38%  180 aa  GCH1_HELPS RecName: Full=GTP cyclohydrolase 1;       
   22::166     2e-20  38%  180 aa  GCH1_HELPG RecName: Full=GTP cyclohydrolase 1;       
   22::166     2e-20  38%  180 aa  GCH1_HELP2 RecName: Full=GTP cyclohydrolase 1;       
   70::211     2e-20  37%  229 aa  GCH1_BRAJA RecName: Full=GTP cyclohydrolase 1;       
   27::152     3e-20  38%  184 aa  GCH1_STRSV RecName: Full=GTP cyclohydrolase 1;       
  116::295     3e-20  35%  313 aa  GCH1_NEUCR RecName: Full=GTP cyclohydrolase 1;       
    9::168     3e-20  36%  184 aa  GCH1_CHRSD RecName: Full=GTP cyclohydrolase 1;       
  133::234     3e-20  42%  250 aa  GCH1_HUMAN RecName: Full=GTP cyclohydrolase 1;       
    7::166     4e-20  34%  182 aa  GCH1_HYDS0 RecName: Full=GTP cyclohydrolase 1;       
   22::166     4e-20  37%  180 aa  GCH1_HELPH RecName: Full=GTP cyclohydrolase 1;       
   75::216     6e-20  36%  234 aa  GCH1_RHOPB RecName: Full=GTP cyclohydrolase 1;       
   55::196     6e-20  39%  212 aa  GCH1_CAUCR RecName: Full=GTP cyclohydrolase 1;       
   50::178     6e-20  39%  208 aa  GCH1_AGRT5 RecName: Full=GTP cyclohydrolase 1;       
   52::200     1e-19  39%  218 aa  GCH1_AZOC5 RecName: Full=GTP cyclohydrolase 1;       
    5::170     1e-19  35%  184 aa  GCH1_PSEA6 RecName: Full=GTP cyclohydrolase 1;       
   22::166     1e-19  40%  180 aa  GCH1_HELAH RecName: Full=GTP cyclohydrolase 1;       
    9::156     2e-19  39%  188 aa  GCH1_HAHCH RecName: Full=GTP cyclohydrolase 1;       
    3::168     2e-19  39%  187 aa  GCH11_PSESM RecName: Full=GTP cyclohydrolase 1 1;       
    9::168     4e-19  37%  184 aa  GCH1_TERTT RecName: Full=GTP cyclohydrolase 1;       
   17::178     4e-19  32%  198 aa  GCH1_JANMA RecName: Full=GTP cyclohydrolase 1;       
   47::188     4e-19  37%  206 aa  GCH1_HYPNA RecName: Full=GTP cyclohydrolase 1;       
    3::173     8e-19  31%  187 aa  GCH1_WOLSU RecName: Full=GTP cyclohydrolase 1;       
   34::197     8e-19  35%  213 aa  GCH1_OSTOS RecName: Full=GTP cyclohydrolase 1;       
  114::224     1e-18  40%  243 aa  GCH1_YEAST RecName: Full=GTP cyclohydrolase 1;       
   43::168     1e-18  37%  201 aa  GCH1_AGRVS RecName: Full=GTP cyclohydrolase 1;       
   66::180     2e-18  35%  203 aa  GCH1_XYLFM RecName: Full=GTP cyclohydrolase 1;       
    5::159     4e-18  38%  196 aa  GCH1_CLOB6 RecName: Full=GTP cyclohydrolase 1;       
  144::307     5e-18  38%  324 aa  GCH1_DROME RecName: Full=GTP cyclohydrolase 1;       
   66::180     7e-18  33%  203 aa  GCH1_XYLFA RecName: Full=GTP cyclohydrolase 1;       
    5::159     7e-18  38%  196 aa  GCH1_CLOBK RecName: Full=GTP cyclohydrolase 1;       
    5::159     7e-18  38%  196 aa  GCH1_CLOBH RecName: Full=GTP cyclohydrolase 1;       
    5::159     7e-18  38%  196 aa  GCH1_CLOB1 RecName: Full=GTP cyclohydrolase 1;       
   65::166     7e-18  40%  181 aa  GCH12_PSESM RecName: Full=GTP cyclohydrolase 1 2;       
    5::159     9e-18  38%  196 aa  GCH1_CLOBL RecName: Full=GTP cyclohydrolase 1;       
    5::159     9e-18  38%  196 aa  GCH1_CLOBJ RecName: Full=GTP cyclohydrolase 1;       
   72::180     1e-17  35%  203 aa  GCH1_XYLFT RecName: Full=GTP cyclohydrolase 1;       
   72::180     1e-17  35%  203 aa  GCH1_XYLF2 RecName: Full=GTP cyclohydrolase 1;       
    5::186     1e-17  30%  209 aa  GCH1_SULAC RecName: Full=GTP cyclohydrolase 1;       
    5::159     2e-17  38%  196 aa  GCH1_CLOBM RecName: Full=GTP cyclohydrolase 1;       
   10::166     5e-17  35%  197 aa  GCH1_CLOB8 RecName: Full=GTP cyclohydrolase 1;       
   39::180     6e-17  31%  200 aa  GCH1_XANCP RecName: Full=GTP cyclohydrolase 1;       
   10::94      8e-17  42%   94 aa  GCH1_PHYBL RecName: Full=GTP cyclohydrolase 1;       
   71::225     1e-16  34%  225 aa  GCH1_ONCMY RecName: Full=GTP cyclohydrolase 1;       
   72::175     1e-16  38%  191 aa  GCH1_LEIXX RecName: Full=GTP cyclohydrolase 1;       
   39::180     2e-16  31%  200 aa  GCH1_XANC5 RecName: Full=GTP cyclohydrolase 1;       
   39::180     3e-16  31%  200 aa  GCH1_XANAC RecName: Full=GTP cyclohydrolase 1;       
    7::152     4e-16  36%  188 aa  GCH1_CALMQ RecName: Full=GTP cyclohydrolase 1;       
   67::168     5e-16  37%  184 aa  GCH1_PSEHT RecName: Full=GTP cyclohydrolase 1;       
    2::80      7e-16  44%   80 aa  GCH1_MUCHA RecName: Full=GTP cyclohydrolase 1;       
   10::192     9e-16  33%  215 aa  GCH1_SULTO RecName: Full=GTP cyclohydrolase 1;       
   74::175     9e-16  36%  190 aa  GCH11_PSEPK RecName: Full=GTP cyclohydrolase 1 1;       
   51::192     1e-15  34%  206 aa  GCH1_HELHP RecName: Full=GTP cyclohydrolase 1;       
   31::171     2e-15  31%  191 aa  GCH1_NITMU RecName: Full=GTP cyclohydrolase 1;       
   81::185     2e-11  33%  208 aa  GCH1_SULSO RecName: Full=GTP cyclohydrolase 1;       
   81::185     2e-11  33%  208 aa  GCH1_SULIY RecName: Full=GTP cyclohydrolase 1;       
   81::185     2e-11  33%  208 aa  GCH1_SULIN RecName: Full=GTP cyclohydrolase 1;       
   81::185     2e-11  33%  208 aa  GCH1_SULIM RecName: Full=GTP cyclohydrolase 1;       
   81::185     2e-11  33%  208 aa  GCH1_SULIL RecName: Full=GTP cyclohydrolase 1;       
   81::185     2e-11  33%  208 aa  GCH1_SULIK RecName: Full=GTP cyclohydrolase 1;       
   81::185     2e-11  33%  208 aa  GCH1_SULIA RecName: Full=GTP cyclohydrolase 1;       
   68::172     8e-11  30%  187 aa  GCH1_THENV RecName: Full=GTP cyclohydrolase 1;       
   68::168     1e-10  30%  187 aa  GCH1_PYRAE RecName: Full=GTP cyclohydrolase 1;       
    2::57      2e-10  41%   80 aa  GCH1_EUGGR RecName: Full=GTP cyclohydrolase 1;       
   33::193     9e-10  28%  209 aa  GCH1_RALSO RecName: Full=GTP cyclohydrolase 1;       
   29::190     5e-09  28%  206 aa  GCH1_CHRVO RecName: Full=GTP cyclohydrolase 1;       
    1::206

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxKYCSKLGKSVQEHLIKLGLEQPREFNLDNDNKITIITKAYRQILDALGLYTDEFEKTPFRVARMF
GCH1_VIBHB      --------SESAKLVKEALEQRGLETPRPNNVSREEKKEKIEHHMREILGLLDLTDDSLEETPHRIAKMY
GCH1_HAEDU      --------SSEAQKVRQALIKKGIETPTELTQDKDSRRAEIQQHMRSVLELLGLRDDSLEETPHRLAKMY
GCH1_VIBCH      --------SESAKLVKDALERRGLETPMQPNLATPEKKEKIEQHMREILNLLGLTDDSLEETPQRIAKMY
GCH1_ACTPJ      ------------QKVREALIAKGIETPTQLTKDKDSRRAEIQQHMRSVLELLGLQDDSLEETPHRLAKMY
GCH1_ACTP7      ------------QKVREALIAKGIETPTQLTKDKDSRRAEIQQHMRSVLELLGLQDDSLEETPHRLAKMY
GCH1_ACTP2      ------------QKVREALIAKGIETPTQLTKDKDSRRAEIQQHMRSVLELLGLQDDSLEETPHRLAKMY
GCH1_PASMU      ------------EKVRNALLSKGIETPMITEQDRDTRRAGIEQHMREVMKLIGLRDDSLEETPVRLAKMF
GCH1_MANSM      ------------EKVRHALIEKGIETPMIALTKSKNERRIIENRMREVMQLIGLTDDSLEETPVRLAKMF
GCH1_HAES2      --------------VRNALVEKGIETPMDLVQDKDQRRQGIEQHMREVIKLIGLSDDSLEETPARLSKMF
GCH1_HAES1      --------------VRNALVEKGIETPMDLVQDKDQRRQGIEQHMREVIKLIGLSDDSLEETPARLSKMF
GCH1_HAEIE      -------------NVRNALIEKGIETPMDPTQAKDERRESIAKHMHEVMKLIGLRDDSLEETPNRLAKMF
GCH1_HAEI8      -------------NVRNALIEKGIETPMDPTQAKDERRESIAKHMHEVMKLIGLRDDSLEETPNRLAKMF
GCH1_WIGBR      --------------VKNALLNKGIETPKKIYEKNKPDIHKISKYIKKIMXXXXXXXXXXXKTPNRIAYMY
GCH1_HAEIN      -------------NVRNALIEKGIETPMDPTQAKNERRESIAKHMHEVMKLIGLRDDSLEETPNRLAKMF
GCH1_BLOFL      --------------VRNALLLQGLENPIDLNIDDKIRMNCIESHMISIMHXXXXXXXXXXXTPKRVAKMY
GCH1_HAEIG      -------------NVRNALIEKGIETPMDPTQAKNERRESIAKHMHEVMKLIGLRDDSLEETPNRLAKMF
GCH1_VIBPA      --------------------------------------------------------------PHRIAKMY
GCH1_ERWT9      --------------VHQALVARGLETPLRSEMDDDARKQLIAGHMTEIMQLLNLEDDSLAETPQRIAKMY
GCH1_TOLAT      ------------------------------------------------------------ETPHRIAKMY
GCH1_PECCP      --------SKEAVMVHEALLARGLETPRGALLDRDTRKQRIAEHMTEIMNXXXXXXXXXXETPTRIAKMY
GCH1_VIBVY      --------SESAQLVKQALEKRGLETPMVPNFSREEKKEKIEHHMREIXXXXXXXXXXXXXXPRRIAKMY
GCH1_VIBVU      --------SESAQLVKQALEKRGLETPMVPNFSREEKKEKIEHHMREIXXXXXXXXXXXXXXPRRIAKMY
GCH1_ERWCT      --------SKEAVMVHEALLARGLETPRGALLDRDTRKQRIAEHMTEIMNXXXXXXXXXXETPTRIAKMY
GCH1_PHOPR      --------------------------------------------------------------PHRIAKMY
GCH1_SODGM      --------TKEASQVRDALLARGLETPRGEVLDNEVRKRLIAEHMTEIMXXXXXXXXXXXETPHRIAKMY
GCH1_BLOPB      --------------VRDALSVRGLENPLELNINHKIRKRRIENHMRAIVXXXXXXXXXXXXTPKRIAKMY
GCH1_FLAJ1      -----------------------------------------------ILQTLGLTDDSIKGTPNRVAKMF
GCH1_VIBFM      --------------VRDALVARGLETPKENGVSREEKKERIEEHMREIXXXXXXXXXXXXXXPHRIAKMY
GCH1_VIBF1      --------------VRDALVARGLETPKENGVSREEKKERIEEHMREIXXXXXXXXXXXXXXPHRIAKMY
GCH1_EDWI9      --------SKEAALVHEALLARGLETPRGEPLARDTRKAQIEAHMTEVMRXXXXXXXXXXETPSRIAKMY
GCH1_SHISS      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_SHIFL      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_SHIF8      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_SHIDS      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_SHIBS      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_SHIB3      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_SERP5      --------SKEAVLVHAALEERGLETPRGEVLDRETRKRRIKEHMTEIMQXXXXXXXXXXETPHRIAKMY
GCH1_ESCF3      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_ECOUT      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_ECOSM      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_ECOSE      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_ECOLU      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_ECOLI      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_ECOLC      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_ECOL6      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_ECOL5      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_ECOK1      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_ECOHS      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_ECODH      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_ECOBW      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_ECO8A      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_ECO81      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_ECO7I      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_ECO5E      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_ECO57      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_ECO55      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_ECO45      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_ECO27      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_ECO24      --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
GCH1_ALISL      --------------------------------------------------------------PHRIAKMY
GCH1_HAMD5      --------SKEARQVHEALVKHGLENP--FNMDPENGLSHIEKHITQIMEXXXXXXXXXXKTPSRIASMY
GCH1_SHELP      --------SEAAKQVQTALLERGLETPMPCGLSSEARKEKIEHHMREILTSLDLRDDSLVETPKRIAKMY
GCH1_AERHH      -------------------------------LDGQQKREKIEGHMRAIMETLGLADDSLAETPHRIAKMY
GCH1_SHEDO      --------------------------------------------------------------PRRIAKMY
GCH1_ENT38      --------SKEAALVHEALVARGLETPLRNELDNETRKRLIAGHMTEIMQXXXXXXXXXXETPQRIAKMY
GCH1_YERPY      --------SKEAELVHQALLARGLETPRKPELDAETRKTRIQAHMTEVMHLLNLTDDSLADTPRRIAKMY
GCH1_YERPG      --------SKEAELVHQALLARGLETPRKPELDAETRKTRIQAHMTEVMHLLNLTDDSLADTPRRIAKMY
GCH1_YERPE      --------SKEAELVHQALLARGLETPRKPELDAETRKTRIQAHMTEVMHLLNLTDDSLADTPRRIAKMY
GCH1_YERPB      --------SKEAELVHQALLARGLETPRKPELDAETRKTRIQAHMTEVMHLLNLTDDSLADTPRRIAKMY
GCH1_YERP3      --------SKEAELVHQALLARGLETPRKPELDAETRKTRIQAHMTEVMHLLNLTDDSLADTPRRIAKMY
GCH1_CITK8      --------SKEAALVHEALVARGLETPLRHEMDNETRKRLISGHMTEIMQXXXXXXXXXXETPHRIAKMY
GCH1_SALTY      --------SKEAALVHDALVARGLETPLRDELDNETRKSLIAGHMTEIMQXXXXXXXXXXETPHRIAKMY
GCH1_SALTI      --------SKEAALVHDALVARGLETPLRDELDNETRKSLIAGHMTEIMQXXXXXXXXXXETPHRIAKMY
GCH1_SALSV      --------SKEAALVHDALVARGLETPLRDELDNETRKSLIAGHMTEIMQXXXXXXXXXXETPHRIAKMY
GCH1_SALPK      --------SKEAALVHDALVARGLETPLRDELDNETRKSLIAGHMTEIMQXXXXXXXXXXETPHRIAKMY
GCH1_SALPC      --------SKEAALVHDALVARGLETPLRDELDNETRKSLIAGHMTEIMQXXXXXXXXXXETPHRIAKMY
