[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD31006.1

[Show Plain Result]


## Summary of Sequence Search
    1::509
   26::501     7e-48  27%  512 aa  EMRB_ECOLI RecName: Full=Multidrug resistance protein B;
   26::501     7e-48  27%  512 aa  EMRB_ECO57 RecName: Full=Multidrug resistance protein B;
   30::505     1e-43  26%  510 aa  EMRB_HAEIN RecName: Full=Multidrug resistance protein B homolog;
   30::505     2e-35  23%  512 aa  EMRY_ECOLI RecName: Full=Multidrug resistance protein Y;
   22::246     9e-33  30%  465 aa  MDTD_YERPY RecName: Full=Putative multidrug resistance protein
   22::246     9e-33  30%  465 aa  MDTD_YERPP RecName: Full=Putative multidrug resistance protein
   22::246     9e-33  30%  465 aa  MDTD_YERPN RecName: Full=Putative multidrug resistance protein
   22::246     9e-33  30%  465 aa  MDTD_YERPG RecName: Full=Putative multidrug resistance protein
   22::246     9e-33  30%  465 aa  MDTD_YERPE RecName: Full=Putative multidrug resistance protein
   22::246     9e-33  30%  465 aa  MDTD_YERPB RecName: Full=Putative multidrug resistance protein
   22::246     9e-33  30%  465 aa  MDTD_YERPA RecName: Full=Putative multidrug resistance protein
   22::246     9e-33  30%  465 aa  MDTD_YERP3 RecName: Full=Putative multidrug resistance protein
   27::371     4e-32  28%  512 aa  BMR3_BACSU RecName: Full=Multidrug resistance protein 3;AltName:
   22::246     6e-32  29%  465 aa  MDTD_YERPS RecName: Full=Putative multidrug resistance protein
   21::237     4e-30  28%  466 aa  MDTD_PECCP RecName: Full=Putative multidrug resistance protein
   23::216     5e-30  31%  477 aa  MDTD_SERP5 RecName: Full=Putative multidrug resistance protein
   18::211     6e-29  30%  469 aa  MDTD_YERE8 RecName: Full=Putative multidrug resistance protein
   27::440     4e-27  21%  532 aa  YHCA_BACSU RecName: Full=Uncharacterized MFS-type transporter yhcA;
   29::422     1e-24  29%  457 aa  YEBQ_ECOLI RecName: Full=Uncharacterized transporter yebQ;
   69::433     3e-24  23%  471 aa  LMRB_LISIN RecName: Full=Lincomycin resistance protein lmrB;
   24::222     7e-24  27%  471 aa  MDTD_ECOL6 RecName: Full=Putative multidrug resistance protein
   24::222     7e-24  27%  471 aa  MDTD_ECO81 RecName: Full=Putative multidrug resistance protein
   69::433     7e-24  23%  471 aa  LMRB_LISMO RecName: Full=Lincomycin resistance protein lmrB;
   24::221     1e-23  28%  471 aa  MDTD_SHIF8 RecName: Full=Putative multidrug resistance protein
   24::221     1e-23  27%  471 aa  MDTD_ESCF3 RecName: Full=Putative multidrug resistance protein
   24::222     1e-23  27%  471 aa  MDTD_ECOUT RecName: Full=Putative multidrug resistance protein
   24::221     1e-23  28%  471 aa  MDTD_ECOLU RecName: Full=Putative multidrug resistance protein
   24::222     1e-23  27%  471 aa  MDTD_ECOK1 RecName: Full=Putative multidrug resistance protein
   24::222     1e-23  27%  471 aa  MDTD_ECO45 RecName: Full=Putative multidrug resistance protein
   24::221     2e-23  27%  471 aa  MDTD_SHISS RecName: Full=Putative multidrug resistance protein
   24::221     2e-23  27%  471 aa  MDTD_SHIFL RecName: Full=Putative multidrug resistance protein
   24::221     2e-23  27%  471 aa  MDTD_SHIBS RecName: Full=Putative multidrug resistance protein
   24::221     2e-23  27%  471 aa  MDTD_SHIB3 RecName: Full=Putative multidrug resistance protein
   24::221     2e-23  27%  471 aa  MDTD_ECOSM RecName: Full=Putative multidrug resistance protein
   24::221     2e-23  27%  471 aa  MDTD_ECOSE RecName: Full=Putative multidrug resistance protein
   24::221     2e-23  27%  471 aa  MDTD_ECOLI RecName: Full=Putative multidrug resistance protein
   24::221     2e-23  27%  471 aa  MDTD_ECOLC RecName: Full=Putative multidrug resistance protein
   24::221     2e-23  27%  471 aa  MDTD_ECOL5 RecName: Full=Putative multidrug resistance protein
   24::221     2e-23  27%  471 aa  MDTD_ECOHS RecName: Full=Putative multidrug resistance protein
   24::221     2e-23  27%  471 aa  MDTD_ECODH RecName: Full=Putative multidrug resistance protein
   24::221     2e-23  27%  471 aa  MDTD_ECOBW RecName: Full=Putative multidrug resistance protein
   24::221     2e-23  27%  471 aa  MDTD_ECO8A RecName: Full=Putative multidrug resistance protein
   24::221     2e-23  27%  471 aa  MDTD_ECO7I RecName: Full=Putative multidrug resistance protein
   24::221     2e-23  27%  471 aa  MDTD_ECO5E RecName: Full=Putative multidrug resistance protein
   24::221     2e-23  27%  471 aa  MDTD_ECO57 RecName: Full=Putative multidrug resistance protein
   24::221     2e-23  27%  471 aa  MDTD_ECO55 RecName: Full=Putative multidrug resistance protein
   24::221     2e-23  27%  471 aa  MDTD_ECO27 RecName: Full=Putative multidrug resistance protein
   24::221     2e-23  27%  471 aa  MDTD_ECO24 RecName: Full=Putative multidrug resistance protein
   24::242     3e-23  25%  471 aa  MDTD_CITK8 RecName: Full=Putative multidrug resistance protein
   24::221     6e-23  27%  470 aa  MDTD_SALSV RecName: Full=Putative multidrug resistance protein
   26::381     8e-23  30%  543 aa  SGE1_YEAST RecName: Full=Protein SGE1;AltName: Full=Crystal violet
   23::387     1e-22  24%  475 aa  HSRA_ECOLI RecName: Full=Probable transport protein hsrA;AltName:
   24::221     1e-22  27%  470 aa  MDTD_SALTI RecName: Full=Putative multidrug resistance protein
   24::221     1e-22  27%  470 aa  MDTD_SALPK RecName: Full=Putative multidrug resistance protein
   24::221     1e-22  27%  470 aa  MDTD_SALPB RecName: Full=Putative multidrug resistance protein
   24::221     1e-22  27%  470 aa  MDTD_SALPA RecName: Full=Putative multidrug resistance protein
   24::221     1e-22  27%  470 aa  MDTD_SALNS RecName: Full=Putative multidrug resistance protein
   24::221     1e-22  27%  470 aa  MDTD_SALHS RecName: Full=Putative multidrug resistance protein
   24::221     1e-22  27%  470 aa  MDTD_SALEP RecName: Full=Putative multidrug resistance protein
   24::221     1e-22  27%  470 aa  MDTD_SALDC RecName: Full=Putative multidrug resistance protein
   24::221     1e-22  27%  470 aa  MDTD_SALA4 RecName: Full=Putative multidrug resistance protein
   24::221     2e-22  27%  470 aa  MDTD_SALTY RecName: Full=Putative multidrug resistance protein
   21::218     2e-22  24%  466 aa  MDTD_ERWCT RecName: Full=Putative multidrug resistance protein
   24::243     5e-22  25%  471 aa  MDTD_ENT38 RecName: Full=Putative multidrug resistance protein
   41::188     4e-21  31%  538 aa  TCMA_STRGA RecName: Full=Tetracenomycin C resistance and export
   34::383     8e-21  22%  479 aa  LMRB_BACSU RecName: Full=Lincomycin resistance protein lmrB;
   11::393     1e-20  20%  541 aa  YUSP_BACSU RecName: Full=Uncharacterized MFS-type transporter yusP;
   24::388     5e-20  21%  463 aa  HSRA_HAEIN RecName: Full=Probable transport protein hsrA;
   12::204     3e-19  24%  472 aa  YCNB_BACSU RecName: Full=Uncharacterized MFS-type transporter ycnB;
   33::259     5e-19  27%  514 aa  QACA_STAAU RecName: Full=Antiseptic resistance protein;
   33::259     5e-19  27%  514 aa  QACA_STAAM RecName: Full=Antiseptic resistance protein;
   22::197     4e-18  24%  471 aa  MDTD_ENTS8 RecName: Full=Putative multidrug resistance protein
   24::200     6e-18  24%  471 aa  MDTD_KLEP3 RecName: Full=Putative multidrug resistance protein
   24::200     8e-18  24%  471 aa  MDTD_KLEP7 RecName: Full=Putative multidrug resistance protein
   27::349     2e-17  22%  518 aa  YFIU_BACSU RecName: Full=Uncharacterized MFS-type transporter yfiU;
   67::392     1e-16  21%  477 aa  BAIG_EUBSP RecName: Full=Bile acid transporter;
   87::205     3e-16  32%  491 aa  YJA1_SCHPO RecName: Full=Uncharacterized transporter C1529.01;
  130::382     2e-14  24%  589 aa  YAN6_SCHPO RecName: Full=Uncharacterized transporter C3H1.06c;
   52::214     2e-14  26%  582 aa  VBA5_YEAST RecName: Full=Vacuolar basic amino acid transporter 5;
   40::239     2e-14  21%  475 aa  MMR_STRCO RecName: Full=Methylenomycin A resistance
   27::360     2e-14  20%  458 aa  TCR_STRPN RecName: Full=Tetracycline resistance protein;
   27::360     2e-14  20%  458 aa  TCR_BACSU RecName: Full=Tetracycline resistance protein;
   27::360     2e-14  20%  458 aa  TCR_BACST RecName: Full=Tetracycline resistance protein;
   27::360     2e-14  20%  458 aa  TCR_BACCE RecName: Full=Tetracycline resistance protein;
   24::182     2e-14  24%  395 aa  MDTL_SALAR RecName: Full=Multidrug resistance protein mdtL;
  130::252     4e-14  34%  589 aa  YI32_SCHPO RecName: Full=Uncharacterized MFS-type transporter
   31::240     7e-14  23%  410 aa  MDTM_ECOLI RecName: Full=Multidrug resistance protein mdtM;
   31::240     9e-14  23%  410 aa  MDTM_ECO57 RecName: Full=Multidrug resistance protein mdtM;
   22::235     2e-13  23%  444 aa  YVKA_BACSU RecName: Full=Uncharacterized MFS-type transporter yvkA;
  141::288     2e-13  29%  547 aa  YCT4_SCHPO RecName: Full=Uncharacterized transporter C794.04c;
   27::370     2e-13  20%  458 aa  TCR_STRAG RecName: Full=Tetracycline resistance protein;
   24::182     3e-13  23%  395 aa  MDTL_SALPK RecName: Full=Multidrug resistance protein mdtL;
   24::182     3e-13  23%  395 aa  MDTL_SALPA RecName: Full=Multidrug resistance protein mdtL;
   24::182     3e-13  23%  395 aa  MDTL_SALEP RecName: Full=Multidrug resistance protein mdtL;
