[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD30942.1

[Show Plain Result]


## Summary of Sequence Search
    1::405
   70::449     1e-58  37%  464 aa  CAPB_BACAN RecName: Full=Capsule biosynthesis protein capB;
   22::381     2e-53  36%  393 aa  CAPB_BACSU RecName: Full=PGA synthase capB;       
   95::226     8e-05  33%  483 aa  MURE_CHLTR RecName:
   95::226     8e-05  33%  483 aa  MURE_CHLTA RecName:
   27::210     8e-05  25%  427 aa  FOLD_YEAST RecName: Full=Folylpolyglutamate synthase;       
   45::189     1e-04  27%  422 aa  FOLC_ECOLI RecName: Full=Bifunctional protein folC;Includes:
    1::405

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxWLIVVVFVILCVYLIIENIVHNNSIKSIPIRIHVNGTRGKSSVARLIAAGVRAGGYRTVAKTTG
CAPB_BACAN      ------FIIGICTVFLIIYGIWEQRCHQKRLNSIPIRVNINGIRGKSTVTRLITGVVQEAKYKTVGKTTG
CAPB_BACSU      --------------------------HQKNIDALPVRVNINGIRGKSTVTRLTTGILIEAGYKTVGKTTG
MURE_CHLTR      --------------------------YNNPSRHLDV-IGITGTNGKTTVSCLVRELMERSGRRT--GLIG
MURE_CHLTA      --------------------------YNNPSRHLDV-IGITGTNGKTTVSCLVRELMERSGRRT--GLIG
FOLD_YEAST      -------------------------------------LHIAGTNGKGSVCTYLSSVLQQKSYQIGKFTTP
FOLC_ECOLI      ------------------------------LKPAPFVFTVAGTNGKGTTCRTLESILMAAGYKVGVYSSP


                         .         .         *         .         .         .         .:140
query           TLARYIDVDGSETPVFRIGFSNIAEQVKIMFKARRAKADAIVIECMALQPLLQSLCELKLIKATHGVLTN
CAPB_BACAN      TSARMIYFTDEEQPIKRRKEGNIGEQRRVVKEAADLEAEALICECMAVQPDYQIIFQNKMIQANVGVIVN
CAPB_BACSU      TDARMIYWDTEEKPIKRKPQGNIGEQKEVMRETVERGANAIVSECMAVNPDYQIIFQEELLQANIGVIVN
MURE_CHLTR      TIEHILGIDSFTTPDAILLQKYFAEMVK-------QNLSAAVMEVSSIGMALGRVRETEFLA---GVLTN
MURE_CHLTA      TIEHILGIDSFTTPDAILLQKYFAEMVK-------QNLSAAVMEVSSIGMALGRVRETEFLA---GVLTN
FOLD_YEAST      HLVHVTDITINNKPIPLERYQNIRLQLEALNKSHSLKCTEFLLTCTAFKYFYDVQCQWCVIEATNVIITK
FOLC_ECOLI      HLVRYVRVQGQELPAHTASFAEIESTLSALWLFKQAQLDVVILEV----GLGGRLDATNIVDADVAVVTS


                         +         .         .         .         .         *         .:210
query           ARPDHLDVMGPTERDVAKALAATVPIGAKYFTAEDIHLDFFEYACKDRGSELIAATAQDAEKISDEEINK
CAPB_BACAN      VLEDHMDVMGPTLDEVAEAFTATIPYNGHLVTIESEYLDYFKEVAEERNTKVIVA---DNSRISEEFLRK
CAPB_BACSU      VLEDHMDVMGPTLDEIAEAFTATIPYNGHLVITDSEYTEFFKQKAKERNTKVIIA---DNSKITDEYLRK
MURE_CHLTR      ITSDHLDFHGSLEEYIAKQFFASLP---------------------------------------------
MURE_CHLTA      ITSDHLDFHGSLEEYIAKQFFASLP---------------------------------------------
FOLD_YEAST      ISLDHESFLGNTLSEISKEKAGIITEGVPFTTNEASVINVVKERCKALGSELSVTDSQ------------
FOLC_ECOLI      IALDHTDWLGPDRESIGREKA-------------------------------------------------


                         .         .         .         +         .         .         .:280
query           FVYSEFKINVALALKVTDDLGIPREIALKGMWEATPDPGAMTEYXXXXXXXXXXXXXXXXXXDPVSTKML
CAPB_BACAN      FDYMVFPDNASLALAVAEALGIDEETAFRGMLNAHPDPGAMRITRFADQSKPAFFVNGFAANDPSSTLRI
CAPB_BACSU      FEYMVFPDNASLALGVAQALGIDEETAFKGMLNAPPDPGAMRILPLISPSEPGHFVNGFAANDASSTLNI
MURE_CHLTR      ----------------------------------------------------------------------
MURE_CHLTA      ----------------------------------------------------------------------
FOLD_YEAST      ----------------------------------------------------------------------
FOLC_ECOLI      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           WDKLCAKYSGCDKKVLVVNCRDDREDRSKQMAEAALGWQKQDLIVLIGTGTEVFTSFYKKYAKSLNKPMT
CAPB_BACAN      WERVDDFGYSNLAPIVIMNCRPDRVDRTEQFARDVLPYIKAEIVIAIGETTAPITSAFEKG----DIPTQ
CAPB_BACSU      WKRVKEIGYPTDDPIIIMNCRADRVDRTQQFANDVLPYIEASELILIGETTEPIVKAYEEG----KIPAD
MURE_CHLTR      ----------------------------------------------------------------------
MURE_CHLTA      ----------------------------------------------------------------------
FOLD_YEAST      ----------------------------------------------------------------------
FOLC_ECOLI      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           KVIVCEEMTPIQILEKTVDSNPANSYILVGVGNIKDIGMELVDxxxxxxxxxxxx
CAPB_BACAN      EYWNLEGWSTSEIMSRM--RPYLKNRIVYGVGNIHGAAEPLID------------
CAPB_BACSU      KLHDLEYKSTDEIME--LLKKRMHNRVIYGVGNIHGAAEPLIE------------
MURE_CHLTR      -------------------------------------------------------
MURE_CHLTA      -------------------------------------------------------
FOLD_YEAST      -------------------------------------------------------
FOLC_ECOLI      -------------------------------------------------------