GCH1_SALPB      --------SKEAALVHDALVARGLETPLRDELDNETRKSLIAGHMTEIMQXXXXXXXXXXETPHRIAKMY
GCH1_SALPA      --------SKEAALVHDALVARGLETPLRDELDNETRKSLIAGHMTEIMQXXXXXXXXXXETPHRIAKMY
GCH1_SALNS      --------SKEAALVHDALVARGLETPLRDELDNETRKSLIAGHMTEIMQXXXXXXXXXXETPHRIAKMY
GCH1_SALHS      --------SKEAALVHDALVARGLETPLRDELDNETRKSLIAGHMTEIMQXXXXXXXXXXETPHRIAKMY
GCH1_SALEP      --------SKEAALVHDALVARGLETPLRDELDNETRKSLIAGHMTEIMQXXXXXXXXXXETPHRIAKMY
GCH1_SALDC      --------SKEAALVHDALVARGLETPLRDELDNETRKSLIAGHMTEIMQXXXXXXXXXXETPHRIAKMY
GCH1_SALCH      --------SKEAALVHDALVARGLETPLRDELDNETRKSLIAGHMTEIMQXXXXXXXXXXETPHRIAKMY
GCH1_SALAR      --------SKEAALVHDALVARGLETPLRDELDNETRKSLIAGHMTEIMQXXXXXXXXXXETPHRIAKMY
GCH1_SALA4      --------SKEAALVHDALVARGLETPLRDELDNETRKSLIAGHMTEIMQXXXXXXXXXXETPHRIAKMY
GCH1_AERS4      -------------------------------LNGQQKKEKIEGHMRAIMETLGLTDDSLAETPHRIAKMY
GCH1_BAUCH      ------------------------------------------------------------KTPYRIAYMY
GCH1_SALG2      --------SKEAALVHDALVARGLETPLRDELDNETRKSLIAGHMTEIMQXXXXXXXXXXETPHRIAKMY
GCH1_YERE8      --------SKEAELVHEALLARGLETPRKQELDAETRKTRIQEHMTQVMQXXXXXXXXXXXTPRRIAKMY
GCH1_KLEP7      --------SKEAVLVHEALVARGLETPMRAEIDNETRKRLITGHMTEIMQXXXXXXXXXXETPHRIAKMY
GCH1_PHOLL      ---------------------------------------------------LDLRDDSLAETPGRIAKMY
GCH1_KLEP3      --------SKEAVLVHEALVARGLETPMRAEIDNETRKRLITGHMTEIMQXXXXXXXXXXETPHRIAKMY
GCH1_SHEAM      --------SEAAQKVQAALLERGLETPMPCGLSREERKDKIEQHMRAILGXXXXXXXXXXXXPRRIAKMY
GCH1_SHEB9      --------SEAAVKVQAALLERGLETPMLPSVSSEERKDKIEHHMKEILTLMXXXXXXXXXTPRRIAKMY
GCH1_SHEB8      --------SEAAVKVQAALLERGLETPMLPSVSSEERKDKIEHHMKEILTLMXXXXXXXXXTPRRIAKMY
GCH1_SHEB5      --------SEAAVKVQAALLERGLETPMLPSVSSEERKDKIEHHMKEILTLMXXXXXXXXXTPRRIAKMY
GCH1_SHEB2      --------SEAAVKVQAALLERGLETPMLPSVSSEERKDKIEHHMKEILTLMXXXXXXXXXTPRRIAKMY
GCH1_SHESR      --------SEAAVKVQAALHERGLETPMLPNVERKDKIEFHMKEILTLMXXXXXXXXXAD-TPRRIAKMY
GCH1_SHESM      --------SEAAVKVQAALQERGLETPMLPNVERKDKIEFHMKEILTLMXXXXXXXXXAD-TPRRIAKMY
GCH1_SHESA      --------SEAAVKVQAALQERGLETPMLPNVERKDKIEFHMKEILTLMXXXXXXXXXAD-TPRRIAKMY
GCH1_SHEON      -------------------------------------------------------------TPRRIAKMY
GCH1_SHESW      --------SEAAVKVQAALLERGLETPMLPSVSSEERKDKIEHHMKEILTLMXXXXXXXXXTPRRIAKMY
GCH1_SHEPC      --------SEAAVKVQAALLERGLETPMLPSVSSEERKDKIEHHMKEILTLMXXXXXXXXXTPRRIAKMY
GCH1_THETN      ----------------------------------------IKKAVREILEAIGEDPDRLLETPDRVARMY
GCH1_DESRM      ----------------------------------------IEKAVKMILEAIGEDPNRLEETPARVARMY
GCH1_BUCAP      ------------------LLLKGLENPKEYNKEKERELLIAEYLYKIMLLNLDLKNESLKDTPIRISKMY
GCH1_CARHZ      -------------------------------------------AVRMILEAIGEDPDRLKDTPKRVARMY
GCH1_THEPX      ----------------------------------------IKKAVRDILEAIGEDPDRLLETPDRVARMY
GCH1_THEP3      ----------------------------------------IKKAVRDILEAIGEDPDRLLETPDRVARMY
GCH1_STRA1      ------------------------------------------KAIYQFLEALGENPDRLKDTPKRVAKMY
GCH1_PELTS      ----------------------------------------IEKAVRLILEAIGENPERLKGTPARVARMY
GCH1_STRA3      ------------------------------------------KAIYQFLEALGENPDRLKDTPKRVAKMY
GCH1_THEFY      ------------------LAPAGIDQPR------------IEKAVREILLAIGEDPDRLVETPARVARAF
GCH1_FUSNN      ----------------------------------------IENAFFEVIEALGEYKEELKDTPKRIADSY
GCH1_STRA5      ------------------------------------------KAIYQFLEALGENPNRLKDTPKRVAKMY
GCH1_STRMU      ----------------------------------------IEEAVYQLLEALGEDPNRLLDTPKRVAKMY
GCH1_THEYD      ----------------------------------------IEEGVRLILEGIGEDVERIKDTPIRIARMF
GCH1_STRGC      ----------------------------------------------QLLELVGENPDRLLDTPKRVAKMY
GCH1_CLOD6      ----------------------------------------IQHAVREILEAIGEDPDRLIETPNRVARMY
GCH1_RICTY      ------------------------------------------------------------KTPDRVINSY
GCH1_LACPL      ----------------------------------------IEHAVREILSAVGEDPDRLVETPARVARMY
GCH1_RICFE      ------------------------------------------------------------KTPDRVVNSY
GCH1_PERMH      ----------------------------------------LKRSIRLFLEAIGEDPDRLKETPDRIVRLW
GCH1_LISMO      ----------------------------------------IADAVKVILEAVGENPDRLIDTPMRVARMY
GCH1_LISMH      ----------------------------------------IADAVKVILEAVGENPDRLIDTPMRVARMY
GCH1_BACA2      ----------------------------------------IEQAVRQILEAIGEDPDRLLDTPKRVAKMY
GCH1_CLOK5      ----------------------------------------IKDAVRMIIEAIGENPERLAETPDRIARMY
GCH1_CLOK1      ----------------------------------------IKDAVRMIIEAIGENPERLAETPDRIARMY
GCH1_BREBN      ------------------------------NVDLDK----IQQAVRMILEAVGDDPDRVLDTPKRVAKMY
GCH1_BACSU      ----------------------------------------IEQAVRQILEAIGEDPNRLLDTPKRVAKMY
GCH1_STRGG      -------------------------------------------AVRELLIAVGEDPDRLRETPGRVARAY
GCH1_LEPBP      ----------------------------------------------------------------------
GCH1_LEPBA      ----------------------------------------------------------------------
GCH1_LISMF      ----------------------------------------IADAVKVILEAVGENPERLIDTPMRVARMY
GCH1_LISMC      ----------------------------------------IADAVKVILEAVGENPERLIDTPMRVARMY
GCH1_LISIN      ----------------------------------------IADAVKVILEAVGENPERLIDTPMRVARMY
GCH1_BACHD      ----------------------------------------IQQAVVMILEAIGEAREGLEDTPKRVAKMY
GCH1_CORA7      -------------------------------------------AVRELLIAVGEDPDRLRETPARVARAY
GCH1_LISW6      ----------------------------------------IADAVKVILEAVGENPERLIDTPMRVARMY
GCH1_CLOTH      ----------------------------------------IKAAVRELLIGIGEDPDRLLETPDRVARM-
GCH1_CORGL      -----------------------------------------TAAIRELLIAVGEDPDRLLETPARVARAY
GCH1_STRT2      -------------------------------MENQEKVE---QAVYQLLEALGENPERLLDTPKRVAKMY
GCH1_STRT1      -------------------------------MENQEKVE---QAVYQLLEALGENPERLLDTPKRVAKMY
GCH1_LEPBL      ----------------------------------------------------------------------
GCH1_LEPBJ      ----------------------------------------------------------------------
GCH1_STRCO      -------------------------------------------AVRELLIAVGEDPDRLRETPARVARAY
GCH1_RICPR      ------------------------------------------------------------KTPDRVINSY
GCH1_LYSSC      ----------------------------------------IEEAVKMILEAVGVNREGLLDTPKRVAKMY
GCH1_STRSY      -------------------------------------------------------------TPKRVAKMY
GCH1_STRS2      -------------------------------------------------------------TPKRVAKMY
GCH1_STRAW      -------------------------------------------AVRELLIAVGEDPDRLRETPGRVARAY
GCH1_RICRS      ------------------------------------------------------------KTPDRVINSY
GCH1_RICRO      ------------------------------------------------------------KTPDRVINSY
GCH1_RICPU      ------------------------------------------------------------KTPDRVINSY
GCH1_RICM5      ------------------------------------------------------------KTPDRVINSY
GCH1_LEPIN      ----------------------------------------------------------------------
GCH1_LEPIC      ----------------------------------------------------------------------
GCH1_BACFR      --------------------------------------------YRSIITLLGEDAERLLKTPERVAKML
GCH1_BACFN      --------------------------------------------YRSIITLLGEDAERLLKTPERVAKML
GCH1_RICAE      -----------------------------------------TEAVRTLLKFIGESREGLLQTPDRVINSY
GCH1_BACP2      ---------------------------------------LIEHAVRDILKAIGEDPDRLLDTPKRVAKMY
GCH1_GEOKA      ----------------------------------------IEYAVRLILEAIGEDPNRLVDTPKRVAKMY
GCH1_CHLCH      ------------------------------------------------------------KTPERVARSM
FOLKE_LACLA     -----KYYASIEKAIAELSVS---EQELHVIKEEKTPRNRIEDAVKEILFAVGENPNRLLETPARVAKMY
GCH1_RICAH      -----------------------------------------TEAVRTLLKFIGETREGLLKTPDRVINSY
GCH1_MYCA1      -------------------------------------------AVRELLFAIGENPDRLAETPARVARAY
GCH1_DEHSC      ----------------------------------------IKQSVQNILVAIGEDPDRLKETPRRVAQMY
GCH1_DEHSB      ----------------------------------------IKQSVQNILVAIGEDPDRLKETPRRVAQMY
GCH1_CORGB      -----------------------------------------TAAIRELLIAVGEDPDRLLETPARVARAY
GCH1_CLOP1      ----------------------------------------IREGMKLILEAIGINREGLIETPDRIARMY
GCH1_CHICK      ------------------------ERPRSEE-DNELSLPSLAAAYTTILRALGEDPERLLKTPWRAA---
GCH12_ANASP     --------AEMVQAVRTLLIGLGENPDREGLLDTPKRVVFLTKGYNESLD--------------------
GCH1_STRZT      ----------------------------------------IEAAVKMIIEAVGVNREGLQETPARVARMY
GCH1_RICCN      ------------------------------------------------------------QTPDRVINSY
GCH1_RICBR      ------------------------------------------------------------KTPDRVIKSY
GCH1_RICB8      ------------------------------------------------------------KTPDRVIKSY
GCH1_MYCPA      -------------------------------------------AVRELLFAIGEDPDRLAETPARVARAY
FOLKE_LACLM     ---------KYYEPIREAIAKLS-ESEQELHVIEEEKSNRIEEAVKEILFAVGENPNRLLETPARVAKMY
GCH1_CLOPE      ----------------------------------------IKEGMKLILEAIGVNREGLIETPDRIARMY
GCH1_STRZP      ----------------------------------------IEAAVKMIIEAVGENANRLQETPARVARMY
GCH1_STRZJ      ----------------------------------------IEAAVKMIIEAVGENANRLQETPARVARMY
GCH1_STRPS      ----------------------------------------IEAAVKMIIEAVGENANRLQETPARVARMY
GCH1_STRPN      ----------------------------------------IEAAVKMIIEAVGANREGLQETPARVARMY
GCH1_STRPJ      ----------------------------------------IEAAVKMIIEAVGANREGLQETPARVARMY
GCH1_STRPI      ----------------------------------------IEAAVKMIIEAVGENANRLQETPARVARMY
GCH1_STRP7      ----------------------------------------IEAAVKMIIEAVGANREGLQETPARVARMY
GCH1_STRP4      ----------------------------------------IEAAVKMIIEAVGANREGLQETPARVARMY
GCH1_PROVI      ------------------------------------------------------------KTPERVARSL
GCH1_PORGI      -------------------------------IEKEEACSRLQQHYAQVLSLLGEKREGLLKTPLRVAKQF
GCH1_PORG3      -------------------------------IEKEEACSRLQQHYAQVLSLLGEKREGLLKTPLRVAKQF
GCH1_PELUB      ------------------------------------------------------------ETPKRVVKAF
GCH1_MYCA9      -------------------------------------------AVRELLYAVGEDPDRLADTPARVARAY
GCH1_CLOPS      ----------------------------------------IREGMKLILEAIGANREGLIETPDRIARMY
GCH1_BRUSU      ------------------------------------------------------------ETPKRVAKAY
GCH1_BRUSI      ------------------------------------------------------------ETPKRVAKAY
GCH1_BRUO2      ------------------------------------------------------------ETPKRVAKAY
GCH1_BRUME      ------------------------------------------------------------ETPKRVAKAY
GCH1_BRUMB      ------------------------------------------------------------ETPKRVAKAY
GCH1_BRUC2      ------------------------------------------------------------ETPKRVAKAY
GCH1_BRUAB      ------------------------------------------------------------ETPKRVAKAY
GCH1_BRUA2      ------------------------------------------------------------ETPKRVAKAY
GCH1_BRUA1      ------------------------------------------------------------ETPKRVAKAY
GCH1_BIFLO      ----------------------------------------VREAVRLFLKSIGEDPERLVETPDRIARA-
GCH1_STRR6      ----------------------------------------IEAAVKMIIEAVGANREGLQETPARVARMY
GCH1_STRP2      ----------------------------------------IEAAVKMIIEAVGANREGLQETPARVARMY
GCH1_PARD8      --------------------------------------------YKEVLGLLGVEREGLLKTPERVAKAM
GCH1_LACSS      ----------------------------------------IEKDVRDILKQVG---DDPERTPQRVAKMY
GCH1_COREF      -------------------------------------------AVRELLIAVGENPERLLETPARVARAY
GCH1_MYCTU      -------------------------------------------AVRELLYAIGEDPDRLVATPSRVARSY
GCH1_MYCTA      -------------------------------------------AVRELLYAIGEDPDRLVATPSRVARSY
GCH1_MYCBT      -------------------------------------------AVRELLYAIGEDPDRLVATPSRVARSY
GCH1_MYCBP      -------------------------------------------AVRELLYAIGEDPDRLVATPSRVARSY
GCH1_MYCBO      -------------------------------------------AVRELLYAIGEDPDRLVATPSRVARSY