   24::182     3e-13  23%  395 aa  MDTL_SALDC RecName: Full=Multidrug resistance protein mdtL;
   24::182     4e-13  23%  395 aa  MDTL_SALTI RecName: Full=Multidrug resistance protein mdtL;
   27::217     6e-13  22%  458 aa  TCRB_BACSU RecName: Full=Tetracycline resistance protein;
   24::182     6e-13  23%  395 aa  MDTL_SALTY RecName: Full=Multidrug resistance protein mdtL;
   24::182     6e-13  23%  395 aa  MDTL_SALPC RecName: Full=Multidrug resistance protein mdtL;
   24::182     6e-13  23%  395 aa  MDTL_SALPB RecName: Full=Multidrug resistance protein mdtL;
   24::182     6e-13  23%  395 aa  MDTL_SALNS RecName: Full=Multidrug resistance protein mdtL;
   24::182     6e-13  23%  395 aa  MDTL_SALHS RecName: Full=Multidrug resistance protein mdtL;
   24::182     6e-13  23%  395 aa  MDTL_SALCH RecName: Full=Multidrug resistance protein mdtL;
   24::182     6e-13  23%  395 aa  MDTL_SALA4 RecName: Full=Multidrug resistance protein mdtL;
   83::230     6e-13  26%  613 aa  AZR1_YEAST RecName: Full=Azole resistance protein 1;
   24::182     8e-13  23%  395 aa  MDTL_SALSV RecName: Full=Multidrug resistance protein mdtL;
   31::234     1e-12  21%  466 aa  MMR_BACSU RecName: Full=Methylenomycin A resistance
   19::179     1e-12  23%  396 aa  MDTL_VIBPA RecName: Full=Multidrug resistance protein mdtL;
  105::264     3e-12  25%  577 aa  YHX6_SCHPO RecName: Full=Uncharacterized MFS-type transporter
   91::389     6e-12  24%  519 aa  YHD3_SCHPO RecName: Full=Uncharacterized MFS-type transporter
   27::360     1e-11  20%  458 aa  TCR_STAHY RecName: Full=Tetracycline resistance protein;
   24::182     2e-11  21%  391 aa  MDTL_ECOL6 RecName: Full=Multidrug resistance protein mdtL;
   24::182     2e-11  21%  391 aa  MDTL_ECO81 RecName: Full=Multidrug resistance protein mdtL;
  121::268     4e-11  33%  542 aa  ATR1_YEAST RecName: Full=Aminotriazole resistance protein;
   54::259     4e-11  21%  578 aa  ACT22_STRCO RecName: Full=Probable actinorhodin transporter;
   24::182     5e-11  21%  391 aa  MDTL_ECOL5 RecName: Full=Multidrug resistance protein mdtL;
   24::182     5e-11  21%  391 aa  MDTL_ECO27 RecName: Full=Multidrug resistance protein mdtL;
   24::182     7e-11  21%  391 aa  MDTL_ECOUT RecName: Full=Multidrug resistance protein mdtL;
   24::182     7e-11  21%  391 aa  MDTL_ECOK1 RecName: Full=Multidrug resistance protein mdtL;
   24::182     7e-11  21%  391 aa  MDTL_ECO45 RecName: Full=Multidrug resistance protein mdtL;
  171::320     2e-10  27%  577 aa  YN42_SCHPO RecName: Full=Uncharacterized transporter C36.02c;
   24::182     2e-10  21%  392 aa  MDTL_KLEP3 RecName: Full=Multidrug resistance protein mdtL;
   24::182     2e-10  21%  391 aa  MDTL_ESCF3 RecName: Full=Multidrug resistance protein mdtL;
   24::182     2e-10  21%  391 aa  MDTL_ECOSM RecName: Full=Multidrug resistance protein mdtL;
   24::182     2e-10  21%  391 aa  MDTL_ECOLU RecName: Full=Multidrug resistance protein mdtL;
   34::194     2e-10  24%  486 aa  CMCT_NOCLA RecName: Full=Cephamycin export protein cmcT;
   24::182     2e-10  21%  391 aa  MDTL_SHISS RecName: Full=Multidrug resistance protein mdtL;
   24::182     2e-10  21%  391 aa  MDTL_SHIFL RecName: Full=Multidrug resistance protein mdtL;
   24::182     2e-10  21%  391 aa  MDTL_SHIF8 RecName: Full=Multidrug resistance protein mdtL;
   24::182     2e-10  21%  391 aa  MDTL_SHIBS RecName: Full=Multidrug resistance protein mdtL;
   24::182     2e-10  21%  391 aa  MDTL_SHIB3 RecName: Full=Multidrug resistance protein mdtL;
   24::182     2e-10  21%  391 aa  MDTL_ECOSE RecName: Full=Multidrug resistance protein mdtL;
   24::182     2e-10  21%  391 aa  MDTL_ECOLI RecName: Full=Multidrug resistance protein mdtL;
   24::182     2e-10  21%  391 aa  MDTL_ECOLC RecName: Full=Multidrug resistance protein mdtL;
   24::182     2e-10  21%  391 aa  MDTL_ECOHS RecName: Full=Multidrug resistance protein mdtL;
   24::182     2e-10  21%  391 aa  MDTL_ECODH RecName: Full=Multidrug resistance protein mdtL;
   24::182     2e-10  21%  391 aa  MDTL_ECOBW RecName: Full=Multidrug resistance protein mdtL;
   24::182     2e-10  21%  391 aa  MDTL_ECO8A RecName: Full=Multidrug resistance protein mdtL;
   24::182     2e-10  21%  391 aa  MDTL_ECO7I RecName: Full=Multidrug resistance protein mdtL;
   24::182     2e-10  21%  391 aa  MDTL_ECO55 RecName: Full=Multidrug resistance protein mdtL;
   24::182     2e-10  21%  391 aa  MDTL_ECO24 RecName: Full=Multidrug resistance protein mdtL;
   24::182     2e-10  21%  390 aa  MDTL_CITK8 RecName: Full=Multidrug resistance protein mdtL;
   24::182     3e-10  21%  391 aa  MDTL_SHIDS RecName: Full=Multidrug resistance protein mdtL;
   24::182     3e-10  21%  391 aa  MDTL_ECO5E RecName: Full=Multidrug resistance protein mdtL;
   24::182     3e-10  21%  391 aa  MDTL_ECO57 RecName: Full=Multidrug resistance protein mdtL;
   36::191     4e-10  24%  396 aa  YFMO_BACSU RecName: Full=Multidrug efflux protein yfmO;
   40::180     4e-10  26%  473 aa  PHDK_NOCSK RecName: Full=Probable 1-hydroxy-2-naphthoate
  111::283     5e-10  25%  599 aa  YBIH_SCHPO RecName: Full=Uncharacterized MFS-type transporter
   66::220     8e-10  26%  396 aa  YWOG_BACSU RecName: Full=Uncharacterized MFS-type transporter ywoG;
   49::195     8e-10  22%  410 aa  MDFA_ECOLI RecName: Full=Multidrug translocase mdfA;AltName:
   49::195     8e-10  22%  410 aa  MDFA_ECOL6 RecName: Full=Multidrug translocase mdfA;AltName:
   49::195     8e-10  22%  410 aa  MDFA_ECO57 RecName: Full=Multidrug translocase mdfA;AltName:
  170::319     1e-09  24%  576 aa  YQO5_SCHPO RecName: Full=Uncharacterized transporter C569.05c;
   24::182     2e-09  20%  392 aa  MDTL_KLEP7 RecName: Full=Multidrug resistance protein mdtL;
  202::323     2e-09  23%  580 aa  YN41_SCHPO RecName: Full=Uncharacterized transporter C36.01c;
    7::140     2e-09  21%  474 aa  VBA2_YEAST RecName: Full=Vacuolar basic amino acid transporter 2;
   34::194     2e-09  20%  398 aa  BCR_HAEIN RecName: Full=Bicyclomycin resistance protein homolog;
  140::275     3e-09  24%  538 aa  YN43_SCHPO RecName: Full=Uncharacterized transporter C36.03c;
   62::196     3e-09  21%  403 aa  YDHC_ECOLI RecName: Full=Inner membrane transport protein ydhC;
   35::202     3e-09  22%  496 aa  NANT_SALTY RecName: Full=Putative sialic acid transporter;AltName:
   35::202     3e-09  22%  496 aa  NANT_SALTI RecName: Full=Putative sialic acid transporter;AltName:
   35::202     3e-09  22%  496 aa  NANT_SALSV RecName: Full=Putative sialic acid transporter;AltName:
   35::202     3e-09  22%  496 aa  NANT_SALPK RecName: Full=Putative sialic acid transporter;AltName:
   35::202     3e-09  22%  496 aa  NANT_SALPC RecName: Full=Putative sialic acid transporter;AltName:
   35::202     3e-09  22%  496 aa  NANT_SALPB RecName: Full=Putative sialic acid transporter;AltName:
   35::202     3e-09  22%  496 aa  NANT_SALPA RecName: Full=Putative sialic acid transporter;AltName:
   35::202     3e-09  22%  496 aa  NANT_SALNS RecName: Full=Putative sialic acid transporter;AltName:
   35::202     3e-09  22%  496 aa  NANT_SALHS RecName: Full=Putative sialic acid transporter;AltName:
   35::202     3e-09  22%  496 aa  NANT_SALG2 RecName: Full=Putative sialic acid transporter;AltName:
   35::202     3e-09  22%  496 aa  NANT_SALEP RecName: Full=Putative sialic acid transporter;AltName:
   35::202     3e-09  22%  496 aa  NANT_SALDC RecName: Full=Putative sialic acid transporter;AltName:
   35::202     3e-09  22%  496 aa  NANT_SALCH RecName: Full=Putative sialic acid transporter;AltName:
   35::202     3e-09  22%  496 aa  NANT_SALAR RecName: Full=Putative sialic acid transporter;AltName:
   35::202     4e-09  20%  496 aa  NANT_ESCF3 RecName: Full=Putative sialic acid transporter;AltName:
   35::202     4e-09  22%  496 aa  NANT_CITK8 RecName: Full=Putative sialic acid transporter;AltName:
   56::189     5e-09  28%  404 aa  YYBF_BACSU RecName: Full=Uncharacterized MFS-type transporter yybF;
   78::279     5e-09  26%  515 aa  YO378_YEAST RecName: Full=Drug resistance protein YOR378W;
   26::189     9e-09  21%  452 aa  YWOD_BACSU RecName: Full=Uncharacterized MFS-type transporter ywoD;
   39::181     9e-09  25%  390 aa  Y466_BUCAI RecName: Full=Uncharacterized transporter BU466;
   35::202     1e-08  20%  496 aa  NANT_SHIFL RecName: Full=Putative sialic acid transporter;AltName:
   35::202     1e-08  20%  496 aa  NANT_SHIF8 RecName: Full=Putative sialic acid transporter;AltName:
   35::202     1e-08  20%  496 aa  NANT_SHIB3 RecName: Full=Putative sialic acid transporter;AltName:
   35::202     1e-08  20%  496 aa  NANT_ECOSM RecName: Full=Putative sialic acid transporter;AltName:
   35::202     1e-08  20%  496 aa  NANT_ECOSE RecName: Full=Putative sialic acid transporter;AltName:
   35::202     1e-08  20%  496 aa  NANT_ECOLI RecName: Full=Putative sialic acid transporter;AltName:
   35::202     1e-08  20%  496 aa  NANT_ECOLC RecName: Full=Putative sialic acid transporter;AltName:
   35::202     1e-08  20%  496 aa  NANT_ECOL5 RecName: Full=Putative sialic acid transporter;AltName:
   35::202     1e-08  20%  496 aa  NANT_ECOHS RecName: Full=Putative sialic acid transporter;AltName:
   35::202     1e-08  20%  496 aa  NANT_ECODH RecName: Full=Putative sialic acid transporter;AltName:
   35::202     1e-08  20%  496 aa  NANT_ECOBW RecName: Full=Putative sialic acid transporter;AltName:
   35::202     1e-08  20%  496 aa  NANT_ECO8A RecName: Full=Putative sialic acid transporter;AltName:
   35::202     1e-08  20%  496 aa  NANT_ECO7I RecName: Full=Putative sialic acid transporter;AltName:
   35::202     1e-08  20%  496 aa  NANT_ECO5E RecName: Full=Putative sialic acid transporter;AltName:
   35::202     1e-08  20%  496 aa  NANT_ECO57 RecName: Full=Putative sialic acid transporter;AltName:
   35::202     1e-08  20%  496 aa  NANT_ECO55 RecName: Full=Putative sialic acid transporter;AltName:
   35::202     1e-08  20%  496 aa  NANT_ECO45 RecName: Full=Putative sialic acid transporter;AltName:
   35::202     1e-08  20%  496 aa  NANT_ECO27 RecName: Full=Putative sialic acid transporter;AltName:
   35::202     1e-08  20%  496 aa  NANT_ECO24 RecName: Full=Putative sialic acid transporter;AltName:
   35::202     1e-08  20%  496 aa  NANT1_ECOL6 RecName: Full=Putative sialic acid transporter
  133::291     1e-08  22%  572 aa  YB30_YEAST RecName: Full=Uncharacterized transporter YBR180W;
  106::222     1e-08  24%  459 aa  TCR_STAES RecName: Full=Tetracycline resistance protein;
  106::222     1e-08  24%  459 aa  TCR_STAAU RecName: Full=Tetracycline resistance protein;AltName:
  157::292     1e-08  23%  605 aa  SPIN_DROME RecName: Full=Protein spinster;AltName: Full=Protein
   92::244     2e-08  22%  516 aa  YN2F_SCHPO RecName: Full=Uncharacterized MFS-type transporter
   20::179     2e-08  21%  495 aa  SMVA_SALTY RecName: Full=Methyl viologen resistance protein smvA;
  126::463     2e-08  25%  607 aa  MIRC_EMENI RecName: Full=Siderophore iron transporter mirC;AltName:
   43::219     3e-08  20%  451 aa  YYAJ_BACSU RecName: Full=Putative metabolite transport protein
   46::245     3e-08  21%  531 aa  FNX1_SCHPO RecName: Full=Multidrug resistance protein fnx1;
  144::274     4e-08  26%  539 aa  YHA8_SCHPO RecName: Full=Uncharacterized MFS-type transporter
   23::185     6e-08  18%  457 aa  YWTG_BACSU RecName: Full=Putative metabolite transport protein
   71::178     6e-08  25%  410 aa  Y588_BUCAI RecName: Full=Uncharacterized transporter BU588;
   50::221     6e-08  24%  457 aa  PCAK_ACIAD RecName: Full=4-hydroxybenzoate transporter;
   48::215     6e-08  19%  510 aa  NANT_YERPY RecName: Full=Putative sialic acid transporter;AltName:
   32::165     6e-08  21%  396 aa  BCR_ECOLI RecName: Full=Bicyclomycin resistance protein;AltName:
   37::186     7e-08  30%  466 aa  BENK_ACIAD RecName: Full=Benzoate transport protein;
  117::293     1e-07  27%  540 aa  YM8M_YEAST RecName: Full=Uncharacterized transporter YMR279C;
    5::173     1e-07  20%  413 aa  MDTM_SALTY RecName: Full=Multidrug resistance protein mdtM;
    5::173     1e-07  20%  413 aa  MDTM_SALTI RecName: Full=Multidrug resistance protein mdtM;
   48::215     1e-07  19%  510 aa  NANT_YERPS RecName: Full=Putative sialic acid transporter;AltName:
   48::215     1e-07  19%  510 aa  NANT_YERPP RecName: Full=Putative sialic acid transporter;AltName:
   48::215     1e-07  19%  510 aa  NANT_YERPG RecName: Full=Putative sialic acid transporter;AltName:
   48::215     1e-07  19%  510 aa  NANT_YERPB RecName: Full=Putative sialic acid transporter;AltName:
   48::215     1e-07  19%  510 aa  NANT_YERP3 RecName: Full=Putative sialic acid transporter;AltName:
   48::362     1e-07  20%  502 aa  NANT2_ECOL6 RecName: Full=Putative sialic acid transporter
   32::194     1e-07  22%  464 aa  GALP_ECOLI RecName: Full=Galactose-proton symporter;AltName:
   32::194     1e-07  22%  464 aa  GALP_ECOL6 RecName: Full=Galactose-proton symporter;AltName:
   28::337     2e-07  24%  403 aa  YVMA_BACSU RecName: Full=Uncharacterized MFS-type transporter yvmA;
   34::183     2e-07  23%  511 aa  YUBD_BACSU RecName: Full=Uncharacterized MFS-type transporter yubD;
  250::396     2e-07  24%  401 aa  YHJO_BACSU RecName: Full=Uncharacterized MFS-type transporter yhjO;
  164::333     2e-07  22%  586 aa  TPO1_YEAST RecName: Full=Polyamine transporter 1;
   48::215     2e-07  19%  510 aa  NANT_YERPE RecName: Full=Putative sialic acid transporter;AltName:
   48::215     2e-07  19%  510 aa  NANT_YERPA RecName: Full=Putative sialic acid transporter;AltName:
   24::161     2e-07  23%  396 aa  MDTL_SHESA RecName: Full=Multidrug resistance protein mdtL;
   24::165     2e-07  21%  461 aa  CSBC_BACSU RecName: Full=Probable metabolite transport protein
   85::255     3e-07  25%  413 aa  Y567_BUCAP RecName: Full=Uncharacterized transporter BUsg_567;
   35::144     3e-07  27%  496 aa  NANT_SALA4 RecName: Full=Putative sialic acid transporter;AltName:
   42::160     4e-07  25%  390 aa  YCEJ_BACSU RecName: Full=Uncharacterized MFS-type transporter yceJ;
   38::90      5e-07  32%  458 aa  VBA3_YEAST RecName: Full=Vacuolar basic amino acid transporter 3;
  238::460     5e-07  24%  622 aa  TPO3_YEAST RecName: Full=Polyamine transporter 3;
   48::319     6e-07  28%  409 aa  BCRH_RICTY RecName: Full=Uncharacterized transporter RT0591;
   38::177     6e-07  22%  472 aa  ARAE_KLEOX RecName: Full=Arabinose-proton symporter;AltName:
   22::188     8e-07  20%  422 aa  EXUT_BACSU RecName: Full=Hexuronate transporter;
   38::177     1e-06  21%  472 aa  ARAE_ECOLI RecName: Full=Arabinose-proton symporter;AltName:
   38::177     1e-06  21%  472 aa  ARAE_ECO57 RecName: Full=Arabinose-proton symporter;AltName:
   46::149     1e-06  23%  382 aa  Y2171_CITK8 RecName: Full=Uncharacterized MFS-type transporter
   61::222     1e-06  26%  492 aa  SVOPL_HUMAN RecName: Full=Putative transporter SVOPL;AltName:
   24::161     1e-06  22%  396 aa  MDTL_SHEON RecName: Full=Multidrug resistance protein mdtL;
  229::451     2e-06  24%  614 aa  TPO2_YEAST RecName: Full=Polyamine transporter 2;
   35::144     2e-06  24%  496 aa  NANT_ENTS8 RecName: Full=Putative sialic acid transporter;AltName:
  114::266     2e-06  22%  526 aa  BSU1_SCHPO RecName: Full=Vitamin B6 transporter bsu1;AltName:
   46::149     2e-06  25%  382 aa  YCAD_SHIFL RecName: Full=Uncharacterized MFS-type transporter ycaD;
   46::149     2e-06  25%  382 aa  YCAD_SHIF8 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   36::149     2e-06  24%  382 aa  YCAD_SALTY RecName: Full=Uncharacterized MFS-type transporter ycaD;
   36::149     2e-06  24%  382 aa  YCAD_SALTI RecName: Full=Uncharacterized MFS-type transporter ycaD;
   36::149     2e-06  24%  382 aa  YCAD_SALSV RecName: Full=Uncharacterized MFS-type transporter ycaD;
   36::149     2e-06  24%  382 aa  YCAD_SALPK RecName: Full=Uncharacterized MFS-type transporter ycaD;
   36::149     2e-06  24%  382 aa  YCAD_SALPC RecName: Full=Uncharacterized MFS-type transporter ycaD;
   36::149     2e-06  24%  382 aa  YCAD_SALPA RecName: Full=Uncharacterized MFS-type transporter ycaD;
   36::149     2e-06  24%  382 aa  YCAD_SALNS RecName: Full=Uncharacterized MFS-type transporter ycaD;
   36::149     2e-06  24%  382 aa  YCAD_SALHS RecName: Full=Uncharacterized MFS-type transporter ycaD;
   36::149     2e-06  24%  382 aa  YCAD_SALCH RecName: Full=Uncharacterized MFS-type transporter ycaD;
   36::149     2e-06  24%  382 aa  YCAD_SALA4 RecName: Full=Uncharacterized MFS-type transporter ycaD;
  187::285     3e-06  28%  552 aa  CYHR_CANMA RecName: Full=Cycloheximide resistance protein;
   24::164     3e-06  21%  407 aa  BCRH_RICPR RecName: Full=Uncharacterized transporter RP603;
   46::149     4e-06  22%  382 aa  YCAD_ESCF3 RecName: Full=Uncharacterized MFS-type transporter ycaD;
  164::301     4e-06  26%  495 aa  S17A5_MOUSE RecName: Full=Sialin;AltName: Full=Solute carrier
   32::193     4e-06  21%  413 aa  MUCK_ACIAD RecName: Full=Cis,cis-muconate transport protein;
   46::149     5e-06  24%  382 aa  YCAD_SHISS RecName: Full=Uncharacterized MFS-type transporter ycaD;
   46::149     5e-06  24%  382 aa  YCAD_SHIDS RecName: Full=Uncharacterized MFS-type transporter ycaD;
   46::149     5e-06  24%  382 aa  YCAD_ECOUT RecName: Full=Uncharacterized MFS-type transporter ycaD;
   46::149     5e-06  24%  382 aa  YCAD_ECOSM RecName: Full=Uncharacterized MFS-type transporter ycaD;
   46::149     5e-06  24%  382 aa  YCAD_ECOSE RecName: Full=Uncharacterized MFS-type transporter ycaD;
   46::149     5e-06  24%  382 aa  YCAD_ECOLU RecName: Full=Uncharacterized MFS-type transporter ycaD;
   46::149     5e-06  24%  382 aa  YCAD_ECOLI RecName: Full=Uncharacterized MFS-type transporter ycaD;
   46::149     5e-06  24%  382 aa  YCAD_ECOLC RecName: Full=Uncharacterized MFS-type transporter ycaD;
   46::149     5e-06  24%  382 aa  YCAD_ECOL6 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   46::149     5e-06  24%  382 aa  YCAD_ECOL5 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   46::149     5e-06  24%  382 aa  YCAD_ECOK1 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   46::149     5e-06  24%  382 aa  YCAD_ECOHS RecName: Full=Uncharacterized MFS-type transporter ycaD;
   46::149     5e-06  24%  382 aa  YCAD_ECODH RecName: Full=Uncharacterized MFS-type transporter ycaD;
   46::149     5e-06  24%  382 aa  YCAD_ECOBW RecName: Full=Uncharacterized MFS-type transporter ycaD;
   46::149     5e-06  24%  382 aa  YCAD_ECO8A RecName: Full=Uncharacterized MFS-type transporter ycaD;
   46::149     5e-06  24%  382 aa  YCAD_ECO81 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   46::149     5e-06  24%  382 aa  YCAD_ECO7I RecName: Full=Uncharacterized MFS-type transporter ycaD;