GCH11_PSEAE     ----------------------------------------LSQHYREILVGLGEQREGLLDTPKRAAKAM
GCH1_RHILO      -------------------------------------------------------------TPKRVAKAF
GCH1_BACCN      ----------------------------------------IEHAVRLILEAIG---DDPNRTPRRVAKMY
GCH1_GEOSW      ----------------------------------------IEYAVRLILEAIGEDPNRLVDTPKRVAKMY
GCH1_DICDI      ---------------------------REPLIHNHEVLNTMQSSVKTLLSSLGEDPDRLLKTPLRMSKFF
GCH1_CLOAB      ----------------------------------------IEKHIRGILIALGDDPDRLKETPKRVAKMY
GCH1_CHLTE      ------------RSAESRLSQCDLDECFDESHDRDEEVLSMTDAVYSLLKGVGEDPERLLLTPERVAKSL
GCH1_MYCVP      -------------------------------------------AVRELLIAVGEDPDRLRDTPARVARAY
GCH1_ENTFA      ----------------------------------------IEQAVTTILEAVGEDTQRLIDTPKRVAKMY
GCH1_CLONN      ----------------------------------------IKKAVIMIIEAIGEDPNRLKETPDRIARMY
GCH1_FINM2      ----------------------------------------IEQAVSMIIEAIGEDPNRLLETPQRVARMY
GCH1_BACWK      ----------------------------------------IEHAVRLILEAIG---DDPNRTPKRVAKMY
GCH1_BACHK      ----------------------------------------IEHAVRLILEAIG---DDPNRTPKRVAKMY
GCH1_BACCZ      ----------------------------------------IEHAVRLILEAIG---DDPNRTPKRVAKMY
GCH1_BACCR      ----------------------------------------IEHAVRLILEAIG---DDPNRTPKRVAKMY
GCH1_BACCQ      ----------------------------------------IEHAVRLILEAIG---DDPNRTPKRVAKMY
GCH1_BACC7      ----------------------------------------IEHAVRLILEAIG---DDPNRTPKRVAKMY
GCH1_BACC4      ----------------------------------------IEHAVRLILEAIG---DDPNRTPKRVAKMY
GCH1_BACC3      ----------------------------------------IEHAVRLILEAIG---DDPNRTPKRVAKMY
GCH1_BACC2      ----------------------------------------IEHAVRLILEAIG---DDPNRTPKRVAKMY
GCH1_BACC1      ----------------------------------------IEHAVRLILEAIG---DDPNRTPKRVAKMY
GCH1_BACC0      ----------------------------------------IEHAVRLILEAIG---DDPNRTPKRVAKMY
GCH1_BACAN      ----------------------------------------IEHAVRLILEAIG---DDPNRTPKRVAKMY
GCH1_BACAH      ----------------------------------------IEHAVRLILEAIG---DDPNRTPKRVAKMY
GCH1_BACAC      ----------------------------------------IEHAVRLILEAIG---DDPNRTPKRVAKMY
GCH1_BACAA      ----------------------------------------IEHAVRLILEAIG---DDPNRTPKRVAKMY
GCH1_STRP8      -------------------------------------------AIYQFLEAIGENPNRLLDTPKRVAKMY
GCH1_STRP6      -------------------------------------------AIYQFLEAIGENPNRLLDTPKRVAKMY
GCH1_STRP1      -------------------------------------------AIYQFLEAIGENPNRLLDTPKRVAKMY
GCH1_RHOBA      ------------------------EQPAEFFVDNEVDFARIESAVREILEAVGEDPDRLLETPERVARMY
GCH1_METS4      ------------------------------------------------------------ETPQRVARAY
GCH1_BIFLD      ------------------------------------------------------------ETPDRIARA-
GCH1_STRPZ      -------------------------------------------AIYQFLEAIGENPNRLLDTPKRVAKMY
GCH1_STRPY      -------------------------------------------AIYQFLEAIGENPNRLLDTPKRVAKMY
GCH1_STRPG      -------------------------------------------AIYQFLEAIGENPNRLLDTPKRVAKMY
GCH1_SINMW      -------------------------------------------------------------TPARVAKAY
GCH1_DEIRA      ---------------------------------------------REWLAAIGEDPDRLQRTPQRVAKAW
GCH1_BACTN      ------------------------------------------------------------KTPERVAKML
GCH1_ALHEH      ----------------------------------------IEAAYRRILQDLGEDPDRLKDTPARAARFL
GCH1_STRP3      -------------------------------------------AIYQFLEAIGENPNRLLDTPKRVAKMY
GCH1_MYCUA      -------------------------------------------------------------TPARVARAY
GCH1_MYCMM      -------------------------------------------------------------TPARVARAY
GCH1_CLOCE      ---------------------------------------------RGLLVAIGENPDRLKETPSRVAQMY
GCH1_SULSY      ----------------------------------------IEQAIRLFLEGIGEDPNRLRDTPKRVAKMW
GCH1_BEII9      -------------------------------------------------------------TPKRVVKAF
GCH11_ANASP     -----------------------LHQPSEEDMES------MMGAVRSILVGVGEDPERLLKTPKRVARFL
GCH1_RAT        --------------------------------DNELNLPNLAAAYSSILRSLGEDPQRLLKTPWRAA---
GCH1_MYCLE      ------------------LLDLGLESPRIRVFDQQRA----EAAIRELLYAIGEDPDRLADTPARVARA-
GCH1_MYCLB      ------------------LLDLGLESPRIRVFDQQRA----EAAIRELLYAIGEDPDRLADTPARVARA-
GCH1_BARHE      -------------------------------------------------------------TPGRVAKAY
GCH1_RHIME      -------------------------------------------------------------TPSRVAKAY
GCH1_HYPBU      ----------------------------------------IEKAVRMILEAIGEDPERLRETPRRVADMF
GCH1_GLOVI      -----------------------------------------------------------ERTPKRVAEAL
GCH1_DEHE1      -----------------------------------------------------------KETPRRVAQMY
GCH1_CAMJJ      ----------------------------------------------------------------------
GCH1_CAMJE      ----------------------------------------------------------------------
GCH1_CAMJ8      ----------------------------------------------------------------------
GCH1_SYNP6      ------------------------------------------------------------KTPKRVARFL
GCH1_SYNE7      ------------------------------------------------------------KTPKRVARFL
GCH1_RHISN      -------------------------------------------------------------TPARVIKSY
GCH1_CAMJR      ----------------------------------------------------------------------
GCH1_AZOVD      ----------------------------------------------------------------------
GCH1_MYCGI      -------------------------------------------AVRELLIAVGEDPDRLLDTPARVARSY
GCH1_CAMC5      ------------------------------------------------------------KTPSRVYKAF
GCH1_CAMC1      ------------------------------------------------------------KTPERVYKAF
GCH1_OCHA4      ------------------------------------------------------------ETPKRVAKAY
GCH1_NOSP7      ------------------------------------------------------------KTPKRVARFL
GCH1_CAMJD      ----------------------------------------------------------------------
GCH1_AQUAE      ----------------------------------------IKQAVRLFLEGIGEDPDRLKETPERVARMW
GCH1_SYNJA      ----------------------------------------------------------------------
GCH1_SCHPO      ---------------------------RRIDTAEEEKVKKISNAISTILECLGLGTPEYAKAMLYFTKGY
GCH1_BARBK      ------------------------------------------KAIRTLLLWVGENPDRLLETPKRIAKVY
GCH1_SYNJB      ----------------------------------------------------------------------
GCH1_BARQU      -------------------------------------------------------------TPRRVAKAY
GCH1_RHOP2      -------------------------------------------AVKTLLSYIGENTERLLDTPRRVVEAY
GCH1_CAMLR      ------------------------------------------------------------KTPTRVFKAF
GCH1_MARMM      -------------------------------------------------------------TPKRVVKAY
GCH1_SYNY3      ------------------------------------------------------------KTPKRVAEAM
GCH1_MESSB      -----------------------------------------------------------KETPARVVKAY
GCH1_CAEEL      ---------------------------RNGTIPKEDHLKSMCNAYQSIIQHVGINRQGLLKTPERAAKAF
GCH12_PSEAE     ----------------------------------------------------------------------
GCH1_RHOPT      -------------------------------------------AVKTLLSYIGENTERLIDTPRRVVEAY
GCH1_RHOPA      -------------------------------------------AVKTLLSYIGENTERLIDTPRRVVEAY
GCH1_RHOPS      -------------------------------------------------------------TPRRVVEAY
GCH1_METCA      ----------------------------------------------------------------------
GCH1_HELPY      --------------------------------------------FNQFFESIGKNREGLKETPKRVQELW
GCH1_THEEB      ----------------------------------------------------------------------
GCH1_COXBU      ----------------------------------------------------------------------
GCH1_COXBR      ----------------------------------------------------------------------
GCH1_COXBN      ----------------------------------------------------------------------
GCH1_HELPJ      ------------------------------------------KFFNQFFENIGKNREGLKETPKRVQELW
GCH12_PSEPK     ----------------------------------------LAEHYHEILVGIGEQREGLLDTPRRAAKAM
GCH1_MOUSE      ----------------------------------------------------------------------
GCH1_HELPS      -----------------------------------------------------------KETPKRVQELW
GCH1_HELPG      -----------------------------------------------------------KETPKRVQELW
GCH1_HELP2      -----------------------------------------------------------KETPKRVQELW
GCH1_BRAJA      -------------------------------------------------------------TPRRVVEAF
GCH1_STRSV      -----------------------------------------------------------QETPQRIAKMY
GCH1_NEUCR      ------------------------ERLEETEAQKQERLDKMKGAVRTLLECIGEDPDRLLATPERYAKAM
GCH1_CHRSD      --------------------------------------------YRHIIAGLGEDPDRLRDTPKRAAKFL
GCH1_HUMAN      ----------------------------------------------------------------------
GCH1_HYDS0      ----------------------------------------IIEGIKLFLEGIGITREGIKETPERVAKMW
GCH1_HELPH      -----------------------------------------------------------KETPKRVQELW
GCH1_RHOPB      -------------------------------------------------------------TPRRVVEAY
GCH1_CAUCR      -------------------------------------------------------------TPKRVVEAF
GCH1_AGRT5      -------------------------------------------------------------TPKRVAKAY
GCH1_AZOC5      ------------------------------------------------------HREGLQETPARVIRSY
GCH1_PSEA6      ----------------------------------------LTQHYSQILSILGEDTQRLVDTPKRAAKAM
GCH1_HELAH      -----------------------------------------------------------KNTPKRV----
GCH1_HAHCH      --------------------------------------------YSAIIESLGVNREGLRDTPKRAAKAM
GCH11_PSESM     --------SSLPQHYRDILLELGENPEREGLLDTPKRAS---KAMQYLCHG---YTQTVE----------
GCH1_TERTT      --------------------------------------------YANLISSTGLQRPGLQGTPARAATAF
GCH1_JANMA      -----------------------------------------TEDWRRLLTHLGENADRLRETPQRVEKAW
GCH1_HYPNA      -------------------------------------------------------------TPKRVVNAY
GCH1_WOLSU      ----------------------------------DKKIAM-EETIRSIFDFIGRHREGLLDTPKRVVKSW
GCH1_OSTOS      ----------------------------------------MTAAYSSIISHVGVNRQGLLKTPDRAAKAF
GCH1_YEAST      ----------------------------------------------------------------------
GCH1_AGRVS      -------------------------------------------------------------TPKRVAKAY
GCH1_XYLFM      ----------------------------------------------------------------------
GCH1_CLOB6      -------------------------------------VKAIEEHIKGILIALGDNPERLKDTPKRVAKMY
GCH1_DROME      ----------------------------------------MARSYRLLLGGLGENPDRLIKTPERAAKAF
GCH1_XYLFA      ----------------------------------------------------------------------
GCH1_CLOBK      -------------------------------------VKAIEEHIRGILIALGDNPERLKNTPKRVAKMY
GCH1_CLOBH      -------------------------------------VKAIEEHIRGILIALGDNPERLKNTPKRVAKMY
GCH1_CLOB1      -------------------------------------VKAIEEHIRGILIALGDNPERLKNTPKRVAKMY
GCH12_PSESM     ----------------------------------------------------------------------
GCH1_CLOBL      -------------------------------------VKAIEEHIRGILIALGDNPERLKNTPKRVAKMY
GCH1_CLOBJ      -------------------------------------VKAIEEHIRGILIALGDDPERLKNTPKRVAKMY
GCH1_XYLFT      ----------------------------------------------------------------------
GCH1_XYLF2      ----------------------------------------------------------------------
GCH1_SULAC      ------------------------------SLNQERLVEEIAKRVKEILQLIGEDTERLKETPERVAKAL
GCH1_CLOBM      -------------------------------------VKAIEEHIRGILIALGDNPERLKDTPKRVAKMY
GCH1_CLOB8      ----------------------------------------IEECIREIIVALGPNREGLLDTPKRVSKMY
GCH1_XANCP      -------------------------------------------------------------TPRRVAEAY
GCH1_PHYBL      ----------------------------------------------------------------------
GCH1_ONCMY      --------------------------------DNEMSLPSLAAAYTTIIRGLGKDPQRLLKTPWRAAKGY
GCH1_LEIXX      ----------------------------------------------------------------------
GCH1_XANC5      -------------------------------------------------------------TPRRVAEAY
GCH1_XANAC      -------------------------------------------------------------TPRRVAEAY
GCH1_CALMQ      ---------------------------------------LIKQAVKQILVAIGEDPERLRRTPDRVANML
GCH1_PSEHT      ----------------------------------------------------------------------
GCH1_MUCHA      ----------------------------------------------------------------------
GCH1_SULTO      ----------------------------EETLNQEKMVEEIAKRIREILEILGENPDRLRETPLRVARAL
GCH11_PSEPK     ----------------------------------------------------------------------
GCH1_HELHP      -------------------------------------------------------------TPKRIASAF
GCH1_NITMU      ------------------------------------------------------------ETPERVTRAW
GCH1_SULSO      ----------------------------------------------------------------------
GCH1_SULIY      ----------------------------------------------------------------------
GCH1_SULIN      ----------------------------------------------------------------------
GCH1_SULIM      ----------------------------------------------------------------------
GCH1_SULIL      ----------------------------------------------------------------------
GCH1_SULIK      ----------------------------------------------------------------------
GCH1_SULIA      ----------------------------------------------------------------------
GCH1_THENV      ----------------------------------------------------------------------
GCH1_PYRAE      ----------------------------------------------------------------------
GCH1_EUGGR      ----------------------------------------------------------------------
GCH1_RALSO      -------------------------------------------AVQSLLEASGIEIDTAHKTAQRVRELW
GCH1_CHRVO      ------------------------------------------RAVADMLTASGIAIDPIHKTAQRVRELW


                         .         .         *         .         .         .         .:140
query           TQEIFNGLDYANFPACALYENEFNYTGVLTQKNITIMSFCEHHFVPFEGTAEVSFIPKNNNIIGLCRINS
GCH1_VIBHB      VDEIFSGLDYSNFPKITVIENKMNVSEMVRVKDITVTSTCEHHLVTIDGKAAVAYIPR-GKIIGLSKINR
GCH1_HAEDU      VDEIFSGLDYATFPKITTIENRMKVSEMVLVDDITLTSTCEHHFVTIDGKVAVAYYPKKW-VIGLSKINR
GCH1_VIBCH      VDEIFSGLDYANFPKITVIENKMKVSEMVKVKDITLTSTCEHHLVTIDGTAAVAYIPR-GKIIGLSKINR
GCH1_ACTPJ      VDEIFSGLDYATFPKITNIENRMKVSEMVLVDDITLTSTCEHHFVTIDGKVAVAYYPKKW-VIGLSKINR
GCH1_ACTP7      VDEIFSGLDYATFPKITNIENRMKVSEMVLVDDITLTSTCEHHFVTIDGKVAVAYYPKKW-VIGLSKINR
GCH1_ACTP2      VDEIFSGLDYATFPKITNIENRMKVSEMVLVDDITLTSTCEHHFVTIDGKVAVAYYPKKW-VIGLSKINR
GCH1_PASMU      VDEIFSGLDYANFPKITNIENRMKVSEMVLVNDVTLTSTCEHHFVTIDGMVSVAYYPKKW-VIGLSKINR
GCH1_MANSM      IDEIFSGLDYTNFPKITNIENRMKVSEMVLVNDVTLTSTCEHHFVTIDGLVSVAYYPKKW-VIGLSKINR
GCH1_HAES2      IDEIFSGLDYANFPKITNIENRMKVSEMVLVDDVTLTSTCEHHFVTIDGKVSVAYYPQKW-VIGLSKINR
GCH1_HAES1      IDEIFSGLDYANFPKITNIENRMKVSEMVLVDDVTLTSTCEHHFVTIDGKVSVAYYPQKW-VIGLSKINR
GCH1_HAEIE      IDEIFSGMDYANFPKMTKIKNQMKVSEMVQVNDITLTSTCEHHFVTIDGKVCVAYYPKDW-VIGLSKINR
GCH1_HAEI8      IDEIFSGMDYANFPKMTKIKNQMKVSEMVQVNDITLTSTCEHHFVTIDGKVCVAYYPKDW-VIGLSKINR
GCH1_WIGBR      IEEIFSGLNYNNFPKITLIKNTSKINDLITVNNIVLNSTCEHHFLIFEGKAIVSYIP-DKILIGLSKINR
GCH1_HAEIN      IDEIFSGMDYANFPKMTKIKNQMKVSEMVQVNDITLTSTCEHHFVTIDGKVCVAYYPKDW-VIGLSKINR
GCH1_BLOFL      VEEIFSGLDYLNFPKITIIANTMQISEMITVRNINITSVCEHHFIIFNGKATVSYIPRKS-VIGLSKINK
GCH1_HAEIG      IDEIFSGMDYANFPKMTKIKNQMKVSEMVQVNDITLTSTCEHHFVTIDGKVCVAYYPKDW-VIGLSKINR
GCH1_VIBPA      VDEIFSGLDYSNFPKITVIENKMNVSEMVRVKDITVTSTCEHHLVTIDGKAAVAYIPRGK-IIGLSKINR
GCH1_ERWT9      VNEVFSGLDYANFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVIIDGQATVAYIPK-DKVIGLSKINR
GCH1_TOLAT      VDEIFSGLDYGSFPKITLIENKMGTDEMIKVQDIGLTSTCEHHFVTIDGKATVAYIPKDK-IIGLSKINR
GCH1_PECCP      VDEIFSGLDYANFPKITIIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DGVIGLSKLNR
GCH1_VIBVY      VDEVFSGLDYQNFPKITVIENKMNVSEMVRVKEITLTSTCEHHLVTIDGKAAVAYIPRGK-IIGLSKINR
GCH1_VIBVU      VDEVFSGLDYQNFPKITVIENKMNVSEMVRVKEITLTSTCEHHLVTIDGKAAVAYIPRGK-IIGLSKINR
GCH1_ERWCT      VDEIFSGLDYANFPKITIIENKMKVDEMVTVRDITLTSTCEHHFVMIDGKATVAYIPK-DGVIGLSKLNR
GCH1_PHOPR      VDEVFSGLDYANFPKITVIENKMKCDEMVRVKGITLTSTCEHHLVTIDGKATVAYIPRGK-IIGLSKINR
GCH1_SODGM      VEEIFAGLDYANFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVIIDGKATVSYIPK-HCVIGLSKINR
GCH1_BLOPB      IEEIFSGLDYSNFPKIAIIQNTMQINEMITVRGINITSTCEHHFIVFNGKVTISYIPE-KNVIGLSKINR
GCH1_FLAJ1      VKEIFGGLNPAKQPKASTFDNNYKYGEMLVEKNITVYSTCEHHLLPIIGRAHVAYI-SSGRVIGLSKMNR
GCH1_VIBFM      VDEIFSGLDYANFPKITVIENKMNCDEMVRVNDITLTSTCEHHLVTIDGKATVAYIPR-GKIIGLSKINR
GCH1_VIBF1      VDEIFSGLDYANFPKITVIENKMNCDEMVRVNDITLTSTCEHHLVTIDGKATVAYIPR-GKIIGLSKINR
GCH1_EDWI9      VDEIFSGLDYANFPKITIIENKMDVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-ERVIGLSKINR
GCH1_SHISS      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_SHIFL      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_SHIF8      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_SHIDS      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_SHIBS      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_SHIB3      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_SERP5      VDEIFSGLDYANFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DAVIGLSKINR
GCH1_ESCF3      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_ECOUT      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_ECOSM      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_ECOSE      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_ECOLU      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_ECOLI      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_ECOLC      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_ECOL6      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_ECOL5      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_ECOK1      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_ECOHS      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_ECODH      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_ECOBW      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_ECO8A      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_ECO81      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_ECO7I      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_ECO5E      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_ECO57      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_ECO55      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_ECO45      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_ECO27      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_ECO24      VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_ALISL      VDEIFSGLDYANFPKITVIENKMNCDEMVRVNDITLTSTCEHHLVTIDGKATVAYIPR-EKIIGLSKINR
GCH1_HAMD5      VDEIFLGLDYAHFPEITLIQNKMQVDEMITVHDISLSSTCEHHFASIDGKATVAYIPK-DYIIGLSKINR
GCH1_SHELP      VDEIFSGLDYENFPKITVIENKMGFDEMVKVNDISLTSTCEHHLVTIDGVATVAYLPR-KNIIGLSKINR
GCH1_AERHH      VNEIFSGLDYATFPKVTVIENKMKVDEMIMVRDISLTSTCEHHFVTIDGLAHVAYIPR-GKVIGLSKINR
GCH1_SHEDO      VDEIFSGLDYDNFPKITVIDNKMGFDEMVRVQDISLTSTCEHHLVTIDGLATVAYLPRAK-IIGLSKINR
GCH1_ENT38      VDEIFSGLDYANFPKITVIENKMNVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DTVIGLSKINR
GCH1_YERPY      VDEIFSGLDYENFPKITLIQNKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_YERPG      VDEIFSGLDYENFPKITLIQNKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_YERPE      VDEIFSGLDYENFPKITLIQNKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_YERPB      VDEIFSGLDYENFPKITLIQNKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_YERP3      VDEIFSGLDYENFPKITLIQNKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_CITK8      VDEIFSGLDYANFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_SALTY      VDEIFAGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_SALTI      VDEIFAGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_SALSV      VDEIFAGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_SALPK      VDEIFAGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_SALPC      VDEIFAGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_SALPB      VDEIFAGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_SALPA      VDEIFAGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_SALNS      VDEIFAGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_SALHS      VDEIFAGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_SALEP      VDEIFAGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_SALDC      VDEIFAGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_SALCH      VDEIFAGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_SALAR      VDEIFAGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_SALA4      VDEIFAGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_AERS4      VNEIFSGLDYSTFPKVTVIENKMKVDEMIMVRDISLTSTCEHHFVTIDGLAHVAYIPR-GKVIGLSKINR
GCH1_BAUCH      IEEIFPGLDYANFPQITLISNKMKADEMVTVRNITLTSTCEHHFLMIDGKATVSYIPK-SNVIGLSKINR
GCH1_SALG2      VDEIFAGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DYVIGLSKINR
GCH1_YERE8      VDEIFSGLDYENFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_KLEP7      VDEIFSGLDYSRFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DSVIGLSKINR
GCH1_PHOLL      VDEIFSGLDYSNFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DKVIGLSKINR
GCH1_KLEP3      VDEIFSGLDYSRFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPK-DAVIGLSKINR
GCH1_SHEAM      VDEIFSGLDYENFPKITVIDNKMGVDEMVRVQDISLTSTCEHHLVTIDGTATVAYLPR-KKIIGLSKINR
GCH1_SHEB9      VDEIFSGLDYANFPKITVIDNKMGFDEMVRVQDISLTSTCEHHLVTIDGTATIAYLPR-KKIIGLSKINR
GCH1_SHEB8      VDEIFSGLDYANFPKITVIDNKMGFDEMVRVQDISLTSTCEHHLVTIDGTATIAYLPR-KKIIGLSKINR
GCH1_SHEB5      VDEIFSGLDYANFPKITVIDNKMGFDEMVRVQDISLTSTCEHHLVTIDGTATIAYLPR-KKIIGLSKINR
GCH1_SHEB2      VDEIFSGLDYANFPKITVIDNKMGFDEMVRVQDISLTSTCEHHLVTIDGTATIAYLPR-KKIIGLSKINR
GCH1_SHESR      VDEIFSGLDYENFPKITVIDNKMGFDEMVRVQDISLTSTCEHHLVTIDGTATIAYIPR-KKIIGLSKINR
GCH1_SHESM      VDEIFSGLDYENFPKITVIDNKMGFDEMVRVQDISLTSTCEHHLVTIDGTATIAYIPR-KKIIGLSKINR
GCH1_SHESA      VDEIFSGLDYENFPKITVIDNKMGFDEMVRVQDISLTSTCEHHLVTIDGTATIAYIPR-KKIIGLSKINR
GCH1_SHEON      VDEIFSGLDYANFPKITVIDNKMGFDEMVRVQDISLTSTCEHHLVTIDGTATIAYLPR-KKIIGLSKINR
GCH1_SHESW      VDEIFSGLDYENFPKITVIDNKMGFDEMVRVQDISLTSTCEHHLVTIDGTATIAYLPR-KKIIGLSKINR
GCH1_SHEPC      VDEIFSGLDYENFPKITVIDNKMGFDEMVRVQDISLTSTCEHHLVTIDGTATIAYLPR-KKIIGLSKINR
GCH1_THETN      -EEIFSGLHTDVKDVIKIFQED-EHQEIILVKDIPLYSMCEHHLLPFIGVAHVAYLPRKGRILGLSKVAR
GCH1_DESRM      -QEIFAGLGEDPEEHLGKTFSEEHEEMVIV-KDIRLFSMCEHHLIPFIGKAHVCYIPRNGNVTGLSKLAR
GCH1_BUCAP      VNEIFSGLDYKNFPKIMLMDNKIKFHEMIIVRDILLISTCEHHFITINGQATIAYIPE-NKIIGLSKINR
GCH1_CARHZ      -EEVFAGLSQDPSEHLERYFTEEHEEMVLV-KDIPLYSMCEHHLLPFYGKAHVAYIPRKGKVTGLSKLAR
GCH1_THEPX      -EEIFAGLHTDVKDVIKIFQED-EHQEIILVKDIPLYSMCEHHLLPFIGVAHVAYLPRKGRILGLSKLAR
GCH1_THEP3      -EEIFAGLHTDVKDVIKIFQED-EHQEIILVKDIPLYSMCEHHLLPFIGVAHVAYLPRKGRILGLSKLAR
GCH1_STRA1      I-EMFSGLNQDPKEQFTAVFSE-NHEEVVIVKDIPFYSMCEHHLVPFYGKAHIAYLPNDGRVTGLSKLAR
GCH1_PELTS      -EEIFSGLQEDPEEHLQKIFSEEHEEMVIV-KDIPLYSICEHHLLPFYGKAHVAYIPRKGKVTGLSKLAR
GCH1_STRA3      I-EMFSGLNQDPKEQFTAVFSE-NHEEVVIVKDIPFYSMCEHHLVPFYGKAHIAYLPNDGRVTGLSKLAR
GCH1_THEFY      AEQ-FAGLSQRPEDVLTTVF-EANHEEMVLVKDIELYSTCEHHLVPFYGAAHVGYIPNTDGITGLSKLAR
GCH1_FUSNN      -KEIFYGIDID--PKEVLTKTEVNSNELIMEKNMDFYSMCEHHFLPFFGTVCIAYVP-NKKIFGFGDILK
GCH1_STRA5      I-EMFSGLNQDPKEQFTAVFSE-NHEEVVIVKDIPFYSMCEHHLVPFYGKAHIAYLPNDGRVTGLSKLAR
GCH1_STRMU      -QEMFAGLNEDQFTAVFSEEHE----DVVLVKDIPFYSMCEHHLVPFHGLAHVAYIPSDGCVTGLSKLAR
GCH1_THEYD      -EEIFRGLLPPDEDLLKSIEGETHDEMVLI-KDIPFYSVCEHHLLPFFGNAHIAYIP-DGRIVGLSELPK
GCH1_STRGC      -QEVFSGLGRDPKDEFTAVFSE-GHEEVVLVKDIPFHSMCEHHLLPFYGVAHVAYLPSNGKVTGLSKLAR
GCH1_CLOD6      -EEIFSGLSEEPRDHLKVLFADEKHEELVLVKDIPFYSCCEHHLVPFFGKAHIAYLPKGGRLTGLSKLAR
GCH1_RICTY      -MEIFSGYDVQEILNTKFYDT-YNFQDLISLEGIKFTSFCEHHILPFNGTVHIAYIP-DNCIIGVSKLAR
GCH1_LACPL      A-EVFATKTAAPFDNYKLFKVE-HPTEMVLLKDIPFYSMCEHHLLPFFGTVQVAYVPQHEQVIGLSKIPR
GCH1_RICFE      T-EIFSGYDVAEILNTKFYDT-CNFQDFILLKDIKFTSFCEHHMLPFIGTVDIAYIP-DNCIVGISKLAR