   46::149     5e-06  24%  382 aa  YCAD_ECO5E RecName: Full=Uncharacterized MFS-type transporter ycaD;
   46::149     5e-06  24%  382 aa  YCAD_ECO57 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   46::149     5e-06  24%  382 aa  YCAD_ECO55 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   46::149     5e-06  24%  382 aa  YCAD_ECO45 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   46::149     5e-06  24%  382 aa  YCAD_ECO27 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   46::149     5e-06  24%  382 aa  YCAD_ECO24 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   63::211     5e-06  23%  506 aa  SPNS1_DANRE RecName: Full=Protein spinster homolog 1;AltName:
   33::184     7e-06  19%  422 aa  YITG_BACSU RecName: Full=Uncharacterized MFS-type transporter yitG;
   36::149     7e-06  23%  382 aa  YCAD_SALEP RecName: Full=Uncharacterized MFS-type transporter ycaD;
  102::220     7e-06  23%  493 aa  VACHT_DANRE RecName: Full=Probable vesicular acetylcholine
  275::397     7e-06  24%  399 aa  PMRA_STRR6 RecName: Full=Multi-drug resistance efflux pump pmrA;
  275::397     7e-06  24%  399 aa  PMRA_STRPN RecName: Full=Multi-drug resistance efflux pump pmrA;
   28::143     7e-06  20%  400 aa  BMR2_BACSU RecName: Full=Multidrug resistance protein 2;AltName:
   36::149     9e-06  23%  382 aa  YCAD_SALPB RecName: Full=Uncharacterized MFS-type transporter ycaD;
    2::64      9e-06  30%  348 aa  MDTD_SHIDS RecName: Full=Putative multidrug resistance protein
   46::149     1e-05  22%  382 aa  YCAD_SALAR RecName: Full=Uncharacterized MFS-type transporter ycaD;
   61::227     1e-05  22%  494 aa  SVOPL_MOUSE RecName: Full=Putative transporter SVOPL;AltName:
  119::301     1e-05  23%  495 aa  S17A5_HUMAN RecName: Full=Sialin;AltName: Full=Solute carrier
   30::352     1e-05  24%  430 aa  DGOT_ECOLI RecName: Full=D-galactonate transporter;
   30::352     1e-05  24%  430 aa  DGOT_ECOL6 RecName: Full=D-galactonate transporter;
   60::163     2e-05  29%  454 aa  YAJR_ECOLI RecName: Full=Inner membrane transport protein yajR;
   62::190     2e-05  22%  386 aa  Y1560_METJA RecName: Full=Uncharacterized MFS-type transporter
  155::272     2e-05  31%  555 aa  S22A2_RAT RecName: Full=Solute carrier family 22 member 2;AltName:
  125::239     2e-05  27%  557 aa  ITR2_SCHPO RecName: Full=Myo-inositol transporter 2;
   65::193     2e-05  19%  417 aa  YFIS_BACSU RecName: Full=Uncharacterized MFS-type transporter yfiS;
   48::185     2e-05  23%  729 aa  MSSP3_ARATH RecName: Full=Monosaccharide-sensing protein 3;AltName:
   25::189     2e-05  21%  394 aa  EMRD_ECOLI RecName: Full=Multidrug resistance protein D;
   66::189     2e-05  24%  194 aa  BBEX_BACSU RecName: Full=Bacillibactin exporter;
   36::149     3e-05  23%  382 aa  YCAD_SALG2 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   36::149     3e-05  23%  382 aa  YCAD_SALDC RecName: Full=Uncharacterized MFS-type transporter ycaD;
  145::280     3e-05  20%  586 aa  AQR1_YEAST RecName: Full=Probable transporter AQR1;
   78::246     3e-05  23%  506 aa  SVOPL_DANRE RecName: Full=Putative transporter SVOPL;AltName:
   41::149     4e-05  25%  392 aa  YUXJ_BACSU RecName: Full=Uncharacterized MFS-type transporter
  342::481     4e-05  25%  515 aa  VMAT2_RAT RecName: Full=Synaptic vesicular amine
   55::198     6e-05  22%  455 aa  UHPT_CHLPN RecName: Full=Probable hexose phosphate transport
  106::255     6e-05  28%  540 aa  GTR9_HUMAN RecName: Full=Solute carrier family 2, facilitated
  181::297     6e-05  20%  564 aa  BMRP_CANAL RecName: Full=Benomyl/methotrexate resistance protein;
   65::149     8e-05  22%  382 aa  Y1421_ENT38 RecName: Full=Uncharacterized MFS-type transporter
  151::268     8e-05  25%  659 aa  TPO4_YEAST RecName: Full=Polyamine transporter 4;
  158::229     8e-05  26%  492 aa  S17A4_MOUSE RecName: Full=Putative small intestine sodium-dependent
  115::208     1e-04  27%  578 aa  VACHT_DROME RecName: Full=Vesicular acetylcholine transporter;     
  168::272     1e-04  30%  553 aa  S22A2_MOUSE RecName: Full=Solute carrier family 22 member
  275::403     1e-04  27%  405 aa  PMRA_LACLA RecName: Full=Multi-drug resistance efflux pump pmrA
  106::255     1e-04  27%  566 aa  GTR9_PONAB RecName: Full=Solute carrier family 2, facilitated
  320::513     1e-04  24%  580 aa  FSLK_DICDI RecName: Full=Frizzled and smoothened-like protein
   71::185     1e-04  24%  405 aa  YJHB_ECOLI RecName: Full=Putative metabolite transport protein
   55::186     1e-04  23%  456 aa  UHPT_CHLTR RecName: Full=Probable hexose phosphate transport
   74::222     1e-04  20%  526 aa  SPNS1_XENLA RecName: Full=Protein spinster homolog 1;
   72::238     1e-04  24%  495 aa  PLST3_ARATH RecName: Full=Probable plastidic glucose transporter 3;
  276::397     1e-04  27%  418 aa  OXLT_OXAFO RecName: Full=Oxalate:formate antiporter;       
   89::264     1e-04  18%  512 aa  ANTR1_ARATH RecName: Full=Sodium-dependent phosphate transport
  127::243     2e-04  22%  586 aa  HOL1_YEAST RecName: Full=Protein HOL1;
  155::287     2e-04  25%  541 aa  YN22_SCHPO RecName: Full=Uncharacterized transporter C530.02;
  344::483     2e-04  23%  517 aa  VMAT2_MOUSE RecName: Full=Synaptic vesicular amine
  344::483     2e-04  23%  517 aa  VMAT2_BOVIN RecName: Full=Synaptic vesicular amine
   66::197     2e-04  24%  433 aa  TUB4_AGRVI RecName: Full=Putative tartrate transporter;
  102::219     2e-04  27%  467 aa  NPT1_HUMAN RecName: Full=Sodium-dependent phosphate transport
   68::124     2e-04  30%  403 aa  MHPT_ECOLI RecName: Full=Putative 3-hydroxyphenylpropionic acid
  255::361     2e-04  25%  398 aa  LTAA_STAS1 RecName: Full=Probable glycolipid permease ltaA;AltName:
    6::202     3e-04  19%  448 aa  YQ92_SCHPO RecName: Full=Uncharacterized MFS-type transporter
  151::323     3e-04  21%  534 aa  YMPB_CAEEL RecName: Full=Putative transporter B0361.11;
   71::165     3e-04  24%  400 aa  YCEI_BACSU RecName: Full=Putative metabolite transport protein
  341::480     3e-04  23%  514 aa  VMAT2_HUMAN RecName: Full=Synaptic vesicular amine
   83::214     3e-04  22%  449 aa  TUB3_AGRVI RecName: Full=Putative tartrate transporter;
   36::172     3e-04  24%  419 aa  CMLA_PSEAE RecName: Full=Chloramphenicol resistance protein;
   36::177     4e-04  18%  412 aa  YWFA_BACSU RecName: Full=Uncharacterized MFS-type transporter ywfA;
  123::262     4e-04  25%  542 aa  YIQ6_YEAST RecName: Full=Uncharacterized transporter YIL166C;
   99::192     4e-04  21%  402 aa  YDGK_BACSU RecName: Full=Uncharacterized MFS-type transporter ydgK;
   69::193     4e-04  23%  394 aa  Y411_BUCBP RecName: Full=Uncharacterized transporter bbp_411;
   46::153     4e-04  20%  382 aa  Y2680_YERPY RecName: Full=Uncharacterized MFS-type transporter
   46::153     4e-04  20%  382 aa  Y2592_YERP3 RecName: Full=Uncharacterized MFS-type transporter
   46::153     4e-04  20%  382 aa  Y2315_YERPP RecName: Full=Uncharacterized MFS-type transporter
   46::153     4e-04  20%  382 aa  Y1506_YERPB RecName: Full=Uncharacterized MFS-type transporter
   46::153     4e-04  20%  382 aa  Y1405_YERPS RecName: Full=Uncharacterized MFS-type transporter
   46::153     4e-04  20%  382 aa  Y1380_YERPE RecName: Full=Uncharacterized MFS-type transporter
  147::274     4e-04  21%  558 aa  XYLL3_ARATH RecName: Full=D-xylose-proton symporter-like 3;
   92::208     4e-04  24%  514 aa  SPNS3_MOUSE RecName: Full=Protein spinster homolog 3;
  167::277     4e-04  24%  554 aa  S22A1_RABIT RecName: Full=Solute carrier family 22 member
   77::191     4e-04  29%  509 aa  GTR4_HUMAN RecName: Full=Solute carrier family 2, facilitated
  115::245     4e-04  22%  512 aa  ANTR3_ARATH RecName: Full=Probable anion transporter 3,
   44::169     5e-04  22%  391 aa  Y450_BUCAP RecName: Full=Uncharacterized transporter BUsg_450;
  164::243     5e-04  25%  495 aa  S17A5_SHEEP RecName: Full=Sialin;AltName: Full=Solute carrier
   96::251     8e-04  18%  520 aa  YOU1_CAEEL RecName: Full=Putative transporter ZK637.1;
  187::251     8e-04  28%  514 aa  YHK8_YEAST RecName: Full=Uncharacterized transporter YHR048W;
  232::360     8e-04  22%  391 aa  YFKF_BACSU RecName: Full=Uncharacterized MFS-type transporter yfkF;
   55::186     8e-04  23%  456 aa  UHPT_CHLMU RecName: Full=Probable hexose phosphate transport
  123::236     8e-04  20%  524 aa  PLST1_ARATH RecName: Full=Probable plastidic glucose transporter 1;
  169::386     8e-04  28%  500 aa  NU4C_NEPOL RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  132::264     8e-04  22%  531 aa  MFS1_SCHPO RecName: Full=Transporter mfs1;
    1::509

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxNTITVGFWSQKRTIVXXXXXXXXXXEIVDLTIVAVAIPQIMGAIGANVETIADVTTVYIVTAAIFI
EMRB_ECOLI      -----------------------------QVLDSTIANVAIPTIAGNLGSSLSQGTWVITSFGVANAISI
EMRB_ECO57      -----------------------------QVLDSTIANVAIPTIAGNLGSSLSQGTWVITSFGVANAISI
EMRB_HAEIN      -----------------------------QVLDSTIANVAIPTIAGDLGASFSQGTWVITSFGVANAISI
EMRY_ECOLI      -----------------------------QMLDSTISNVAIPTISGFLGASTDEGTWVITSFGVANAIAI
MDTD_YERPY      -----------------------------QTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVML
MDTD_YERPP      -----------------------------QTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVML
MDTD_YERPN      -----------------------------QTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVML
MDTD_YERPG      -----------------------------QTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVML
MDTD_YERPE      -----------------------------QTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVML
MDTD_YERPB      -----------------------------QTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVML
MDTD_YERPA      -----------------------------QTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVML
MDTD_YERP3      -----------------------------QTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVML
BMR3_BACSU      -------------------------------MDNTIVATAMGNIVADLGS-FDKFAWVTASYMVAVMAGM
MDTD_YERPS      -----------------------------QTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVML
MDTD_PECCP      -----------------------------QTLDTTIVNTALPSMAASLNESPLHMHSVIVSYVLTVAVML
MDTD_SERP5      -----------------------------QTLDTTIVNTALPSMAVSLGENPLRMQSVIVSYVLTVAVML
MDTD_YERE8      -----------------------------QTLDTTIVNTALPSMAASLGENPLRMQSVIVSYVLTVAVML
YHCA_BACSU      ------------------------------ILNQTLLNVAMPHLMTEFGVSATTIQWLTTGYMLVNGVLI
YEBQ_ECOLI      ------------------------------VLDGAIANVALPTIATDLHATPASSIWVVNAYQIAIVISL
LMRB_LISIN      ----------------------------------------------------------------------
MDTD_ECOL6      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_ECO81      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
LMRB_LISMO      ----------------------------------------------------------------------
MDTD_SHIF8      -------------------------------LDTTIVNTAIPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_ESCF3      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_ECOUT      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_ECOLU      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_ECOK1      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_ECO45      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_SHISS      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_SHIFL      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_SHIBS      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_SHIB3      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_ECOSM      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_ECOSE      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_ECOLI      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_ECOLC      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_ECOL5      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_ECOHS      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_ECODH      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_ECOBW      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_ECO8A      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_ECO7I      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_ECO5E      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_ECO57      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_ECO55      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_ECO27      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_ECO24      -------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVML
MDTD_CITK8      -------------------------------LDTTIVNTALPSMALSLGESPLHMHMVVVSYVLTVAVML
MDTD_SALSV      -------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVML
SGE1_YEAST      -----------------------------------VIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFM
HSRA_ECOLI      -----------------------------QALDATILNTALPAIAHSLNRSPLAMQSAIISYTLTVAMLI
MDTD_SALTI      -------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVML
MDTD_SALPK      -------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVML
MDTD_SALPB      -------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVML
MDTD_SALPA      -------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVML
MDTD_SALNS      -------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVML
MDTD_SALHS      -------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVML
MDTD_SALEP      -------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVML
MDTD_SALDC      -------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVML
MDTD_SALA4      -------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVML
MDTD_SALTY      -------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVML
MDTD_ERWCT      -----------------------------QTLDTTIVNTALPSMAASLNESPLHMHSVIVSYVLTVAVML
MDTD_ENT38      -------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVIVSYVLTVAVML
TCMA_STRGA      --------------------------------DSTIVAIANPAIQQDLHASLADVQWITNGYLLALAVSL
LMRB_BACSU      ----------------------------------TALNIALTDLMKELNITAATVQWLTTGYLLVLGILV
YUSP_BACSU      --------------KRTLLITGLIIAMFFSALDGTIVGTAMPKIVGDLGG-LSMMTWLTTAYLLTSTTIV
HSRA_HAEIN      -------------------------------LDATILNTALPAISSDLHKPAFEMQMAIIAYSLAVALFI
YCNB_BACSU      ---------------RSVIVGILLAGAFVAILNQTLLITALPHIMRDFNVDANQAQWLTTSFMLTNGILI
QACA_STAAU      -------------------------------MDMTILIMALPELVRELEPSGTQQLWIVDIYSLVLAGFI
QACA_STAAM      -------------------------------MDMTILIMALPELVRELEPSGTQQLWIVDIYSLVLAGFI
MDTD_ENTS8      -----------------------------QALDTTIVNTALPSMAASLGESPLRMHMVIVSYVLTVAVML
MDTD_KLEP3      -------------------------------LDTTIVNTALPSMAKSLGESPLHMHMIIVSYVLTVAVML
MDTD_KLEP7      -------------------------------LDTTIVNTALPSMAKSLGESPLHMHMIIVSYVLTVAVML
YFIU_BACSU      -------------------------------LDNGIISAALTTINESFSVSPSWGSWGITLYTLGLSVSV
BAIG_EUBSP      ----------------------------------------------------------------------
YJA1_SCHPO      ---------------------------------------------------------ILSIYLLVFAISP
YAN6_SCHPO      ---------------------------------------------------------IGTAYTLAQTSIL
VBA5_YEAST      -------------------------------LDILIVGTIIDVVAEQFG-NYSKTGWLVTGYSLPNAILS
MMR_STRCO       -------------------------------LDVTVVNVAGATIQESLDTTLTQLTWIVDGYVLTFASLL
TCR_STRPN       ------------------------------VLNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGT
TCR_BACSU       ------------------------------VLNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGT
TCR_BACST       ------------------------------VLNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGT
TCR_BACCE       ------------------------------VLNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGT
MDTL_SALAR      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYLAGMATAM
YI32_SCHPO      ---------------------------------------------------------IGTAYSLAETSIL
MDTM_ECOLI      -----------------------------------LIQPGIINVVRDFNADVSLAPAAVSLYLAGGMALQ
MDTM_ECO57      -----------------------------------LIQPGIINVVRDFNADVSLAPAAVSLYLAGGMALQ
YVKA_BACSU      -------------------------------INSTMIAVALSSISHTYNESIASITWVVTVYLIVMAVTQ
YCT4_SCHPO      -----------------------------------------------VGATVGDLCSAT--FLLGFAAGS
TCR_STRAG       ------------------------------VLNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGT
MDTL_SALPK      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYLAGMATAM
MDTL_SALPA      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYLAGMATAM
MDTL_SALEP      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYLAGMATAM
MDTL_SALDC      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYLAGMATAM
MDTL_SALTI      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYLAGMATAM
TCRB_BACSU      ------------------------------VLNEMVLNVSLPDIANEFNKLPASANWVNTAFMLTFSIGT
MDTL_SALTY      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYLAGMATAM
MDTL_SALPC      --------------------------------------VGLPRIAVDLNASESQLHIAFSVYLAGMATAM
MDTL_SALPB      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYLAGMATAM
MDTL_SALNS      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYLAGMATAM
MDTL_SALHS      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYLAGMATAM
MDTL_SALCH      --------------------------------------VGLPRIAVDLNASESQLHIAFSVYLAGMATAM
MDTL_SALA4      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYLAGMATAM
AZR1_YEAST      --------------------------------DIMIVSTIIEEVAKQFGSYSE-IGWLFTGYSLPNALLA
MDTL_SALSV      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYLAGMATAM
MMR_BACSU       -------------------------------LDVTVVNVAMADMKNTLSMSLSGVTWVVDGYILTFXXXX
MDTL_VIBPA      ---------------------------------IDLYLVGLPQIASDLNASESQLHIAFSVYLAGMATTM
YHX6_SCHPO      --------------------------------DNTIVASTYTKI-GAEFGKFSQVSWTATAYMISCTAFQ
YHD3_SCHPO      -------------------------------------------------------------YSLTVGTFI
TCR_STAHY       ------------------------------VLNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGT
MDTL_ECOL6      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_ECO81      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
ATR1_YEAST      --------------------------------------------------------------------FI
ACT22_STRCO     -----------------------------DLLDGTVMNVAAPAVRADLGGSLSVIQWITVGYTLAFAVLL
MDTL_ECOL5      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_ECO27      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_ECOUT      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_ECOK1      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_ECO45      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