GCH1_PERMH      --EEFKS--YENFNM-TVFEDIGDYNEMVVVRDIQFYSFCEHHLLPFFGKAHIAYIPEKK-VCGLSKLVR
GCH1_LISMO      -EEVFAGLKKPSVHFDTIFEEQ--HEELVLVKDIRFSSMCEHHLVPFFGVAHVAYLPQNGRVAGLSKLAR
GCH1_LISMH      -EEVFAGLKKPSVHFDTIFEEQ--HEELVLVKDIRFSSMCEHHLVPFFGVAHVAYLPQNGRVAGLSKLAR
GCH1_BACA2      A-EVFSGL---NEDPKEHFKTVFDHEELVLVKDIAFHSMCEHHLVPFYGKAHIAYIPRGGKVTGLSKLAR
GCH1_CLOK5      T-EIFSGLKEK--PEEHLKKVTVNNDDIVLEKDIQFYSMCEHHFMPFYGKTHVAYIP-NGKVVGLSKLAR
GCH1_CLOK1      T-EIFSGLKEK--PEEHLKKVTVNNDDIVLEKDIQFYSMCEHHFMPFYGKTHVAYIP-NGKVVGLSKLAR
GCH1_BREBN      A-EVFEGM---HIDEEQYFETVFSHEEMVLVKDIPFYSMCEHHLVPFFGKAHVAYVPRGGRVVGLSKLAR
GCH1_BACSU      A-EVFSGL---NEDPKEHFQTIFNHEELVLVKDIAFHSMCEHHLVPFYGKAHVAYIPRGGKVTGLSKLAR
GCH1_STRGG      -KEIFAGL-YQEPEDVLTTTFDLGHDEMVLVKDIEVFSTCEHHLVPFRGVAHVGYIPATTGITGLSKLAR
GCH1_LEPBP      ---------------------EENTTGMVLVRDIEMYSLCEHHLLPFYGRAHVAYIP-NKKIIGISKIPR
GCH1_LEPBA      ---------------------EENTTGMVLVRDIEMYSLCEHHLLPFYGRAHVAYIP-NKKIIGISKIPR
GCH1_LISMF      -EEVFAGLKKPSVHFDTIFEEQ--HEELVLVKDIRFSSMCEHHLVPFFGVAHVAYLPQNGRVAGLSKLAR
GCH1_LISMC      -EEVFAGLKKPSVHFDTIFEEQ--HEELVLVKDIRFSSMCEHHLVPFFGVAHVAYLPQNGRVAGLSKLAR
GCH1_LISIN      -EEVFAGLKKPSVHFDTIFEEQ--HEELVLVKDIRFSSMCEHHLVPFFGVAHVAYLPQNGRVAGLSKLAR
GCH1_BACHD      -EEVFAGLNQDPKEHFATIFGEDHEELVLV-KDIPFFSMCEHHLVPFFGKAHVGYIPKGGKVTGLSKLAR
GCH1_CORA7      A-EVFAGLHQD--PTEVLHKTAEEHQELVLVRDIPIYSTCEHHLVPFYGTAHIGYIPTDGHVTGLSKLAR
GCH1_LISW6      -EEVFSGLKKIHFDTIFAEQHE----ELVLVKDIRFSSMCEHHLVPFFGVAHVAYLPQNGRVAGLSKLAR
GCH1_CLOTH      CEEIFAGLHQDPKSVVKVFQEE-NHEEMVMVKDIPIYSICEHHLLPFIGVAHVVYIPRKGKIMGLSKLAR
GCH1_CORGL      -KETFAGLH--EDPTTVL-EKTFSHEELVLVREIPIYSMCEHHLVPFFGVAHIGYIPKSGKVTGLSKLAR
GCH1_STRT2      A-EMFSGLNEDPKDQFTAVFSEVHDEVVLV-KDIPFYSMCEHHLVPFYGMAHVAYLPSGDKVTGLSKLAR
GCH1_STRT1      A-EMFSGLNEDPKDQFTAVFSEVHDEVVLV-KDIPFYSMCEHHLVPFYGMAHVAYLPSGDKVTGLSKLAR
GCH1_LEPBL      --------------------------GMILVRDIEVYSLCEHHLLPFYGRAHVAYLP-NKKIIGISKIPR
GCH1_LEPBJ      --------------------------GMILVRDIEVYSLCEHHLLPFYGRAHVAYLP-NKKIIGISKIPR
GCH1_STRCO      -REIFAGLWQE--PEDVLTTTDLGHDEMVLVKDIEVFSTCEHHLVPFRGVAHVGYIPSTSGITGLSKLAR
GCH1_RICPR      T-EIFSGYGK---DAQEILNTKFNFQDLISLEGIKFTSFCEHHILPFNGTVHIAYIP-DNCIIGVSKLAR
GCH1_LYSSC      A-EMFSGLDAKDYFRTVFHED---HEELVLVKDIPFYSMCEHHLVPFYGKAHVAYIPNDGIVAGLSKLGR
GCH1_STRSY      L-EMFNGLEEDPKDQFTAVFSE-GHEEVVLVKDIPFHSMCEHHLVPFYGIAHVAYIPSKGRVTGLSKLAR
GCH1_STRS2      L-EMFNGLEEDPKDQFTAVFSE-GHEEVVLVKDIPFHSMCEHHLVPFYGIAHVAYIPSKGRVTGLSKLAR
GCH1_STRAW      -REIFAGLWQK--PEDVLTTTDIGHDEMVLVKDIEVLSSCEHHLVPFVGVAHVGYIPSTDGITGLSKLAR
GCH1_RICRS      A-EIFSGYDVAEILNTKFYET-CNFRDFILL-NIKFTSFCEHHILPFNGTVDIAYVP-DNCIVGISKLAR
GCH1_RICRO      A-EIFSGYDVAEILNTKFYET-CNFRDFILL-NIKFTSFCEHHILPFNGTVDIAYVP-DNCIVGISKLAR
GCH1_RICPU      A-EIFSGYDVAEILNTKFYET-CNFRDFILL-NIKFTSFCEHHILPFNGTVDIAYVP-DNCIVGISKLAR
GCH1_RICM5      A-EIFSGYDVAKILNTKFYET-CNFQDFILL-NIKFTSFCEHHILPFNGTVDIAYVP-DNCIVGISKLAR
GCH1_LEPIN      --------------------------GMVLVRDIEMYSLCEHHLLPFYGKAHVAYLP-NKKIIGISKIPR
GCH1_LEPIC      --------------------------GMVLVRDIEMYSLCEHHLLPFYGKAHVAYLP-NKKIIGISKIPR
GCH1_BACFR      TLTKGYHMDPHEVLRSAKFQEE--YSQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIP-NGYITGLSKIAR
GCH1_BACFN      TLTKGYHMDPHEVLRSAKFQEE--YSQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIP-NGYITGLSKIAR
GCH1_RICAE      V-EIFSGYDVAEILNTKFYET-CNFQDFILL-NIKFTSFCEHHILPFNGTVDIAYIP-DNCIVGISKLAR
GCH1_BACP2      -EEVFSGLNEDPKEHFKTIFGEDHEELVLV-KDIAFHSMCEHHLVPFYGKAHVAYIPRGGKVTGLSKLAR
GCH1_GEOKA      A-EVFAGLQEQHFQTVFSEEHE----ELVLVKDIPFYSMCEHHLVPFFGAAHVAYIPREGKVTGLSKLAR
GCH1_CHLCH      R---FLTKGYHENPEELLQKALFSYDEMVLVRDIDLFSMCEHHMLPFFGKAHVAYIP-DGKIVGLSKLAR
FOLKE_LACLA     -EEILSSQRLSKFNEYKLFEIDSSKTSIVLIKDIPFYSMCEHHMLPFFGKAHVAYIPADGKIIGLSKIPR
GCH1_RICAH      T-EIFSGYDVEEILNTKFYDT-CNFQDFISLEGIKFTSFCEHHMLPFNGTVHIAYIP-DNCIVGISKLAR
GCH1_MYCA1      -REMFAGL-YTDPDSVLNTMFDEEHDELVLVKEIPLYSTCEHHLVSFHGVAHVGYIPGNDGVTGLSKIAR
GCH1_DEHSC      T-ELFSGMNQD--PAEVLRVGELGHREMVIIKDIPFYSMCEHHLLPFSGVVHIGYIPNDGRVVGISKLAR
GCH1_DEHSB      T-ELFSGMNQD--PAEVLRVGELGHREMVIIKDIPFYSMCEHHLLPFSGVVHIGYIPNDGRVVGISKLAR
GCH1_CORGB      -KETFAGLH--EDPTTVL-EKTFSHEELVLVREIPIYSMCEHHLVPFFGVAHIGYIPKSGKVTGLSKLAR
GCH1_CLOP1      -EEIFSGIGM-NAKEHLSKTFEVHSNDLVLEKDITFYSMCEHHLVPFYGKVHIAYIP-NGRVVGLSKLAR
GCH1_CHICK      TAMQFFTKGYQETIADVLNDAIFDHDEMVIVKNIDMFSLCEHHLVPFVGKVHIGYLP-NKQVLGLSKLAR
GCH12_ANASP     --ELLNG---------AVFTEDANEMVLI--RDIDIFSSCEHHILPIIGRAHVAYIP-NGKVIGLSKIAR
GCH1_STRZT      -QEIFSGLGQTAEEHLSK-SFEIIDDNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIP-DGRVAGLSKLAR
GCH1_RICCN      V-EIFSGYDVAEILNTKFYET-CNFRDFILL-NIKFTSFCEHHILPFNGTVDIAYVP-DNCIVGISKLAR
GCH1_RICBR      -EEIFSGYG-KNIEE--ILETKFSDTGFISLEGIKFTSFCEHHMLPFSGTVHIAYIP-DNCIVGISKLAR
GCH1_RICB8      -EEIFSGYG-KNIEE--ILETKFSDTGFISLEGIKFTSFCEHHMLPFSGTVHIAYIP-DNCIVGISKLAR
GCH1_MYCPA      -REMFAGL-YTDPDSVLNTMFDEEHDELVLVKEIPLYSTCEHHLVSFHGVAHVGYIPGNDGVTGLSKIAR
FOLKE_LACLM     -EEILSSQRLTNFNEYKLFEIDSSKNSIVLIKDIPFYSMCEHHMLPFFGKAHVAYIPDGGRIIGLSKIPR
GCH1_CLOPE      -EEIFSGIGM-NAKEHLSKTFEVHSNDLVLEKDITFYSMCEHHLVPFYGKVHIAYIP-NGRVVGLSKLAR
GCH1_STRZP      -QEIFSGLGQTAEEHLSK-SFEIIDDNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIP-DGRVAGLSKLAR
GCH1_STRZJ      -QEIFSGLGQTAEEHLSK-SFEIIDDNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIP-DGRVAGLSKLAR
GCH1_STRPS      -QEIFSGLGQTAEEHLSK-SFEIIDDNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIP-DGRVAGLSKLAR
GCH1_STRPN      -QEIFSGLGQTAEEHLSK-SFEIIDDNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIP-DGRVAGLSKLAR
GCH1_STRPJ      -QEIFSGLGQTAEEHLSK-SFEIIDDNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIP-DGRVAGLSKLAR
GCH1_STRPI      -QEIFSGLGQTAEEHLSK-SFEIIDDNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIP-DGRVAGLSKLAR
GCH1_STRP7      -QEIFSGLGQTAEEHLSK-SFEIIDDNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIP-DGRVAGLSKLAR
GCH1_STRP4      -QEIFSGLGQTAEEHLSK-SFEIIDDNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIP-DGRVAGLSKLAR
GCH1_PROVI      A---FLTRGYRQDPEEMLKKAVFSYDEMVLVKDIDIFSMCEHHMLPFFGKAHVAYIP-DGKIVGLSKLAR
GCH1_PORGI      LTKGYNEDPEAILRA-AMFEED--YQQMVIVKDIDFFSMCEHHMLPFFGKAHVGYIP-NRYITGLSKLPR
GCH1_PORG3      LTKGYNEDPEAILRA-AMFEED--YQQMVIVKDIDFFSMCEHHMLPFFGKAHVGYIP-NRYITGLSKLPR
GCH1_PELUB      -KEYFGGYTE---DAEKILEKTFGYDDMVVEKNISVSSHCEHHMAPIVGTAHVAYIP-NERVVGLSKLAR
GCH1_MYCA9      -REIFAGL-YTDPDTVLNTTFDEQHDELVLVKSIPMYSTCEHHLVSFHGVAHVGYIPQHGRVTGLSKIAR
GCH1_CLOPS      -EEIFSGIGM-NAKEHLSKTFEVHSNDLVLEKDITFYSMCEHHLVPFYGKVHIAYIP-NGRVVGLSKLAR
GCH1_BRUSU      -QELFGG--YSESPEEVLFEEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGR-VVGLSKIAR
GCH1_BRUSI      -QELFGG--YSESPEEVLFEEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGR-VVGLSKIAR
GCH1_BRUO2      -QELFGG--YSGSPEEVLFEEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGR-VVGLSKIAR
GCH1_BRUME      -QELFGG--YSESPEEVLFEEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGR-VVGLSKIAR
GCH1_BRUMB      -QELFGG--YSESPEEVLFEEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGR-VVGLSKIAR
GCH1_BRUC2      -QELFGG--YSESPEEVLFEEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGR-VVGLSKIAR
GCH1_BRUAB      -QELFGG--YSESPEEVLFEEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGR-VVGLSKIAR
GCH1_BRUA2      -QELFGG--YSESPEEVLFEEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGR-VVGLSKIAR
GCH1_BRUA1      -QELFGG--YSESPEEVLFEEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGR-VVGLSKIAR
GCH1_BIFLO      CRELFTGLQAS--PADALEKHDVDTDELVLVKDIELYSVCEHHLLPFHGVAHVGYIPAKDGVMGLSKLAR
GCH1_STRR6      -QEIFSGLGQTAEEHLSK-SFEIIDDNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIP-DGRVAGLSKLAR
GCH1_STRP2      -QEIFSGLGQTAEEHLSK-SFEIIDDNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIP-DGRVAGLSKLAR
GCH1_PARD8      Q---FLTKGYHEDPEAVLRSAMFDYKQMVIVKDIDFFSLCEHHMLPFFGKAHVAYIPKKY-ITGLSKIPR
GCH1_LACSS      G-EVLAYQGETIFKDYKLFETETDDDQMVMMQDIPFYSMCEHHMLPFFGQVSVAYLPANGQIIGLSKIPR
GCH1_COREF      -REIFAGLH--EDPTAVLNKTSEDHQELVLVREIPIYSTCEHHLVPFFGVAHIGYIPESGQVTGLSKLAR
GCH1_MYCTU      -REMFAGL-YTDPDSVLNTMFDEDHDELVLVKEIPMYSTCEHHLVAFHGVAHVGYIPGDDGVTGLSKIAR
GCH1_MYCTA      -REMFAGL-YTDPDSVLNTMFDEDHDELVLVKEIPMYSTCEHHLVAFHGVAHVGYIPGDDGVTGLSKIAR
GCH1_MYCBT      -REMFAGL-YTDPDSVLNTMFDEDHDELVLVKEIPMYSTCEHHLVAFHGVAHVGYIPGDDGVTGLSKIAR
GCH1_MYCBP      -REMFAGL-YTDPDSVLNTMFDEDHDELVLVKEIPMYSTCEHHLVAFHGVAHVGYIPGDDGVTGLSKIAR
GCH1_MYCBO      -REMFAGL-YTDPDSVLNTMFDEDHDELVLVKEIPMYSTCEHHLVAFHGVAHVGYIPGDDGVTGLSKIAR
GCH11_PSEAE     QEEIVNGALFAS-------DND----EMVIVRDIELYSLCEHHLLPFIGKAHVAYIP-TGKVLGLSKVAR
GCH1_RHILO      -REMFGGYDMC--PAEELFEEVAGYDDLVIVKDIHFHSHCEHHMVPIIGKAHVGYLP-DGKVVGLSKIAR
GCH1_BACCN      A-EVFSGMHEDPKEHLHKVFGEDHEELVLV-KDIPFYSMCEHHLVPFYGVAHVAYIPRGGKVTGLSKLAR
GCH1_GEOSW      A-EVFAGLHEDPKQHFQTVFSEDHEELVLV-KDIPFYSMCEHHLVPFFGVAHVAYIPRGGKVTGLSKLAR
GCH1_DICDI      TQGYEQSVDEVIGEAIF---NE-NHHEMVVVRDIDIFSLCEHHMVPFHGKCHIGYIP-DQKVLGLSKLAR
GCH1_CLOAB      -EEVFKGMEYSNDDIAEMFNKTFEEDNIVLVKDIEIFSHCEHHLLMYNMTVAVAYIP-NKRLIGLSKIAR
GCH1_CHLTE      R---FLTKGYRQDPEQLLKKAVFSYDEMVLVKDIDIYSMCEHHMLPFFGKAHVAYIP-DGKIVGLSKIPR
GCH1_MYCVP      -QEIFAGL-YTDPDEVLKTMFDEQHDEMVLVKDIPMYSTCEHHLVSFHGVAHVGYIPGDGRVTGLSKLAR
GCH1_ENTFA      A-EVFSGLTEPEFDDYKLFDS-LNEGEMVLVKDIAFYSMCEHHLLPFYGKVHVAYLPEGGKVLGLSKLPR
GCH1_CLONN      -EEIFSGI--RETPEKHLXXXXXXXXXXXXXXXIQFYSMCEHHFLPFFGKVHIAYIP-NGKVVGLSKLAR
GCH1_FINM2      -EEIFSGL---NQDAKTHLSKSFEIVNMVIEKDIPFYSMCEHHLLPFWGKVNIAYIP-NKRVAGLSKLAR
GCH1_BACWK      A-EVFSGMHEDPKEHLHKVFGEDHEELVLV-KDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLAR
GCH1_BACHK      A-EVFSGMHEDPKEHLHKVFGEDHEELVLV-KDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLAR
GCH1_BACCZ      A-EVFSGMHEDPKEHLHKVFGEDHEELVLV-KDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLAR
GCH1_BACCR      A-EVFSGMHEDPKEHLHKVFGEDHEELVLV-KDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLAR
GCH1_BACCQ      A-EVFSGMHEDPKEHLHKVFGEDHEELVLV-KDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLAR
GCH1_BACC7      A-EVFSGMHEDPKEHLHKVFGEDHEELVLV-KDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLAR
GCH1_BACC4      A-EVFSGMHEDPKEHLHKVFGEDHEELVLV-KDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLAR
GCH1_BACC3      A-EVFSGMHEDPKEHLHKVFGEDHEELVLV-KDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLAR
GCH1_BACC2      A-EVFSGMHEDPKEHLHKVFGEDHEELVLV-KDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLAR
GCH1_BACC1      A-EVFSGMHEDPKEHLHKVFGEDHEELVLV-KDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLAR
GCH1_BACC0      A-EVFSGMHEDPKEHLHKVFGEDHEELVLV-KDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLAR
GCH1_BACAN      A-EVFSGMHEDPKEHLHKVFGEDHEELVLV-KDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLAR
GCH1_BACAH      A-EVFSGMHEDPKEHLHKVFGEDHEELVLV-KDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLAR
GCH1_BACAC      A-EVFSGMHEDPKEHLHKVFGEDHEELVLV-KDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLAR
GCH1_BACAA      A-EVFSGMHEDPKEHLHKVFGEDHEELVLV-KDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLAR
GCH1_STRP8      A-EMFLGLGKEEFTAVFKEQHE----DVVIVKDISFYSICEHHLVPFYGKAHIAYLPSDGRVTGLSKLAR
GCH1_STRP6      A-EMFLGLGKEEFTAVFKEQHE----DVVIVKDISFYSICEHHLVPFYGKAHIAYLPSDGRVTGLSKLAR
GCH1_STRP1      A-EMFLGLGKEEFTAVFKEQHE----DVVIVKDISFYSICEHHLVPFYGKAHIAYLPSDGRVTGLSKLAR
GCH1_RHOBA      A-EMFAGLDPGRHLAKVFAED---YDEIVLVRDISFCSMCEHHLLPFTGKAHIAYLP-SGKVVGLSKLAR
GCH1_METS4      EQ-IFGG--YRQEPTHILFEEVEGYGDIVLVRDIPFHSHCEHHMVPFIGRAHIAYYPRRG-VVGLSKLAR
GCH1_BIFLD      CRELFAGLQAS--PADVLEKHDVDTDELVLVKDIELYSVCEHHLLPFHGVAHVGYIPAKDGVMGLSKLAR
GCH1_STRPZ      A-EMFLGLGKEEFTAVFKEQHE----DVVIVKGISFYSICEHHLVPFYGKAHIAYLPSDGRVTGLSKLAR
GCH1_STRPY      A-EMFAGLKKDPKEEFTAVFTE-HHEDVVIVKDISFYSMCEHHQVPFYGKAHIAYLPSDGRVTGLSKLAR
GCH1_STRPG      A-EMFLGLGKDPKEEFTAVFKE-HHEDVVIVKDISFYSICEHHLVPFYGKAHIAYLPSDGRVTGLSKLAR
GCH1_SINMW      -REIFGGYDLAAEDVLGTFEEVSGYDDIVLEKDIPFYSHCEHHMVPIIGKAHIAYLP-NGRVLGLSKIAR
GCH1_DEIRA      A---YMTEGYGQTLAQVVGEGVFAAEGMVIVKDIEFYSMCEHHMLPFYGRAHVAYIP-GTRILGLSKFAR
GCH1_BACTN      SLTKGYHMDPHEVLRSAKFQEE--YSQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIP-NGYITGLSKIAR
GCH1_ALHEH      TKGYQEDLDQVLNGAVFSSDND----EMVIVRNIELYSLCEHHLLPFIGRAHVAYLP-DGKVIGLSKVAR
GCH1_STRP3      A-EMFLGLGKDPKEEFTAVFKE-HHEDVVIVKDISFYSVCEHHLVPFYGKAHIAYLPSDGRVTGLSKLAR
GCH1_MYCUA      -REIFAGL-YTDPDAVLNTMFDEDHDELVLIKEIPLYSTCEHHLVSFHGVAHVGYIPRDGRVTGLSKIAR
GCH1_MYCMM      -REIFAGL-YTDPDAVLNTMFDEDHDELVLIKEIPLYSTCEHHLVSFHGVAHVGYIPRDGRVTGLSKIAR
GCH1_CLOCE      -QEVFEGISYTNDEIAEMFNKTFEEDLVIPKKDIDIFSYCEHHMLMYNMKVAVAYIP-NDKILGLSKIAR
GCH1_SULSY      --EEFESYREMNM---TIFEEVGSYDEMVVVRDIQFYSLCEHHLLPFFGKAHVAYIP-DKKVCGLSKIVR
GCH1_BEII9      -EEFFSGYNAASDVLSRVFEEVHGYDNMVLVRDIPFSSHCEHHMVPFFGVAHIGYYPSEAGVIGLSKLAR
GCH11_ANASP     TEELLNG---------AVFDEGHNE--MVLVRDINFFSLCEHHMLPFMGRAHVAYIP-NQKVVGLSKLAR
GCH1_RAT        TAMQFFTKGYQETISDVLNDAIFDHDEMVIVKDIDMFSMCEHHLVPFVGRVHIGYLP-NKQVLGLSKLAR
GCH1_MYCLE      CRELFSGL-YTDPQTVTMFDEEHNELVIV--KEIPMYSTCEHHLVSFHGVAHIGYLPADGRVTGLSKIAR
GCH1_MYCLB      CRELFSGL-YTDPQTVTMFDEEHNELVIV--KEIPMYSTCEHHLVSFHGVAHIGYLPADGRVTGLSKIAR
GCH1_BARHE      -RDLFTGYDESVEEILGVFEEVSGYNEPVIMKDLSFYSHCEHHMIPIVGKAHIAYFP-DEKIVGLSKIAR
GCH1_RHIME      -REIFGGYDLAEDVLGRTFEEVSGYDDIVLEKDIPFYSHCEHHMVPIIGKAHIAYLP-NGRVLGLSKIAR
GCH1_HYPBU      -EELLEGYDFTEE-----YTWFTEATDLVVVSGIRFYSLCEHHLLPFFGVAHVAYLPRGK-VIGLSKIVR
GCH1_GLOVI      KEELLNGAIF-----------DLGHDELVLVRDIDLFSMCEHHMLPFIGRAHVGYIP-DQKVVGLSKLAR
GCH1_DEHE1      A-ELFSGMNQD--PAEVLRVGELGHREMVIIKDIPFYSMCEHHLLPFSGVVHIGYIPNDGRVVGISKLAR
GCH1_CAMJJ      ----------------ALFESSNNE--MVLVRDIEFYSLCEHHLLPFFGRAHVAYIP-NKKVVGLSKIPR
GCH1_CAMJE      ----------------ALFESSNNE--MVLVRDIEFYSLCEHHLLPFFGRAHVAYIP-NKKVVGLSKIPR
GCH1_CAMJ8      ----------------ALFESSNNE--MVLVRDIEFYSLCEHHLLPFFGRAHVAYIP-NKKVVGLSKIPR
GCH1_SYNP6      TSGYSQSLD--DLVNGAIFDEGHNE--MVLVRDITAFSLCEHHMLPFMGKVHVAYIP-NQKVVGLSKLAR
GCH1_SYNE7      TSGYSQSLD--DLVNGAIFDEGHNE--MVLVRDITAFSLCEHHMLPFMGKVHVAYIP-NQKVVGLSKLAR
GCH1_RHISN      -REIFGGYDLAEDVLGRTFEEVSGYDDIVLEKDVPFYSHCEHHMVPIIGKAHVAYLP-NGRVLGLSKIAR
GCH1_CAMJR      ----------------ALFESSNNE--MVLVRDIEFYSLCEHHLLPFFGRAHVAYIP-NKKVVGLSKIPR
GCH1_AZOVD      -------------------------------KNIELYSLCEHHMLPFIGKAHVAYLP-NGKVLGLSKVAR
GCH1_MYCGI      -REIFAGL-YTDPDEVLTTMFDEQHDEMVLVKDIPMYSTCEHHLVSFHGVAHVGYIPGDGRVTGLSKLAR
GCH1_CAMC5      K---FLTSGYEEDPKEVLNDALFTSSNMVLMRNIEFYSLCEHHLLPIIGRVHVAYIP-NGKVVGLSKIPR
GCH1_CAMC1      K---FLTSGYEQDPKEVLGDALFTSSNMVLMRNIEFYSLCEHHLLPIIGRVHVAYIP-NGKVVGLSKIPR
GCH1_OCHA4      -KELFAG--YTESPEEVLFEEVGGYNDLVLVKDISFHSHCEHHMVPIIGKAHVAYLP-DHKVVGLSKIAR
GCH1_NOSP7      TSGYNQSLE--ELVNDAIFDEGHNE--MVLVRDINFFSLCEHHMLPFMGRAHVAYIP-NQKVVGLSKLAR
GCH1_CAMJD      ----------------ALFESSNNE--MVLVRDIEFYSLCEHHLLPFFGRAHVAYIP-NKKVVGLSKIPR
GCH1_AQUAE      EEERMRNFDMK------LFEEFGGYNEMVLVKDIKFYSLCEHHLLPFFGKVHIAYIP-DKKISGLSKLVR
GCH1_SYNJA      -------------------------------RDITLFSLCEHHLLPFIGKAHVAYIPRQK-VVGLSKIAR
GCH1_SCHPO      EQNLTEVINEAVF--------QEDHEEMVIVRDIDVFSLCEHHLVPFIGKIHIGYIPRKR-VLGLSKLAR
GCH1_BARBK      -KELFSGYESVDEILGVVFEEVAGYDEPVIVKDIFFYSHCEHHMIPIIGKAHVAYLP-DKKIVGLSKIAR
GCH1_SYNJB      -------------------------------RDVSLFSLCEHHLLPFIGKAHVAYIPKQK-VVGLSKIAR
GCH1_BARQU      RDLFIGYGESVEEILGTVFEEVSGYNEPVIVKDISFYSHCEHHMIPIVGKAHIAYLP-DEKVVGLSKIAR
GCH1_RHOP2      -DELFQG--YHQCPAEVLFGETAGYDDFVLVRDISFTSHCEHHVMPFYGKAHIAYTPVER-VVGLSKLAR
GCH1_CAMLR      E---FLNSGYKQDPKQILNDALFESSNMVLVRDIEFYSLCEHHLLPFFGRVHVAYIP-DKKVVGLSKIPR
GCH1_MARMM      -EEWFSGYDADPLKALGTFEDVQGYDDMVMLTNIDVESHCEHHLAPIMGVAHVAYLP-SKAVVGISKIAR
GCH1_SYNY3      -QFLTQGYDQSKLVNGAIFDEGHNE--MVLVRDIDFFSLCEHHMLPFMGKAHLAYIP-NQKVVGLSKLAR
GCH1_MESSB      -QELFGGYDLC--PAEELFEEVAGYEDMVLVKDIPFHSHCEHHMVPIVGKAHVGYLP-DGKVVGLSKIAR
GCH1_CAEEL      TKGYDDQLDEL------LNEAVFDHDEMVIVKDIEMFSLCEHHLVPFMGKVHIGYIP-NKKVLGLSKLAR
GCH12_PSEAE     -------------------------------KDIELYSLCEHHLLPFIGKAHVAYIP-NGKVLGLSKVAR
GCH1_RHOPT      -DELFQG--YHQCPKEVLFGETAGYDDFVLVRNISFTSHCEHHVMPFYGKAHIAYTPVER-VVGLSKLAR
GCH1_RHOPA      -DELFQG--YHQCPKEVLFGETAGYDDFVLVRNISFTSHCEHHVMPFYGKAHIAYTPVER-VVGLSKLAR
GCH1_RHOPS      -DELFQG--YHQCPAEVLFGETAGYDDFVLVRDIGFTSHCEHHVMPFYGKAHIAYTPVER-VVGLSKLAR
GCH1_METCA      -------------------------------KDIELYSLCEHHLLPFIGKCHVGYLPQGK-VIGLSKIAR
GCH1_HELPY      -KFLYKG--YKEDPRVALKSAYFQGVEMIVAQNIEFYSTCEHHLLPFLGNISVGYIPKEK-IVGISAIAK
GCH1_THEEB      -------------------------------RDINFFSLCEHHMLPFIGKAHVAYIP-NQRVIGLSKLAR
GCH1_COXBU      -------------------------------KDIELYSLCEHHLLPFIGRCHVAYLP-SGKIIGISKLAR
GCH1_COXBR      -------------------------------KDIELYSLCEHHLLPFIGRCHVAYLP-SGKIIGISKLAR
GCH1_COXBN      -------------------------------KDIELYSLCEHHLLPFIGRCHVAYLP-SGKIIGISKLAR
GCH1_HELPJ      -KFLYKG--YKEDPRVALKSAYFQGVEMIVAQNIEFYSTCEHHLLPFFGNISVGYIPKEK-IVGISAIAK
GCH12_PSEPK     -QYLCNGYDLHEVVNGALFESENDE--MIVVRDIELYSLCEHHMLPFIGKAHVAYLP-TGRVLGLSKVAR
GCH1_MOUSE      -------------------------------KDIDMFSMCEHHLVPFVGRVHIGYLP-NKQVLGLSKLAR
GCH1_HELPS      -KFLYKG--YKEDPKVALKSAYFQGVEMIVAQNIEFYSTCEHHLLPFLGNISLGYIPKEK-IVGISAIAK
GCH1_HELPG      -KFLYKG--YKEDPKVALKSAYFQGVEMIVAQNIEFYSTCEHHLLPFFGNISVGYIPKEK-IVGISAIAK
GCH1_HELP2      -KFLYKG--YKEDPKVALKSAYFQGVEMIVAQNIEFYSTCEHHLLPFLGNISVGYIPKEK-IVGISAIAK
GCH1_BRAJA      -DELYQG--YHQCPAEVLFGETAGYDDFVLVRDIEFTSQCEHHMMPFYGKAHIAYTPVER-VVGLSKLAR
GCH1_STRSV      -QEIFAGLETAEEHLAKSFEIIDN--NMVVEKDIFFHSMCEHHFLPFYGKVHIAYVP-NGRVAGLSKLAR
GCH1_NEUCR      VRDIVNG---------AIFQEGHNEMVIV--KDIEVFSMCEHHLVPFTGKMHIGYIP-SNAVIGISKLPR
GCH1_CHRSD      TQGYGQTLE--SLVNGAVFESQTDEMVLI--KDIELYSMCEHHLLPFIGKCHIAYLPEGR-VLGLSKFAR
GCH1_HUMAN      -------------------------------KDIDMFSMCEHHLVPFVGKVHIGYLP-NKQVLGLSKLAR
GCH1_HYDS0      EEEKERSFDFK------LFEEYSNYSEMIIVKDIPFYSMCEHHLLPFFGKAHIAYIP-NKKICGLSKLVR
GCH1_HELPH      -KFLYKG--YKEDPRVALKSAYFQGVEMIVAQNIEFYSTCEHHLLPFLGNISLGYIPKEK-IVGISAIAK
GCH1_RHOPB      -DELFQG--YHQCPAEVLFGETAGYDDFVLIRDMSFTSHCEHHVMPFYGKAHIAYTPVER-VVGLSKLAR
GCH1_CAUCR      -DEWFAG--YHGDPAKELFEDVQGYDDMVMLRGIDVQSHCEHHMAPFLGKAWIAYMP-TGKVVGLSKLAR
GCH1_AGRT5      -RELFAGYELVQDVLGTTFEEVGGYDDVVLVRDIPFFSHCEHHMVPIVGKAHVAYLPAGR-VLGLSKIAR
GCH1_AZOC5      -DEIYGG--YALSPDDVL-DRTFGEIGSFDDKDIPFTSHCEHHMVPFMGKAHVAYFPVER-VVGLSKIAR
GCH1_PSEA6      -QFLTDGYELNDVVNGAIFEADTDEMVVI--QNIEYYSLCEHHILPFIGQCHIAYLPQGK-VLGLSKFAR
GCH1_HELAH      -QELWNFLGYKEDPKVALKSAYFQGVEMIVAQHIEFYSTCEHHLLPFFGNISLGYIPKEK-IIGISAIAK
GCH1_HAHCH      QEEVTNG---------AVFESDTDE--MVLVKDIELYSLCEHHLLPFIGRCHIAYIP-NGKVLGLSKFAR
GCH11_PSESM     --EIVNG---------ALFASD-NDEMVIVQ-NIELYSLCEHHLLPFIGKAHVAYIP-TGKVLGLSKIAR
GCH1_TERTT      VQEVVND---------ALFPSDSN--DMVVVRDIELFSLCEHHMLPFIGKAHVGYIP-TGKVLGLSKVAR
GCH1_JANMA      -KHWTSGYDQDPAEILKVFEDGAEYNELIVVRGIPVYSHCEHHLAPFFGTATIGYTP-NGKIVGLSKLTR
GCH1_HYPNA      -KEWFEG--YGEDPVKYLFEDVQGYDDIVMLRNIEVESHCEHHIAPFIGKAFIAYKP-STAVVGISKLAR
GCH1_WOLSU      -DKLYSGYTQDPREILGTVFEDGACDEMVVLKNIEFYSMCEHHMLPFFGKVSIGYIP-DQKVVGISKLAR
GCH1_OSTOS      TKGYEQQLD--DILNDAVFDE--NHDEMVIVRDIEMFSLCEHHLVPFNGKVHIGYIP-NKKVLGLSKLAR
GCH1_YEAST      ---------------------EEDHDEMVIVRDIEIYSLCEHHLVPFFGKVHIGYIP-NKKVIGLSKLAR
GCH1_AGRVS      G-ELFGGYNVVEDVLGTTFEEVGGYNDIVLVRDIPFFSHCEHHMLPVIGKAHVAYLP-NGRVLGLSKIAR
GCH1_XYLFM      ------------------FEEISGYDEMIVLRNITYESHCEHHMAPIIGKVHVGYLP-NGKVVGISKLAR
GCH1_CLOB6      -EEVFKGMCYTNDEIAEMFNVTFNVGDMVFMKDIEIFSHCEHHLLMYNMKVAIAYIPKGK-IIGLSKIAR
GCH1_DROME      TEDVLNG---------AVFDEDHDEMVVV--KDIEMFSMCEHHLVPFYGKVSIGYLP-CNKILGLSKLAR
GCH1_XYLFA      ------------------FEEISGYDELIVLRNITYESHCEHHMAPIIGKVHIGYLP-NGKVVGISKLAR
GCH1_CLOBK      -EEVFKGMCYSNDEIAEMFNVTFNENDMVFMKEIEIFSHCEHHLLMYNMKVAIAYIPKKK-IIGLSKIAR
GCH1_CLOBH      -EEVFKGMCYSNDEIAEMFNVTFNENDMVFMKEIEIFSHCEHHLLMYNMKVAIAYIPKKK-IIGLSKIAR
GCH1_CLOB1      -EEVFKGMCYSNDEIAEMFNVTFNENDMVFMKEIEIFSHCEHHLLMYNMKVAIAYIPKKK-IIGLSKIAR
GCH12_PSESM     -------------------------------KDIELYSLCEHHLLPFIGKAHVAYIP-NGKVLGLSKVAR
GCH1_CLOBL      -EEVFKGMCYSNDEIAEMFNVTFNENDMVFMKEIEIFSHCEHHLLMYNMKVAIAYIPKKK-IIGLSKIAR
GCH1_CLOBJ      -EEVFKGMCYSNDEIAEMFNVTFNENDMVFMKEIEIFSHCEHHLLMYNMKVAIAYIPKKK-IIGLSKIAR
GCH1_XYLFT      ------------------------YDEMIVLRNITYESHCEHHMAPIIGKVHVGYLP-NGKVVGISKLAR
GCH1_XYLF2      ------------------------YDEMIVLRNITYESHCEHHMAPIIGKVHVGYLP-NGKVVGISKLAR
GCH1_SULAC      TSALRSPQPYIKVFSLAENENSSVEDQIVLVKDISFSSLCEHHLLPIIGKVHVAYVVKSGKVAGLSKIIR
GCH1_CLOBM      -EEVFKGMCYSNDEIAEMFNITFNENDMVFMKEIEIFSHCEHHLLMYNMKVAIAYIPKGK-IIGLSKMAR
GCH1_CLOB8      -EEVFQGMTLSNREIAEAFGTTFEHNNMVVVKDIPIHSYCEHHLLMYNMKVTVVYIPKDK-IIGLSKISR
GCH1_XANCP      G-DWFSG--YREEPRAYLFEEVAGYDELIVLRDISYESHCEHHMAPIIGKVHVGYLPRGK-VVGISKLAR
GCH1_PHYBL      -------------------------------KDVDIFSLCEHHKVPSTGKISIGYIP-NRRVVGLSKLAR
GCH1_ONCMY      QEKIIDVLNDAIL--------DEDHDEMVIVKDIDMFSMCEHHLVPIFGRVHIGYLP-NKRVLGLSKLAR
GCH1_LEIXX      -------------------------------REISFRSVCEHHLLPFIGVAHVAYLP-GEAVIGLGRIPR
GCH1_XANC5      G-DWFSG--YREEPREYLFEEVAGYDELIVLRDISYESHCEHHMAPIIGKVHVGYLPRGK-VVGISKLAR
GCH1_XANAC      G-DWFSG--YRDEPREYLFEEVAGYDELIVLRDISYESHCEHHMAPIIGKVHVGYLPRGK-VVGISKLAR
GCH1_CALMQ      -EELTNGRE--ENVQYTLFEGSSNMVIVA---GIRFSTLCEHHLLPMLGVTHVAYIP-SDKVIGVSKIPR
GCH1_PSEHT      -------------------------------QDIELYSMCEHHLLPFTGRCHIAYIP-NGKVLGLSKFAR
GCH1_MUCHA      -------------------------------------SMCEHHLLPFIGKAHVAYIP-NGKVLGLSKVAR
GCH1_SULTO      L-EMTSGLRTPQPQIKTFNLSEDGISEVEDQKNIGFSSLCEHHLLPIIGKVHVAYIVQERKVAGFSKIIR
GCH11_PSEPK     -------------------------------RDIELYSMCEHHMLPFIGKAHVAYLPK-GKVLGLSKVAR
GCH1_HELHP      S-DMLNG--YAKSPKQALGSEDGVCDEMIVLKKLHFYSICEHHLLPFFGHISIGYIP-DKKLVGISGLAR
GCH1_NITMU      AHWTRG---YKQDPAAILKDGGESYDELIVVRQIPVYSHCEHHLAPFFGHATIGYLP-TGHIVGLSKLTR
GCH1_SULSO      -------------------------------KDVNFSSLCEHHMLPIIGKIHVAYIVSNSKVAGFSKIIR
GCH1_SULIY      -------------------------------KDVNFSSLCEHHMLPIIGKIHVAYIVSNSKVAGFSKIIR
GCH1_SULIN      -------------------------------KDVNFSSLCEHHMLPIIGKIHVAYIVSNSKVAGFSKIIR
GCH1_SULIM      -------------------------------KDVNFSSLCEHHMLPIIGKIHVAYIVSNSKVAGFSKIIR
GCH1_SULIL      -------------------------------KDVNFSSLCEHHMLPIIGKIHVAYIVSNSKVAGFSKIIR
GCH1_SULIK      -------------------------------KDVNFSSLCEHHMLPIIGKIHVAYIVSNSKVAGFSKIIR
GCH1_SULIA      -------------------------------KDVNFSSLCEHHMLPIIGKIHVAYIVSNSKVAGFSKIIR
GCH1_THENV      --------------------------GPVVIENISAVSLCEHHLLPILLSVSVAYIP-GDGVPGLSKVIR
GCH1_PYRAE      --------------------------GPVVIENIGAVSLCEHHLLPILLRISVAYVP-GDGVPGLSKVIR
GCH1_EUGGR      -------------------------------------SMCEHHMLPFWGKVHIAYIPKGK-VLGLSKLAR
GCH1_RALSO      QRRLLDGYDID--PAEALGHGEDPRRDMVIIRSIAVHGVCPHHLLPFRGVAHVAYLP-DGRLHGFGRIAR
GCH1_CHRVO      QKRLLDGYD--TVPAEALFADERRDMVVI--RSLAVHGMCPHHLLPFRGVAHVAYLP-GGRLHGFGRIAR


                         +         .         .         .         .         *         .:210
query           ICDFFSRRPQIQERMTAQIFEALKFILSTEDVSVKIKAKHACVSLRGVNNQNSQTYTQMVGGVFAK
GCH1_VIBHB      IVRFFAQRPQVQERMTQQILVALQTLLESDDVAVTIDATHYCVKSRGVMDATSETTTTALGGIF--
GCH1_HAEDU      VVQFFAQRPQVQERFTEQILTAFQTILETEDVAIYVKATHFCVKCRGIKDSNSYTVTSAFGGVF--
GCH1_VIBCH      IVRFFAQRPQVQERMTQQILVALQTLLESDDVAVTIDATHYCVKSRGVMDATSVTTTTALGGIF--
GCH1_ACTPJ      VVQFFAQRPQVQERFTEQILTAFQTILETDDVAVFVKATHFCVKCRGVKDTNSYTVTSAFGGVF--
GCH1_ACTP7      VVQFFAQRPQVQERFTEQILTAFQTILETDDVAVFVKATHFCVKCRGVKDTNSYTVTSAFGGVF--
GCH1_ACTP2      VVQFFAQRPQVQERFTEQILTAFQTILETDDVAVFVKATHFCVKCRGVKDTNSYTVTSAFGGVF--
GCH1_PASMU      IVAFFAQRPQVQERLTEQILLAFQTILETDDVAVYVKATHFCVKCRGIKDTNSYTVTSAFGGVF--
GCH1_MANSM      VVQFFAQRPQVQERLTEQILLAFQTILETEDVAVYMKATHFCVKCRGIKDTNSYTVTSAFGGVF--
GCH1_HAES2      VVAFFAQRPQVQERLTQQILLAFQTILETEDVAVYVKATHFCVKCRGIKDTNSYTVTSAFGGVF--
GCH1_HAES1      VVAFFAQRPQVQERLTQQILLAFQTILETEDVAVYVKATHFCVKCRGIKDTNSYTVTSAFGGVF--
GCH1_HAEIE      IVSFFAQRPQVQERLTEQLLTAFQTILETDDVAVYVKATHFCVKARGIRDTNSYTVTSAYGGVF--
GCH1_HAEI8      IVSFFAQRPQVQERLTEQLLTAFQTILETDDVAVYVKATHFCVKARGIRDTNSYTVTSAYGGVF--
GCH1_WIGBR      IVDFFSKRPQIQERLTNQILVAIQILLDTKNVAVAIKAKHLCVKARGIKDSHSKTLTLSLGGVF--
GCH1_HAEIN      IVSFFAQRPQVQERLTEQLLTAFQTILETDDVAVYVKATHFCVKARGIRDTNSYTVTSAYGGVF--