YN42_SCHPO      -----------------------------------------------------------TVSLLTMTVFL
MDTL_KLEP3      --------------------------------------VGLPRIAQDLGASEAQLHIAFSVYLAGMASAM
MDTL_ESCF3      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_ECOSM      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_ECOLU      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
CMCT_NOCLA      ------------------------------VFDTSVITVALPSVRADLGFAPASLQWVVNSYTXXXXXXX
MDTL_SHISS      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_SHIFL      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_SHIF8      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_SHIBS      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_SHIB3      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_ECOSE      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_ECOLI      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_ECOLC      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_ECOHS      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_ECODH      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_ECOBW      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_ECO8A      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_ECO7I      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_ECO55      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_ECO24      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_CITK8      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYLAGMATAM
MDTL_SHIDS      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_ECO5E      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
MDTL_ECO57      --------------------------------------VGLPRIAADLNASEAQLHIAFSVYXXXXXXXX
YFMO_BACSU      -----------------------------------LVDPILPAIAAQLHASPSEVSLLFTSYLLVTGFMM
PHDK_NOCSK      -------------------------------MDITLASHLFPPVIRDWGVPVSAVTLVVSLGVVAMAIGA
YBIH_SCHPO      -------------------------------LDNTIVTTALPTIAEDFN-DTSSSSWIGSAYVLASNAVL
YWOG_BACSU      ----------------------------------------------------------------------
MDFA_ECOLI      -------------------------------------------------AGIDWVPTSMTAYLAGGMFLQ
MDFA_ECOL6      -------------------------------------------------AGIDWVPTSMTAYLAGGMFLQ
MDFA_ECO57      -------------------------------------------------AGIDWVPTSMTAYLAGGMFLQ
YQO5_SCHPO      -----------------------------------------------------------TVSLLTMTVFL
MDTL_KLEP7      --------------------------------------VGLPRIAQDLGASEAQLHIAFSVYLAGMASAM
YN41_SCHPO      ----------------------------------------------------------------------
VBA2_YEAST      ---------------------------------------------------------ITTAYLITSTSFQ
BCR_HAEIN       ------------------------------------------EIAKDLDVSPEQVQHTLTSFAYGMAFGQ
YN43_SCHPO      -----------------------------------------------------------SLYVCGFASGP
YDHC_ECOLI      ----------------------------------------------------------------------
NANT_SALTY      --------------------------------DFVLIALVLTEVQSEFGLTTVQAASLISAAFISRWFGG
NANT_SALTI      --------------------------------DFVLIALVLTEVQSEFGLTTVQAASLISAAFISRWFGG
NANT_SALSV      --------------------------------DFVLIALVLTEVQSEFGLTTVQAASLISAAFISRWFGG
NANT_SALPK      --------------------------------DFVLIALVLTEVQSEFGLTTVQAASLISAAFISRWFGG
NANT_SALPC      --------------------------------DFVLIALVLTEVQSEFGLTTVQAASLISAAFISRWFGG
NANT_SALPB      --------------------------------DFVLIALVLTEVQSEFGLTTVQAASLISAAFISRWFGG
NANT_SALPA      --------------------------------DFVLIALVLTEVQSEFGLTTVQAASLISAAFISRWFGG
NANT_SALNS      --------------------------------DFVLIALVLTEVQSEFGLTTVQAASLISAAFISRWFGG
NANT_SALHS      --------------------------------DFVLIALVLTEVQSEFGLTTVQAASLISAAFISRWFGG
NANT_SALG2      --------------------------------DFVLIALVLTEVQSEFGLTTVQAASLISAAFISRWFGG
NANT_SALEP      --------------------------------DFVLIALVLTEVQSEFGLTTVQAASLISAAFISRWFGG
NANT_SALDC      --------------------------------DFVLIALVLTEVQSEFGLTTVQAASLISAAFISRWFGG
NANT_SALCH      --------------------------------DFVLIALVLTEVQSEFGLTTVQAASLISAAFISRWFGG
NANT_SALAR      --------------------------------DFVLIALVLTEVQSEFGLTTVQAASLISAAFISRWFGG
NANT_ESCF3      --------------------------------DFVLIALVLTEVQGEFGLTTVQAASLISAAFISRWFGG
NANT_CITK8      --------------------------------DFVLIALVLTEVQGEFGLTTVQAASLISAAFISRWFGG
YYBF_BACSU      ---------------------------------------------------------VTTMLL---AVSM
YO378_YEAST     --------------------------------------------------NAGQLSWFASAYSLTVGTFI
YWOD_BACSU      ----------------------------------SMISLALHSIQHEFHLSFTTVSWLISSFYLASAVAQ
Y466_BUCAI      ------------------------------------------------GGNKFLIGLSMGIYGISQVIFQ
NANT_SHIFL      --------------------------------DFVLIALVLTEVQGEFGLTTVQAASLISAAFISRWFGG
NANT_SHIF8      --------------------------------DFVLIALVLTEVQGEFGLTTVQAASLISAAFISRWFGG
NANT_SHIB3      --------------------------------DFVLIALVLTEVQGEFGLTTVQAASLISAAFISRWFGG
NANT_ECOSM      --------------------------------DFVLIALVLTEVQGEFGLTTVQAASLISAAFISRWFGG
NANT_ECOSE      --------------------------------DFVLIALVLTEVQGEFGLTTVQAASLISAAFISRWFGG
NANT_ECOLI      --------------------------------DFVLIALVLTEVQGEFGLTTVQAASLISAAFISRWFGG
NANT_ECOLC      --------------------------------DFVLIALVLTEVQGEFGLTTVQAASLISAAFISRWFGG
NANT_ECOL5      --------------------------------DFVLIALVLTEVQGEFGLTTVQAASLISAAFISRWFGG
NANT_ECOHS      --------------------------------DFVLIALVLTEVQGEFGLTTVQAASLISAAFISRWFGG
NANT_ECODH      --------------------------------DFVLIALVLTEVQGEFGLTTVQAASLISAAFISRWFGG
NANT_ECOBW      --------------------------------DFVLIALVLTEVQGEFGLTTVQAASLISAAFISRWFGG
NANT_ECO8A      --------------------------------DFVLIALVLTEVQGEFGLTTVQAASLISAAFISRWFGG
NANT_ECO7I      --------------------------------DFVLIALVLTEVQGEFGLTTVQAASLISAAFISRWFGG
NANT_ECO5E      --------------------------------DFVLIALVLTEVQGEFGLTTVQAASLISAAFISRWFGG
NANT_ECO57      --------------------------------DFVLIALVLTEVQGEFGLTTVQAASLISAAFISRWFGG
NANT_ECO55      --------------------------------DFVLIALVLTEVQGEFGLTTVQAASLISAAFISRWFGG
NANT_ECO45      --------------------------------DFVLIALVLTEVQGEFGLTTVQAASLISAAFISRWFGG
NANT_ECO27      --------------------------------DFVLIALVLTEVQGEFGLTTVQAASLISAAFISRWFGG
NANT_ECO24      --------------------------------DFVLIALVLTEVQGEFGLTTVQAASLISAAFISRWFGG
NANT1_ECOL6     --------------------------------DFVLIALVLTEVQGEFGLTTVQAASLISAAFISRWFGG
YB30_YEAST      ---------------------------------------ALPLLQREYDVSATTINATVSVFMAVFSVGP
TCR_STAES       ----------------------------------------------------------------------
TCR_STAAU       ----------------------------------------------------------------------
SPIN_DROME      -----------------------------------------------------------TVFVISYMVCA
YN2F_SCHPO      ----------------------------------SIFSGAVPEVMVKFHVCRTVALLGISLYVLGFASGP
SMVA_SALTY      -------------------------------IDATVLHVAAPTLSMTLGASGNELLWIIDIYSLVMAGMV
MIRC_EMENI      ----------------------------------------------------------------------
YYAJ_BACSU      -----------------------------DLADLFTLSNVAPALIEHWGIPLSTIANVTAASFLGMFLGA
FNX1_SCHPO      -------------------------------LDMTIVASLYP-VIGSEFKLMNNASYIVTAYLITNTAFQ
YHA8_SCHPO      -----------------------------------------------------------SLMVVGFGIGP
YWTG_BACSU      --------------------------------DTGVISGAILFMKKELGLNAFTEGLVVSSLLVGAILGS
Y588_BUCAI      ---------------------------------------------------------------ITMSLGM
PCAK_ACIAD      -------------------------------IDTAAMGFIAPALAQDWGVDRSQLGPVMSAALGGMIIGA
NANT_YERPY      --------------------------------DFVLITLVLTDIKQEFGLTLIQATSLISAAFISRWFGG
BCR_ECOLI       ---------------------------------------ALPVISAQFGVPAGSTQMTLSTYILGFALGQ
BENK_ACIAD      --------------------------------DLVIYGVALPLLM-----KEWAIDPVTAGFIGSIALFG
YM8M_YEAST      ---------------------------------------------------------------LAAGSFI
MDTM_SALTY      --------IQFFSQRATTLFFPMALILYDFAAYLTLIQPGIINVVRDFNADVSLAPASVSLYLAGGMALQ
MDTM_SALTI      --------IQFFSQRATTLFFPMALILYDFAAYLTLIQPGIINVVRDFNADVSLAPASVSLYLAGGMALQ
NANT_YERPS      --------------------------------DFVLITLVLTDIKQEFGLTLIQATSLISAAFISRWFGG
NANT_YERPP      --------------------------------DFVLITLVLTDIKQEFGLTLIQATSLISAAFISRWFGG
NANT_YERPG      --------------------------------DFVLITLVLTDIKQEFGLTLIQATSLISAAFISRWFGG
NANT_YERPB      --------------------------------DFVLITLVLTDIKQEFGLTLIQATSLISAAFISRWFGG
NANT_YERP3      --------------------------------DFVLITLVLTDIKQEFGLTLIQATSLISAAFISRWFGG
NANT2_ECOL6     --------------------------------DFVLISLVLTEVQHEFGLTTIEAASLISAAFISRWFGG
GALP_ECOLI      --------------------------------DIGVIAGALPFIADEFQITSHTQEWVVSSMMFGAAVGA
GALP_ECOL6      --------------------------------DIGVIAGALPFIADEFQITSHTQEWVVSSMMFGAAVGA
YVMA_BACSU      -----------------------------------IYSPILPIIKESFHVSTAMVNLSVSVFMIVTAIMQ
YUBD_BACSU      -------------------------------------------VQKTVGTSVFTSVNPILIGNMAFALLV
YHJO_BACSU      -----------------------------------------------------------TIYSAAKALFV
TPO1_YEAST      ----------------------------------SIFASAVPQIC-EIYHVIEVVAILITLFVLGFAASP
NANT_YERPE      --------------------------------DFVLITLVLTDIKQEFGLTLIQATSLISAAFISRWFGG