GCH1_BLOFL      IVEFFSKRPQLQERLTQQIFLALQTLLNTNNVAIFINAVHYCVKARGIHDMTSTTNTTALGGLF--
GCH1_HAEIG      IVSFFAQRPQVQERLTEQLLTAFQTILETDDVAVYVKATHFCVKARGIRDTNSYTVTYAYGGVF--
GCH1_VIBPA      IVRFFAQRPQVQERMTQQILVALQTLLESDDVAVTIDATHYCVKSRGVMDATSETTTTALGGIF--
GCH1_ERWT9      IVQFFSSRPQVQERLTQQILVALQTLLGTSNVAVSIDAVHYCVKARGIRD----------------
GCH1_TOLAT      IVNFFAKRPQVQERLTQQILVALQVLLGTDNVAITVTATHYCVKSRGVMDASSQTTTTALGGVF--
GCH1_PECCP      IVQFFSQRPQVQERLTQQILVALQTLLGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_VIBVY      IVRFFAQRPQVQERMTQQILVALQTLLESDDVAVTIDATHYCVKSRGVMDATSETTTTALGGIF--
GCH1_VIBVU      IVRFFAQRPQVQERMTQQILVALQTLLESDDVAVTIDATHYCVKSRGVMDATSETTTTALGGIF--
GCH1_ERWCT      IVQFFSQRPQVQERLTQQILVALQTLLGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_PHOPR      IVRFFAQRPQVQERMTQQILVALQTLLESDDVAVTIDATHYCVKARGVMDATSETTTTALGGIFKR
GCH1_SODGM      IVQFFAQRPQVQERLTQQIMLALQTLLGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_BLOPB      IVQFFSKRPQLQERLTKQIFLALQTLLNTDNVAIFIDAVHYCVKARGIHDVXXXXXXXALGGLF--
GCH1_FLAJ1      IVEYYAKRPQVQERLTMQIVQELQKALGTEDVACVIDAKHLCVNSRGIKDIESSTVTSEFGGKF--
GCH1_VIBFM      IVRFFAQRPQVQERMTQQILVALQTLLGSDDVAITMEATHYCVKSRGVMDXXXXXXXXXLGGIFKR
GCH1_VIBF1      IVRFFAQRPQVQERMTQQILVALQTLLGSDDVAITMEATHYCVKSRGVMDXXXXXXXXXLGGIFKR
GCH1_EDWI9      IVRFFAQRPQVQERLTQQILVALQTLLGTKNVAVSIDAVHYCVKARGVRD----------------
GCH1_SHISS      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_SHIFL      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_SHIF8      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_SHIDS      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_SHIBS      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_SHIB3      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_SERP5      IVQFFSQRPQVQERLTQQILVALQTLLGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_ESCF3      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_ECOUT      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_ECOSM      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_ECOSE      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_ECOLU      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_ECOLI      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_ECOLC      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_ECOL6      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_ECOL5      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_ECOK1      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_ECOHS      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_ECODH      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_ECOBW      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_ECO8A      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_ECO81      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_ECO7I      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_ECO5E      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_ECO57      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_ECO55      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_ECO45      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_ECO27      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_ECO24      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_ALISL      IVRFFAQRPQVQERMTQQILVALQTLLGSDDVAITMEATHYCVKSRGVMDXXXXXXXXXLGGIFKR
GCH1_HAMD5      VVQFFSQRPQVQERXXXXXXXXXXXXXXXENVAVSIDATHYCVKARGICDRSSVTRTTSLRGLF--
GCH1_SHELP      IVRFFAQRPQVQERXXXXXXXXXXXXXETKDVAVKMDAVHYCVKSRGVMDXXXXXXXXALGGIF--
GCH1_AERHH      IVQFFARRPQVQERXXXXXXXXXXXXXXXKDVAISIKATHFCVKARGVMDXXXXXXXXXLGGVF--
GCH1_SHEDO      IVRFFAQRPQVQERLTQQILVALQTLLETKDVAVKIDAVHFCVKSRGVMDXXXXXXXXXLGGIF--
GCH1_ENT38      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGVRD----------------
GCH1_YERPY      IVQFFAQRPQVQERXXXXXXXXXXXXXXXNNVAVSIDAVHYCVKARGIRD----------------
GCH1_YERPG      IVQFFAQRPQVQERXXXXXXXXXXXXXXXNNVAVSIDAVHYCVKARGIRD----------------
GCH1_YERPE      IVQFFAQRPQVQERXXXXXXXXXXXXXXXNNVAVSIDAVHYCVKARGIRD----------------
GCH1_YERPB      IVQFFAQRPQVQERXXXXXXXXXXXXXXXNNVAVSIDAVHYCVKARGIRD----------------
GCH1_YERP3      IVQFFAQRPQVQERXXXXXXXXXXXXXXXNNVAVSIDAVHYCVKARGIRD----------------
GCH1_CITK8      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_SALTY      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_SALTI      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_SALSV      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_SALPK      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_SALPC      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_SALPB      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_SALPA      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_SALNS      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_SALHS      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_SALEP      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_SALDC      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_SALCH      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_SALAR      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_SALA4      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_AERS4      IVQFFARRPQVQERXXXXXXXXXXXXXXXKDVAISIKATHFCVKARGVMDXXXXXXXXXLGGVF--
GCH1_BAUCH      IVRFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIYAVHYCVKARGICDXXXXXXXXXLGGIF--
GCH1_SALG2      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_YERE8      IVQFFAQRPQVQERXXXXXXXXXXXXXXXNNVAVSIDAVHYCVKARGIRD----------------
GCH1_KLEP7      IVQFFAQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_PHOLL      IVQFFSQRPQVQERXXXXXXXXXXXXXGTNNVAVSIDAVHYCVKARGIRD----------------
GCH1_KLEP3      IVQFFAQRPQVQERXXXXXXXXXXXXXGTSNVAVSIDAVHYCVKARGIRD----------------
GCH1_SHEAM      IVRFFAQRPQVQERLTXXXXXXXXXXXETKDVAVKIDAVHYCVKSRGVMDXXXXXXXXXLGGIF--
GCH1_SHEB9      IVRFFAQRPQVQERXXXXXXXXXXXXXETKDVAVKMDAVHYCVKSRGVMDXXXXXXXXALGGIF--
GCH1_SHEB8      IVRFFAQRPQVQERXXXXXXXXXXXXXETKDVAVKMDAVHYCVKSRGVMDXXXXXXXXALGGIF--
GCH1_SHEB5      IVRFFAQRPQVQERXXXXXXXXXXXXXETKDVAVKMDAVHYCVKSRGVMDXXXXXXXXALGGIF--
GCH1_SHEB2      IVRFFAQRPQVQERXXXXXXXXXXXXXETKDVAVKMDAVHYCVKSRGVMDXXXXXXXXALGGIF--
GCH1_SHESR      IVRFFSQRPQVQERXXXXXXXXXXXXXETKDVAVKMDAVHYCVKSRGVMDXXXXXXXXALGGIF--
GCH1_SHESM      IVRFFSQRPQVQERXXXXXXXXXXXXXETKDVAVKMDAVHYCVKSRGVMDXXXXXXXXALGGIF--
GCH1_SHESA      IVRFFSQRPQVQERXXXXXXXXXXXXXETKDVAVKMDAVHYCVKSRGVMDXXXXXXXXALGGIF--
GCH1_SHEON      IVRFFAQRPQVQERXXXXXXXXXXXXXETKDVAVKMDAVHYCVKSRGVMDXXXXXXXXALGGIF--
GCH1_SHESW      IVRFFAQRPQVQERXXXXXXXXXXXXXETKDVAVKMDAVHYCVKSRGVMDXXXXXXXXALGGIF--
GCH1_SHEPC      IVRFFAQRPQVQERXXXXXXXXXXXXXETKDVAVKMDAVHYCVKSRGVMDXXXXXXXXALGGIF--
GCH1_THETN      IVDVLSKRPQLQERLTSEIADTIMEAVNPLGVAVVIEAEHLCMTMRGVKKPGSKTVTSALRGIF--
GCH1_DESRM      LVNGYARRPQLQERLTKQIADAIMKRLNPYGVVVVVEAEHLCMSMRGVRSPGARTVTSAVRGIFKK
GCH1_BUCAP      IAQFFAKRPQIQERXXXXXXXXXXXXXXXXNVAIIIHMDHFCVKARGVCDXXXXXXXXCLDGLF--
GCH1_CARHZ      VVEGFAKRPQLQERLTSQIADAIMEKLNPRGVLVVIEAEHMCMTMRGVKKPGSKTITSAVRGIFA-
GCH1_THEPX      IVDILAKRPQLQERLTSEIADTIMEAVNPLGVAVVIEAEHLCMTMRGIKKPGAKTVTSALRGIF--
GCH1_THEP3      IVDILAKRPQLQERLTSEIADTIMEAVNPLGVAVVIEAEHLCMTMRGIKKPGAKTVTSALRGIF--
GCH1_STRA1      AVEVASKRPQLQERLTAQVAQALEDALAPKGIFVMIEAEHMCMTMRGIKKPGSKTITTVARGLY--
GCH1_PELTS      VVEGFAKRPQLQERLTSQIADTIMRRLNPIGVLVVIEAEHMCMTFRGVKKPGSKTVTSAVRGLFRK
GCH1_STRA3      AFEVASKRPQLQERLTAQVAQALEDALAPKGIFVMIEAEHMCMTMRGIKKPGSKTITTVARGLY--
GCH1_THEFY      LVDIYARRPQVQERLTSQVADALMERLEPRGVIVVVEAEHLCMTMRGVRKPGAKTVTSAVRGAF--
GCH1_FUSNN      LIEILSRRPQLQERLTEEIAKYIYEILNCQGVYVVVEAKHLCVTMRGQKKENTKILTTSAKGVF--
GCH1_STRA5      AVEVASKRPQLQERLTAQVAQALEDALAPKGIFVMIEAEHMCMTMRGIKKPGSKTITTVARGLY--
GCH1_STRMU      AVEVVSKRPQLQERLTVQIANALEEALKPKGVLVMIEAEHMCMTMRGIKKPGSKTVTRVVRGI---
GCH1_THEYD      ALDYLSKRPQVQERLTSQLANLLMEKLKPKGCMVVIEAEHLCMSMRGIKKPDAKTITSAVRGIFRK
GCH1_STRGC      AVEVASKRPQLQERLTAQIATALDEALSPEGVFVMVEAEHMCMTMRGIKKPGSKTITTVAKGIY--
GCH1_CLOD6      VIDTLAKRPQLQERITKNAADIIMEELQPYGVLVVVEAEHMCMTMRGVKKPGSKTVTSAVRGIFEK
GCH1_RICTY      IVNIFSRRLQIQEKMTVQIAESIQESLKPLGVAIKISAFHSCMSMRGVMHDNSVMNTMYYTGIFAE
GCH1_LACPL      LIDYCSQQPNVQERLTVSIATELQRILDPAGIAVSITARHMCMEMRGVSKPGVHTESSYYSGQF--
GCH1_RICFE      IVNAFSKRLQIQEKMTVQIAESVQENLKPLGVAVKISALHSCMSMRGVMQDNSVMNTMHYTGIFAE
GCH1_PERMH      VVNKFAYRPQVQERLTAQIAEFLEKELSPKGVAVVLEAEHLCMSMRGVKNPTSYTITSKLTGAF--
GCH1_LISMO      VVDDVSRRPQLQERITTTVAEIMMEKLKPLGVMVIMEAEHMCMTIRGVNKPGTKTITSAVRGAF--
GCH1_LISMH      VVDDVSRRPQLQERITTTVAEIMMDKLKPLGVMVIMEAEHMCMTIRGVNKPGTKTITSAVRGAF--
GCH1_BACA2      AVEAVSKRPQLQERITSTIAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVTSAVRGIF--
GCH1_CLOK5      TVEVFAKRLQLQERMTVQIADSIMDYLKVKGVMVVIEAEHMCMTMRGIKKPGSKTVTVATRGIF--
GCH1_CLOK1      TVEVFAKRLQLQERMTVQIADSIMDYLKVKGVMVVIEAEHMCMTMRGIKKPGSKTVTVATRGIF--
GCH1_BREBN      AVDTVAKRPQLQERITATVADSIMRKLDPHGVVVVVEAEHMCMTMRGVKKPGSKTITSAVRGMFEK
GCH1_BACSU      AVEAVAKRPQLQERITSTIAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVTSAVRGVF--
GCH1_STRGG      LVDVYARRPQVQERLTTQIAESLMSILEPRGVIVVVECEHMCMSMRGIRKPGAKTLTSAVRG----
GCH1_LEPBP      IVDVFARRLQVQERLTDQIAQAIQETLDPLGVGVVIKAKHLCMMMRGVEKQNSELFTSSLLGLF--
GCH1_LEPBA      IVDVFARRLQVQERLTDQIAQAIQETLDPLGVGVVIKAKHLCMMMRGVEKQNSELFTSSLLGLF--
GCH1_LISMF      VVDDVSRRPQLQERITTTVAEIMMEKLKPLGVMVIMEAEHMCMTIRGVNKPGTKTITSAVRGAF--
GCH1_LISMC      VVDDVSRRPQLQERITTTVAEIMMEKLKPLGVMVIMEAEHMCMTIRGVNKPGTKTITSAVRGAF--
GCH1_LISIN      VVDDVSRRPQLQERITTTVAEIMMDKLKPLGVMVIMEAEHMCMTIRGVNKPGTKTITSAVRGAF--
GCH1_BACHD      AVEAVARRPQLQERITSTVADALVETLEPHGVIVVVEAEHMCMTMRGVKKPGAATVTSAVRGTFA-
GCH1_CORA7      LADMYAKRPQVQERLTSQIADALVEVLHAQSVIVVIECEHLCMAMRGIRKPGATTTTSAVRGGFKK
GCH1_LISW6      VVDDVSKRPQLQERITTTVAEIMMDKLKPLGVMVIMEAEHMCMTIRGVNKPGTKTITSAVRGAF--
GCH1_CLOTH      IVDIIARKPQLQERLGSEVANVIMESINPLGVAVVVEAEHLCMTMRGIKKAGSKTVTSALRGI---
GCH1_CORGL      LADMFAKRPQVQERLTSQIADALVEKLDAQAVAVVIEAEHLCMAMRGIRKPGAVTTTSAVRGGF--
GCH1_STRT2      AVEVAARRPQLQERLTDQVATALEEALNPRGVFVMVEAEHMCMTMRGIKKPGSKTITTVAKGIY--
GCH1_STRT1      AVEVAARRPQLQERLTDQVATALEEALNPRGVFVMVEAEHMCMTMRGIKKPGSKTITTVAKGIY--
GCH1_LEPBL      IVDVFARRLQVQERLTEQIAYAVQEVLDPQGVAVVIKAKHLCMMMRGVEKQNSELFTSCLLGAF--
GCH1_LEPBJ      IVDVFARRLQVQERLTEQIAYAVQEVLDPQGVAVVIKAKHLCMMMRGVEKQNSELFTSCLLGAF--
GCH1_STRCO      LVDVYARRPQVQERLTTQIADSLMEILEPRGVIVVVECEHMCMSMRGIRKPGAKTLTSAVRG----
GCH1_RICPR      IVNIFARRLQIQEKMTLEIAESVQENLKPLGVAVKISALHSCMSMRGVMHDNSVMNTMYYTGIFAE
GCH1_LYSSC      AVETIARRPQLQERITSSVADTIMEMLAPKGVYVVIEAEHMCMTMRGLKKPGSKTVTSVARGVY--
GCH1_STRSY      AVEVASRRPQLQERLTHQVAHALQDALEPEGVFVMVEAEHMCMSMRGIRKPGSKTVTTVALGKY--
GCH1_STRS2      AVEVASRRPQLQERLTHQVAHALQDALEPEGVFVMVEAEHMCMSMRGIRKPGSKTVTTVALGKY--
GCH1_STRAW      LVDVYARRPQVQERLTTQVADSLMEILEPRGVIVVVECEHMCMSMRGVRKPGAKTITSAVRG----
GCH1_RICRS      IVNIFARRLQIQEKMTVQIAESVQENLKPLGVAVKISAVHSCMSMRGVMQDNSVMNTMHYTGIFAE
GCH1_RICRO      IVNIFARRLQIQEKMTVQIAESVQENLKPLGVAVKISAVHSCMSMRGVMQDNSVMNTMHYTGIFAE
GCH1_RICPU      IVNIFARRLQIQEKMTVQIAESVQENLKPLGVAVKISAVHSCMSMRGVMQDNSVMNTMHYTGIFAE
GCH1_RICM5      IVNIFARRLQIQEKMTVQIAESVQENLKPLGVAVKISAVHSCMSMRGVMQDNSVMNTMHYTGIFAE
GCH1_LEPIN      IVDVFARRLQVQERLTEQIAYAIQEVLDPQGVAVVIKAKHLCMMMRGVEKQNSELFTSCMLGAF--
GCH1_LEPIC      IVDVFARRLQVQERLTEQIAYAIQEVLDPQGVAVVIKAKHLCMMMRGVEKQNSELFTSCMLGAF--
GCH1_BACFR      VVDIFSHRLQVQERMTLQIKECIQETLNPLGVMVVVEAKHMCMQMRGVEKQNSVTTTSDFTGAF--
GCH1_BACFN      VVDIFSHRLQVQERMTLQIKECIQETLNPLGVMVVVEAKHMCMQMRGVEKQNSVTTTSDFTGAF--
GCH1_RICAE      IVNIFARRLQIQEKMTVQIAESVQENLKPLGVAVKISAVHSCMSMRGVMQDNSVMNTMHYTGIFAE
GCH1_BACP2      AVEAVAKRPQLQERITSTIADSMVETLNPHGVMIVVEAEHMCMTMRGVKKPGAKTVTSAVRGTFA-
GCH1_GEOKA      AVEAVARRPQLQERITATIADSIVEALEPHGVMVVVEAEHMCMTMRGVKKPGSKTVTTAVRGVF--
GCH1_CHLCH      VVEVFSRRLQVQERLTQQIRDAIQNVLNPKGVAVVIEAKHLCMVMRGVEKLNSITTTSAMSGVF--
FOLKE_LACLA     LVDYVSRKLSVQENITHDIGDILTDILNPKGVAVLVEGRHMCVEMRGVKKVNSITKTSYFLGEF--
GCH1_RICAH      IVNIFAKRLQIQEKMTVQIAESVQENLKPLGVAVKIAALHSCMSMRGVMQDHSIMNTMHYTGIFAE
GCH1_MYCA1      LVDLYAKRPQVQERLTSQIADALVKKLNPRGVIVVVEAEHLCMAMRGVRKPGAVTTTSAVRGLF--
GCH1_DEHSC      VVEIYAKRPQIQERMATQIADAIMDGLKCDGVAVVIEAEHMCMVMRGIKKPGSRVITSALRGSFHK
GCH1_DEHSB      VVEIYAKRPQIQERMATQIADAIMDGLKCDGVAVVIEAEHMCMVMRGIKKPGSRVITSALRGSFHK
GCH1_CORGB      LADMLAKRPQVQERLTSQIADALVEKLDAQAVAVVIEAEHLCMAMRGIRKPGAVTTTSAVRGGF--
GCH1_CLOP1      CVEVYSKKPQLQERLTTEIADSIMEYLDAQGVMVVVEGEHMCMTMRGVRKPGAKTVTTTYRGKF--
GCH1_CHICK      IVEIYSRRLQVQERLTKQIAIAITEALQPAGVGVVIEATHMCMVMRGVQKMNSKTATSTMLGVF--
GCH12_ANASP     VCEMYARRLQVQERLTLQIADALQGLLKPQGVAVVIEATHMCMVMRGVQKPGSWTVTSAMRGVFAE
GCH1_STRZT      TVEVYSKKPQIQERLNIEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLF--
GCH1_RICCN      IVNIFARRLQIQEKMTVQIAESVQENLKPLGVAVKISAVHSCMSMRGVMQDNSVMNTMHYTGIFAE
GCH1_RICBR      IVNAFAKRLQIQEKMTVQIAESVQENLKPLGVAVKISALHSCMSMRGVMQDNSIMNTMHYTGIFAE
GCH1_RICB8      IVNAFAKRLQIQEKMTVQIAESVQENLKPLGVAVKISALHSCMSMRGVMQDNSIMNTMHYTGIFAE
GCH1_MYCPA      LVDLYAKRPQVQERLTSQIADALVKKLNPRGVIVVVEAEHLCMAMRGVRKPGAVTTTSAVRGLF--
FOLKE_LACLM     LVNYVSRKLSVQENITHDIADILTDILKPKGVAVLVEGRHMCVEMRGVKKVNSLTKTSYFLGEF--
GCH1_CLOPE      CVEVYSKKPQLQERLTKEIADSIMEYLDAQGVMVVVEGEHMCMTMRGVRKPGAKTVTTTYRGKF--
GCH1_STRZP      TVEVYSKKPQIQERLNIEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLF--
GCH1_STRZJ      TVEVYSKKPQIQERLNIEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLF--
GCH1_STRPS      TVEVYSKKPQIQERLNIEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLF--
GCH1_STRPN      TVEVYSKKPQIQERLNIEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLF--
GCH1_STRPJ      TVEVYSKKPQIQERLNIEVADALMEYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLF--
GCH1_STRPI      TVEVYSKKPQIQERLNIEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLF--
GCH1_STRP7      TVEVYSKKPQIQERLNIEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLF--
GCH1_STRP4      TVEVYSKKPQIQERLNIEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLF--
GCH1_PROVI      VVEVFARRLQVQERLTQQIRDAIQDVLHPKGVGVVIEAKHMCMVMRGVEKLNSVTTTSAMSGEF--
GCH1_PORGI      VVDVFARRLQVQERLTTQIKECIQNTLNPLGVIVVIEAQHMCMQMRGVEKQNSLTTTSDFTGAF--
GCH1_PORG3      VVDVFARRLQVQERLTTQIKECIQNTLNPLGVIVVIEAQHMCMQMRGVEKQNSLTTTSDFTGAF--
GCH1_PELUB      VVEVFSKRLQTQERLTMQVAQALMTSLDAKGVAVTIDAAHQCMTMRGIKKENATTVTNYFLGEFKK
GCH1_MYCA9      LVDLYAKRPQVQERLTAQIADALVRKLEPRGVIVVVEAEHLCMAMRGVRKPGATTTTSAVRGQFKR
GCH1_CLOPS      CVEVYSKKPQLQERLTTEIADSIMEYLDAQGVMVVVEGEHMCMTMRGVRKPGAKTVTTTYRGKF--
GCH1_BRUSU      VVDIFARRLQTQESITAQIADSMQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDF--
GCH1_BRUSI      VVDIFARRLQTQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDF--
GCH1_BRUO2      VVDIFARRLQTQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDF--
GCH1_BRUME      VVDIFARRLQTQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDF--
GCH1_BRUMB      VVDIFARRLQTQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDF--
GCH1_BRUC2      VVDIFARRLQTQESITAQIADSMQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDF--
GCH1_BRUAB      VVDIFARRLQTQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDF--
GCH1_BRUA2      VVDIFARRLQTQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDF--
GCH1_BRUA1      VVDIFARRLQTQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDF--
GCH1_BIFLO      LVEVYARRPQVQERLTQQIADALVEYAGARGVIVVTECEHLCMSMRGIKKSSARTVTSAVRGM---
GCH1_STRR6      TVEVYSKKPQIQERLNIEVADALMDYLGAKGAFVIIEAEHMCMSMRGVRKPGTATLTTVARGLF--
GCH1_STRP2      TVEVYSKKPQIQERLNIEVADALMDYLGAKGAFVIIEAEHMCMSMRGVRKPGTATLTTVARGLF--
GCH1_PARD8      VVDIFARRLQIQERMTMQIKDCIQRTLDPLGVMVVIEAQHMCMQMRGVEKQNSLTTTSDFTGFF--
GCH1_LACSS      LVDFVSKRLSVQENLTRDIGQILNQILKPYGVAVQVTARHMCVEMRGIKKANSQTHTTFYSGNF--
GCH1_COREF      LADMYAKRPQVQERLTSQIADALVDKLGAQSVAVVIEAEHLCMGMRGIRKPGAVTTTSAVRGGF--
GCH1_MYCTU      LVDLYAKRPQVQERLTSQIADALMKKLDPRGVIVVIEAEHLCMAMRGVRKPGSVTTTSAVRGLF--
GCH1_MYCTA      LVDLYAKRPQVQERLTSQIADALMKKLDPRGVIVVIEAEHLCMAMRGVRKPGSVTTTSAVRGLF--
GCH1_MYCBT      LVDLYAKRPQVQERLTSQIADALMKKLDPRGVIVVIEAEHLCMAMRGVRKPGSVTTTSAVRGLF--
GCH1_MYCBP      LVDLYAKRPQVQERLTSQIADALMKKLDPRGVIVVIEAEHLCMAMRGVRKPGSVTTTSAVRGLF--
GCH1_MYCBO      LVDLYAKRPQVQERLTSQIADALMKKLDPRGVIVVIEAEHLCMAMRGVRKPGSVTTTSAVRGLF--
GCH11_PSEAE     IVDMFARRLQIQENLTRQIAEAVRQVTSAAGVAVVIEAQHMCMMMRGVEKQNSQMFTSVMLGAF--
GCH1_RHILO      VVDIFAHRLQTQEALTAQIAGVIQDVLNPRGVAVMIEAEHMCMAMRGIRKQGSTTLTSTFTGVF--
GCH1_BACCN      TVDTIARRPQLQERITSTVADSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGV---
GCH1_GEOSW      AVETVARRPQLQERITATVADSIMETLDPYGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVF--
GCH1_DICDI      VAEIFARRLQVQERLTRQIAQAIQAHLNPMGVAVVIEASHMCMVMRGVQKPGASTVTSSVCGIFEK
GCH1_CLOAB      IADMVSRRLQLQERIGKDIAEIMEKVTASKDIAVIIKGEHGCMTSRGIKKPGALTTTMTLKGRF--
GCH1_CHLTE      VVEVFARRLQVQERLTQQIRDAIQNVLNPRGVAVVIEATHMCMVMRGVEKQNAVTTTSAMSGDF--
GCH1_MYCVP      VVDLYAKRPQVQERLTGQIADALMRRLDPRGVIVVIEAEHLCMAMRGIRKPGAVTTTSAVRGQF--
GCH1_ENTFA      LVEHCAKRPTVQEDLTVTIARKLQENIPVKGIAVAIEAEHMCMTMRGVKTPQSSTKTFQFTGLF--
GCH1_CLONN      TTEVFSKRPQLQERLTSQIADSLMEYLKCKGAMVIIEAEHLCMSMRGVKKWGSKTTTIVTRGEFQK
GCH1_FINM2      TVDVYSKKPQLQERLNIEIADALMEYLNCKGCLVTIEAEHMCMNMRGVKKPGTSTMTSVARGAF--
GCH1_BACWK      TVDTIARRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGV---
GCH1_BACHK      TVDTIARRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGV---
GCH1_BACCZ      TVDTIARRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGV---
GCH1_BACCR      TVDTIARRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGV---
GCH1_BACCQ      TVDTIARRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGV---
GCH1_BACC7      TVDTIARRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGV---
GCH1_BACC4      TVDTIARRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGV---
GCH1_BACC3      TVDTIARRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGV---
GCH1_BACC2      TVDTIARRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGV---
GCH1_BACC1      TVDTIARRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGV---
GCH1_BACC0      TVDTIARRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGV---
GCH1_BACAN      TVDTIARRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGV---
GCH1_BACAH      TVDTIARRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGV---
GCH1_BACAC      TVDTIARRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGV---
GCH1_BACAA      TVDTIARRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGV---
GCH1_STRP8      AVEVASKRPQLQERLTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLY--
GCH1_STRP6      AVEVASKRPQLQERLTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLY--
GCH1_STRP1      AVEVASKRPQLQERLTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLY--
GCH1_RHOBA      VVEEVARRPQVQERLTHTVANLIEDRLSARGVAVVVESTHSCMTMRGIRKPGSLCLTSAMRGAF--
GCH1_METS4      VVDAFARRLQTQETMTAQIADTIDAVLNPRGVAVMVEAEHLCMAMRGVQKAGVSTLTTQFTGVF--
GCH1_BIFLD      LVEVYARRPQVQERLTQQIADALVEYAGARGVIVVTECEHLCMSMRGIKKSSARTVTSAVRGL---
GCH1_STRPZ      AVEVASKRPQLQERLTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLY--
GCH1_STRPY      AVEVASKRPQLQERLTAQIADALVEALHPTGVLVLVEAEHMCMTMRGIKKPGSKTITTTARGLY--
GCH1_STRPG      AVEVASKRPQLQERLTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLY--
GCH1_SINMW      VVDIYARRLQTQEAMTAQIARAIDETLVPRGVAVMIEAEHLCMAMRGIKKQGAXXXXXXXXGEF--
GCH1_DEIRA      IVDLYSRRLQVQERITTQVADAVEELLAPKGVAVLMEGIHLCMAMRGVQKQNSSTTTSAMRGLF--
GCH1_BACTN      VVDIFSHRLQVQERMTLQIKDCIQETLNPLGVMVVVEAKHMCMQMRGVEKQNSITTTSDFTGAF--
GCH1_ALHEH      IVDMYARRLQIQENLTRQIALAVQQVTGGKGVAVYINARHLCMMMRGVEKQNSEMSTSVMLGDF--
GCH1_STRP3      AVEVASKRPQLQERLTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLY--
GCH1_MYCUA      LVDLYAKRPQVQERLTSQIADALVKRLGPRGVLVVVEAEHLCMAMRGVRKPGAVTTTSAVRGQF--
GCH1_MYCMM      LVDLYAKRPQVQERLTSQIADALVKRLGPRGVIVVVEAEHLCMAMRGVRKPGAVTTTSAVRGQF--
GCH1_CLOCE      IADMVGKRLQLQERIGSDIAEIMQKITDSEDVAVIVEGQHACMTTRGIKNTGSRXXXXXLRGAF--
GCH1_SULSY      VVNKFSYRPQVQERLTAEIAEYLEKELQPKGVAVVMEAVHLCMAMRGVRNPESITVTSKLTGRF--
GCH1_BEII9      LVDIFAKRLQTQEALTAQIIGAIDEHLQPRGCAIMLEAEHMCMSMRGVQKHGTSTLTTQFTGVF--
GCH11_ANASP     IVEMYSRRLQVQERLTRQIAEAVQTILEPQGVAVVMEASHMCMVMRGVQKPGSWTVTSAMLGVF--
GCH1_RAT        IVEIYSRRLQVQERLTKQIAVAITEALQPAGVGVVIEATHMCMVMRGVQKMNSKTVTSTMLGVF--
GCH1_MYCLE      LVDLYAKRPQVQERLTSQIADALVSKLDPRGVIIVVEAEHLCMAMRGVRKPGAITTTSAVRGQF--
GCH1_MYCLB      LVDLYAKRPQVQERLTSQIADALVSKLDPRGVIIVVEAEHLCMAMRGVRKPGAITTTSAVRGQF--
GCH1_BARHE      VVNVFSRRLQTQEAMTAQIANALETHLKPRGVAVLIEAEHMCMTMRGVQKQGAKTITTSFHGSYEK
GCH1_RHIME      VVDIYARRLQTQEAMTAQIAKAIDETLMPRGVAVMIEAEHLCMAMRGIKKQ---------------
GCH1_HYPBU      IVNKYSRRLQIQERMTKQIADEISKATGSPDVMVITEAVHLCMAMRGVRN-GAPTVVAAVRGEFER
GCH1_GLOVI      IVEMYARRLQVQERLTRQIAEALQEVLQPRGVAVVIEASHMCMVMRGVQKPNSWTVTSSMVGVF--
GCH1_DEHE1      VVEIYAKRPQIQERMATQIADAIIDGLKCDGVAVVIEAEHMCMVMRGIKKPGSRVITSALRGSFHK
GCH1_CAMJJ      LVEVFARRLQIQEQLTEQIAQALMENVDAKGVGVVIEARHMCVEMRGVQKANSTTTTSALRGIFLK
GCH1_CAMJE      LVEVFARRLQIQEQLTEQIAQALMENVDAKGVGVVIEARHMCVEMRGVQKANSTTTTSALRGIFLK
GCH1_CAMJ8      LVEVFARRLQIQEQLTEQIAQALMENVDAKGVGVVIEARHMCVEMRGVQKANSTTTTSALRGIFLK
GCH1_SYNP6      IVEMYSRRLQVQERLTRQIAESVQEILDPQGVAVVMEATHMCMVMRGVQKPGSWTVTSAMVGVF--
GCH1_SYNE7      IVEMYSRRLQVQERLTRQIAESVQEILDPQGVAVVMEATHMCMVMRGVQKPGSWTVTSAMVGVF--
GCH1_RHISN      VVDIYARRLQTQEAMTAQIARAIDETLAPRGVAVMIEAEHLCMAMRGIKKHGSXXXXXXXXGAF--
GCH1_CAMJR      LVEVFARRLQIQEQLTEQIAQALMENVDAKGVGVVIEARHMCVEMRGIQKANSTTTTSALRGIFLK
GCH1_AZOVD      IVDMFARRLQIQENLTRQIAEAVEQVTGASGVGVVIEAQHMCMMMRGVEKQNSTLVTSVMLGHF--
GCH1_MYCGI      VVDLYAKRPQVQERLTSQIADALMRKLDPRGAIVVIEAEHLCMAMRGIRKPGAVTTTSAVRGQF--
GCH1_CAMC5      MVNIYARRLQIQEQMTEQIAQALAEVIEPKGVGVVVEARHMCVEMRGVQKINSTTTTSALRGCFIK
GCH1_CAMC1      MVNIYARRLQIQEQMTEQIAKALEDVIAPKGVGVVVEARHMCVEMRGVEKINSTTTTSALRGCFIK
GCH1_OCHA4      VVDIFARRLQTQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRGIRKQGS-------------
GCH1_NOSP7      IVEMYSRRLQVQERLTRQIAEAIQTILEPRGVAVVMEASHMCMVMRGVQKPGSWTVTSAMVGVF--
GCH1_CAMJD      LVEVFARRLQIQEQLTEQIAQALMENADAKGVGVIIEARHMCVEMRGVQKANSTTTTSALRGIFLK
GCH1_AQUAE      TVRAFALRPQVQERLTEEIADFLEKELEPKGVGVVIEAEHLCMSMRGVMSPGHLTVTSALRGVFLK
GCH1_SYNJA      IVEMYSRRLQVQERLTRQIAEALMTMLDPYGVGVVIEATHMCMVMRGVQKPGSWTVTSSMVGVF--
GCH1_SCHPO      IANMFSRRLQVQERLTKQVAQAIQAVLKPQGVAVVMEATHMCMVMRGVEKPGSSTVTSSLTGIFQR
GCH1_BARBK      VVDVFAHRLQTQETMTAQVANSLKKYLKPRGLAVLIEAEHMCMAMRGVQKQGAATITTSFHGYYKK
GCH1_SYNJB      IVEMYSRRLQVQERLTRQIAEALMEVLDPYGVGVVIEATHMCMVMRGVQKAGSWTVTSSMVGVF--
GCH1_BARQU      IVDVFSRRLQTQETMTAQIADALEEYLKPCGIAVLIEAEHMCMTMRGVQKQGATTITTSFHGSYEK
GCH1_RHOP2      LVEIFARRLQTQEHLTAQIAAAIDEVLKPRGVAVMIEAEHTCMSVRGIGKQGASTFTSRYTGMF--
GCH1_CAMLR      LVEVFARRLQIQEQLTEQIAEALMEHVGAKGVGVVIEARHMCVEMRGVQKANSTTSTSALRGSFLK
GCH1_MARMM      VVEIFSKRMQTQETMTAQIADALTEAMEPRGVAVLVDAKHQCMTTRGVHHPNVSTITTTFTGEF--
GCH1_SYNY3      IVEMFSRRLQVQERLTRQIAEAVQEILDPQGVAVVMEATHMCMVMRGVQKPGSWTVTSAMIGSF--
GCH1_MESSB      VVDIFARRLQTQEAITAQIAGAIQNVLQPLGVAVMVEAEHMCMAMRGVRKQ---------------
GCH1_CAEEL      IVEMFSRRLQVQERLTKQIATAMVQAVQPSGVAVVIEASHMCMVMRGVQKINASTTTSCMLGVF--
GCH12_PSEAE     IVDMYARRLQIQENMSRQIAEAVQQVTGALGVAVVIQAQHMCMMMRGVEKQNSSMVTSVMLGEF--
GCH1_RHOPT      LVDIFARRLQTQEHLTAQIAAAIDEVLKPRGVAVLLEAEHTCMSVRGIAKKGATTFTSRYTGVF--
GCH1_RHOPA      LVDIFARRLQTQEHLTAQIAAAIDEVLKPRGVAVLLEAEHTCMSVRGIAKKGATTFTSRYTGVF--
GCH1_RHOPS      LVEIFARRLQTQEHLTAQIAAAIDEVLKPRGVAVMIEAEHTCMSVRGIGKQGASTFTSRYTGMF--
GCH1_METCA      IVEMYARRLQIQERLTKQIADAIQTAVNPRGVAVVVEAKHLCMMMRGVEKQNSVMTTSSMLGLFRK
GCH1_HELPY      LIEIYSRRLQIQERLTIQIAETFDEIIEPRGVIVVCEAKHLCMSMQGVQKQNAIIKTSVLRGLFKK
GCH1_THEEB      VVEMYARRLQVQERLTRQVAEAIETVLDPKGVAVVMEATHMCMVMRGVQKPGSWTVTSSMLGVF--
GCH1_COXBU      IVDMFAKRLQVQENLTKQIAEAILTATEAKGVGVIIEAKHLCMMMRGVEKQNSEMTTSVMLGTFRK
GCH1_COXBR      IVDMFAKRLQVQENLTKQIAEAILTATEAKGVGVIIEAKHLCMMMRGVEKQNSEMTTSVMLGTFRK
GCH1_COXBN      IVDMFAKRLQVQENLTKQIAEAILTATEAKGVGVIIEAKHLCMMMRGVEKQNSEMTTSVMLGTFRK
GCH1_HELPJ      LIEIYSKRLQIQERLTTQIAETFDEIIEPRGVIVVCEAKHLCMSMQGVQKQNAIIKTSVLRGLFKK
GCH12_PSEPK     VVDMFARRLQIQENLTRQIAYAVQEVTDAAGVGVVIEAKHMCMMMRGVEKQNSVMISSVMLGAF--
GCH1_MOUSE      IVEIYSRRLQVQERLTKQIAVAITEALQPAGVGVVIEATHMCMVMRGVQKMNSKTVTSTMLGVF--
GCH1_HELPS      LIEIYSRRLQIQERLTTQIAETFDEIIEP