NANT_YERPA      --------------------------------DFVLITLVLTDIKQEFGLTLIQATSLISAAFISRWFGG
MDTL_SHESA      --------------------------------------VGLPQIANQLGATEAQLHIAFSVYLAGMATTM
CSBC_BACSU      --------------------------------DTGVISGALLFINNDIPLTTLTEGLVVSMLLLGAIFGS
Y567_BUCAP      ------------------------------------------------------------------SIGT
NANT_SALA4      --------------------------------DFVLIALVLTEVQSEFGLTTVQAASLISAAFISRWFGG
YCEJ_BACSU      ---------------------------------------------------------MVSAYALGYALFA
VBA3_YEAST      ----------------------------------------------------------------------
TPO3_YEAST      ----------------------------------------------------------------------
BCRH_RICTY      ----------------------------------------------------------STLYFLGFAVGI
ARAE_KLEOX      -------------------------------LDIGVIAGALPFITDHFVLSSRLQEWVVSSMMLGAAIGA
EXUT_BACSU      -------------------------------LDRSALSIAAPFIQDDLTLSATQMGLIFSSFSIGYAIFN
ARAE_ECOLI      -------------------------------LDIGVIAGALPFITDHFVLTSRLQEWVVSSMMLGAAIGA
ARAE_ECO57      -------------------------------LDIGVIAGALPFITDHFVLTSRLQEWVVSSMMLGAAIGA
Y2171_CITK8     ---------------------------------------------------------VSSSYFTGNLVGT
SVOPL_HUMAN     -----------------------------EAMEIMLIAVVSPVIRCEWQLENWQVALVTTMVFFGYMVFS
MDTL_SHEON      --------------------------------------VGLPQIASQLGASEAQLHIAFSVYLAGMATTM
TPO2_YEAST      ----------------------------------------------------------------------
NANT_ENTS8      --------------------------------DFVLIALVLTEIQDEFGLTTIQAASLISAAFISRWFGG
BSU1_SCHPO      -----------------------------------------------VSAQVATLC--LSMNILGSGLGP
YCAD_SHIFL      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_SHIF8      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_SALTY      -------------------------------------------------ANLPTVGMVSSSYFTGNLVGT
YCAD_SALTI      -------------------------------------------------ANLPTVGMVSSSYFTGNLVGT
YCAD_SALSV      -------------------------------------------------ANLPTVGMVSSSYFTGNLVGT
YCAD_SALPK      -------------------------------------------------ANLPTVGMVSSSYFTGNLVGT
YCAD_SALPC      -------------------------------------------------ANLPTVGMVSSSYFTGNLVGT
YCAD_SALPA      -------------------------------------------------ANLPTVGMVSSSYFTGNLVGT
YCAD_SALNS      -------------------------------------------------ANLPTVGMVSSSYFTGNLVGT
YCAD_SALHS      -------------------------------------------------ANLPTVGMVSSSYFTGNLVGT
YCAD_SALCH      -------------------------------------------------ANLPTVGMVSSSYFTGNLVGT
YCAD_SALA4      -------------------------------------------------ANLPTVGMVSSSYFTGNLVGT
CYHR_CANMA      ----------------------------------------------------------------------
BCRH_RICPR      ----------------------------------TIYTSGLPSLTRCFSIDGCITQMTSTLYFLGFAVGI
YCAD_ESCF3      ---------------------------------------------------------VSSSYFTGNLVGT
S17A5_MOUSE     ----------------------------------------------------------------------
MUCK_ACIAD      --------------------------------DLMLLSYSLNSIKAEFNLSTVEAGMLGSFTLAGMAIGG
YCAD_SHISS      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_SHIDS      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_ECOUT      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_ECOSM      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_ECOSE      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_ECOLU      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_ECOLI      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_ECOLC      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_ECOL6      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_ECOL5      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_ECOK1      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_ECOHS      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_ECODH      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_ECOBW      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_ECO8A      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_ECO81      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_ECO7I      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_ECO5E      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_ECO57      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_ECO55      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_ECO45      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_ECO27      ---------------------------------------------------------VSSSYFTGNLVGT
YCAD_ECO24      ---------------------------------------------------------VSSSYFTGNLVGT
SPNS1_DANRE     -------------------------------MDRFTVAGVLPDIEHFFGIGDGTSGLLQTVFICSYMFLA
YITG_BACSU      ----------------------------------------LPKMKSELHLSQFQVSLVITVFSLIAAFAI
YCAD_SALEP      -------------------------------------------------ANLPTVGMVSSSYFTGNLVGT
VACHT_DANRE     ----------------------------------------------------------------------
PMRA_STRR6      ----------------------------------------------------------------------
PMRA_STRPN      ----------------------------------------------------------------------
BMR2_BACSU      -----------------------------------LIIPVMPSFMKIMHLSGSTMGYLVAAFAISQLITS
YCAD_SALPB      -------------------------------------------------ANLPTVGMVSSSYFTGNLVGT
MDTD_SHIDS      ----------------------------------------------------------------------
YCAD_SALAR      ---------------------------------------------------------VSSSYFTGNLVGT
SVOPL_MOUSE     -----------------------------EAMEIMLIAVVSPVIRCEWQLENWQVAFVTTMVFFGYMVSS
S17A5_HUMAN     -------------------------------------------------------------YIITQ----
DGOT_ECOLI      -------------------------------VDRANLAVASAHIQEEFGITKAEMGYVFSAFAWLYTLCQ
DGOT_ECOL6      -------------------------------VDRANLAVASAHIQEEFGITKAEMGYVFSAFAWLYTLCQ
YAJR_ECOLI      ----------------------------------------------------------------TQAVFQ
Y1560_METJA     ----------------------------------------------------------------------
S22A2_RAT       --------------------------------------------------------------VVNVGFFI
ITR2_SCHPO      ---------------------------------------------------------ITSATSFAALISA
YFIS_BACSU      ----------------------------------------------------------------------
MSSP3_ARATH     ---------------------------------------------------------IVAMSLIGATLIT
EMRD_ECOLI      ----------------------------------TIYIPAIADMARDLNVREGAVQSVMGAYLLTYGVSQ
BBEX_BACSU      ----------------------------------------------------------------------
YCAD_SALG2      -------------------------------------------------ANLPTVGMVSSSYFTGNLVGT
YCAD_SALDC      -------------------------------------------------ANLPTVGMVSSSYFTGNLVGT
AQR1_YEAST      -------------------------------------------------------------YLLFQGISP
SVOPL_DANRE     -----------------------------EAMEIMLLAVVSPEIRCEWHLEDWQVALVSTMVFFGFMVCG
YUXJ_BACSU      ------------------------------------------------------------VFGITFLMAF
VMAT2_RAT       -------------------------------------------------------------YLIGTNIF-
UHPT_CHLPN      ---------------------------------------AMPTLIADLGFDKAQLGIIGSTLYFSYGISK
GTR9_HUMAN      ---------------------------------------------------------LTLLWSVTVSIFA
BMRP_CANAL      ----------------------------------------------------------------------
Y1421_ENT38     ----------------------------------------------------------------------
TPO4_YEAST      ----------------------------------------------------------------------
S17A4_MOUSE     ----------------------------------------------------------------------
VACHT_DROME     ----------------------------------------------------------------------
S22A2_MOUSE     ----------------------------------------------------------------------
PMRA_LACLA      ----------------------------------------------------------------------
GTR9_PONAB      ---------------------------------------------------------LTLLWSVTVSIFA
FSLK_DICDI      ----------------------------------------------------------------------
YJHB_ECOLI      ----------------------------------------------------------------------
UHPT_CHLTR      ---------------------------------------AMPTLIADLGFDKAQLGIIGSTLYITYGISK
SPNS1_XENLA     -------------------------------MDRFTVAGVLPDIKKAFNISDSNSGLVQTVFICSYMFLA
PLST3_ARATH     ---------------------------------LGVVNETLESISIDLGFSGNTIAEGLVVSTCLGGAFI
OXLT_OXAFO      ----------------------------------------------------------------------
ANTR1_ARATH     ----SSIVLPWWEEKRWVIVLLCFSAFLLCNMDRVNMSIAILPMSAEYGWNPATVGLIQSSFFWGYLLTQ
HOL1_YEAST      ----------------------------------------------------------------------
YN22_SCHPO      --------------------------------------------------------------------FA
VMAT2_MOUSE     -------------------------------------------------------------YLIGTNIF-
VMAT2_BOVIN     -------------------------------------------------------------YLIGTNVF-
TUB4_AGRVI      -------------------------------------------------------------------LFE
NPT1_HUMAN      ----------------------------------------------------------------------
MHPT_ECOLI      ----------------------------------------------------------------------
LTAA_STAS1      ---------------------------------------------------------------IGCAISM
YQ92_SCHPO      -----------WVKQRRSLPFIIGTIAIALFTDLFLYGIITPSLVDRVGISPDRVQSVISTLLAVYAVAN
YMPB_CAEEL      -----------------------------------------------------------TIFTIGAVIAV
YCEI_BACSU      ----------------------------------------------------------------------
VMAT2_HUMAN     -------------------------------------------------------------YLIGTNIF-
TUB3_AGRVI      -------------------------------------------------------------------LFE
CMLA_PSEAE      ---------------------------------------AVPFMPNALGXXXXXXXXXXXXYLVMIGAGQ
YWFA_BACSU      -----------------------------------VISPLLPDLAKAFSSDVSVLALSISIYGVMIFIGA
YIQ6_YEAST      -----------------------------------------------------------TVYLVIFLASE
YDGK_BACSU      ----------------------------------------------------------------------
Y411_BUCBP      ----------------------------------------------------------------------
Y2680_YERPY     ---------------------------------------------------------VSSSYFTGNLVGT
Y2592_YERP3     ---------------------------------------------------------VSSSYFTGNLVGT
Y2315_YERPP     ---------------------------------------------------------VSSSYFTGNLVGT
Y1506_YERPB     ---------------------------------------------------------VSSSYFTGNLVGT
Y1405_YERPS     ---------------------------------------------------------VSSSYFTGNLVGT
Y1380_YERPE     ---------------------------------------------------------VSSSYFTGNLVGT
XYLL3_ARATH     --------------------------------------------------------------VVSGSLYG
SPNS3_MOUSE     -----------------------------------------------------------TVFISCLLVSA
S22A1_RABIT     ----------------------------------------------------------------------
GTR4_HUMAN      ---------------------------------------------------------LTTLWALSVAIFS
ANTR3_ARATH     --------------------------------DRVVMSVAVVPLADKLGWSSSFLGVVQSSFLWGYIFSS
Y450_BUCAP      ------------------------------------------------GGNKFLIGLAVGIYGATQIVFQ
S17A5_SHEEP     ----------------------------------------------------------------------
YOU1_CAEEL      -----------------------------DAMEMMLLSLISPALACEWGISSVQQALVTTCVFSGMMLSS
YHK8_YEAST      ----------------------------------------------------------------------
YFKF_BACSU      -----------------------------------------------LGISVDAVAIILPAFAIGSIIFQ
UHPT_CHLMU      ---------------------------------------AMPTLIADLGFDKAQLGIIGSTLYITYGISK
PLST1_ARATH     ---------------------------------------------------------VVSIFIAGAFIGS
NU4C_NEPOL      ------------------------------------------------------------LYTALGSIFI
MFS1_SCHPO      -------------------------------------------------------------YAVGPLIFS


                         .         .         *         .         .         .         .:140
query           LLSGLIIEKYGIKRVALVSSVIFGISSIMCGLSTSLAEMIVFRAFQGMGGAFLPSVAQTYISTSFKNEEY
EMRB_ECOLI      PLTGWLAKRVGEVKLFLWSTIAFAIASWACGVSSSLNMLIFFRVIQGIVAGPLIPLSQSLLLNNYPPAKR
EMRB_ECO57      PLTGWLAKRVGEVKLFLWSTIAFAIASWACGVSSSLNMLIFFRVIQGIVAGPLIPLSQSLLLNNYPPAKR
EMRB_HAEIN      PITGWLAKRFGEVRLFLVSTFLFVVSSWLCGIADSLEALIIFRVIQGVAGPVIP-LSQSLLLNNYPPEKR
EMRY_ECOLI      PVTGRLAQRIGEXXXXXXXXXXXXXXXXXXXXXTNLDVLIFFRVVQGLMAGPLIPLSQSLLLRNYPPEKR
MDTD_YERPY      PASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_YERPP      PASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_YERPN      PASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_YERPG      PASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_YERPE      PASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_YERPB      PASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_YERPA      PASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_YERP3      PASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQY
BMR3_BACSU      PIYGKLSDMYGRKRXXXXXXXXXXXXSALCGIAQTMNQLIIFRAIQGIGGGALLPIAFTIIFDLFPPEKR
MDTD_YERPS      PASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGDAMMVPVGRLTVMKIVPREQY
MDTD_PECCP      PASGWLADRIGVKNIFFAAILLFTLGSLLCARSETLNELLASRVIQGIGGAMMVPVGRLTVMKIVPRDQY
MDTD_SERP5      PASGWLADRVGVQRVFFSAIVLFTLGSILCARSETLNELIASRVVQGIGGAMMVPVGRLTVMKIVPREQY
MDTD_YERE8      PASGWLADRVGVKWVFFSAIILFTLGSLLCAQAETLNELISSRVIQGIGGAMMVPVGRLTVMKIVPREQY
YHCA_BACSU      PLSAFLITRFGQRSLFLVAMFCFTLGTLVCGIAPNFSTMLIGRLIQAVGGGILQPLVMTTILLIFPPESR
YEBQ_ECOLI      LSFSFLGDMFGYRRIYKCGLVVFLLSSLFCALSDSLQMLTLARVIQGFGGAALMSVNTALIRLIYPQRFL
LMRB_LISIN      -ISGLLLQWF-TTRGLFFTAVSFSIATLIAALSPTFAMLMIGRVVQAVGTALLLPLMFNTILLIFPEHKR
MDTD_ECOL6      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_ECO81      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
LMRB_LISMO      -ISGLLLQWF-TTRGLFFTAVSFSIATLIAALSPTFAMLMIGRVVQAVGTALLLPLMFNTILLIFPEHKR
MDTD_SHIF8      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_ESCF3      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSATLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_ECOUT      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_ECOLU      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_ECOK1      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_ECO45      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_SHISS      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_SHIFL      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_SHIBS      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_SHIB3      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_ECOSM      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_ECOSE      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_ECOLI      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_ECOLC      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_ECOL5      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_ECOHS      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_ECODH      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_ECOBW      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_ECO8A      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_ECO7I      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_ECO5E      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_ECO57      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_ECO55      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_ECO27      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_ECO24      PASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_CITK8      PASGWLADKVGVRNIFFTAIVLFTLGSLFCAWSSTLNELVLARVLQGVGGAMMVPVGRLTVMKIVPREQY
MDTD_SALSV      PASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVPRAQY
SGE1_YEAST      LLWGRLAEILGTKECLMISVIVFEIGSLISALSNSMATLISGRVVAGFGGSGIESLAFVVGTSIVRENHR
HSRA_ECOLI      PVSGWLADRFGTRRIFTLAVSLFTLGSLACALSNSLPQLVVFRVIQGIGGAMMMPVARLALLRAYPRNEL
MDTD_SALTI      PASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVPRAQY
MDTD_SALPK      PASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVPRAQY
MDTD_SALPB      PASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVPRAQY
MDTD_SALPA      PASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVPRAQY
MDTD_SALNS      PASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVPRAQY
MDTD_SALHS      PASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVPRAQY
MDTD_SALEP      PASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVPRAQY
MDTD_SALDC      PASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVPRTQY
MDTD_SALA4      PASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVPRAQY
MDTD_SALTY      PASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVPRAQY
MDTD_ERWCT      PASGWLADRIGVKNIFFAAILLFTLGSLLCARSETLDELLISRVIQGIGGAMMVPVGRLTVMKIVPRDQY
MDTD_ENT38      PASGWMADKIGVRNIFFTAIVLFTLGSLFCAKADTLNELVMSRVLQGVGGAMMVPVGRLTVMKIVPREQY
TCMA_STRGA      ITAGKLGDRFGHRQTFLVGVAGFAVTSAAIGLSGSVAAIVVFRVLQGLFGALMQPSALGLLRVTFPPGKL
LMRB_BACSU      PVSGLLLQWFTTRQLFTVSLIFSILGTFIXXXXXXXXXXXXXRIVQALGGLLLPLMFNT-ILVIFPPHKR
YUSP_BACSU      PIAGKLADLLGRRIVYVSGLIIFMAASALCGMANNMTELXXXXXXXXXXXXXXXXXXXXXXXDLFTGKQR
HSRA_HAEIN      PLTAWAAAKFGTLTVFRSAVFTFILGSVACAAASNLESLILARVIQGIGGAFMMPVARLAIIQAVPKQQL
YCNB_BACSU      PITAFLIEKFTSRALLITAMSIFTAGTVVGAFAPNFPVLLTARIIQAAGAGIMMPLMQTVFLTIFPIEKR
QACA_STAAU      IPLSAFADKWGRKKALLTGFALFGLVSLAIFFAESAEFVIAIRFLLGIAGALIMPTTLSMIRVIFENKER
QACA_STAAM      IPLSAFADKWGRKKALLTGFALFGLVSLAIFFAESAEFVIAIRFLLGIAGALIMPTTLSMIRVIFENKER
MDTD_ENTS8      PASGWLADRVGVRNIFFTAIVLFTLGSLFCAQSSTLNELVAARVLQGIGGAMMVPVGRLTVMKIVPRDQY
MDTD_KLEP3      PASGWLADRVGVRNIFFTAIVLFTAGSLFCAQASTLDQLVMARVLQGIGGAMMVPVGRLTVMKIVPRDQY
MDTD_KLEP7      PASGWLADRVGVRNIFFTAIVLFTAGSLFCAQASTLDQLVMARVLQGVGGAMMVPVGRLTVMKIVPRDQY
YFIU_BACSU      PIVGKLSDRYGRKKLFLIEVCLFGLGSLLVALSQSFPLFLISRLIQALXXXXXXXXXSSHILATLPKEKQ
BAIG_EUBSP      ---GKLGDVLGRRTTLLLGIVIFAAGNVLTAVATSLIFMLAARFIVGIGTAAISPIVMAYIVTEYPQEET
YJA1_SCHPO      MISAPLSEVFGRRMLLQVGNVIFIVFNMACGLARTKAQMYIFRFLAGFGSATPMGLGSGTISDLFTPDER
YAN6_SCHPO      PFCGIMSEVVGRKIVLYTSIVLFLFGSAMCGAAQNMLWLVLCRAVQGIGGGGITSLVTIVIATPLQTRPY
VBA5_YEAST      LIWGRFASIIGFQHSLILAILIFEAGSLIAALASSMNMLIFGRVVAGVGGSGLQTLCFVIGCTMVGERSR
MMR_STRCO       MLAGGLANRIGAKTVYLWGMGVFFLASLACALAPTAETLIAARLVQGAGAAXXXXXXXXXXXXXXEKRQR
TCR_STRPN       AVYGKLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFFSLLIMARFQGAGAAAFPALVMVVVARYIPKENR
TCR_BACSU       AVYGKLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFFSLLIMARFQGAGAAAFPALVMVVVARYIPKENR
TCR_BACST       AVYGKLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFFSLLIMARFQGAGAAAFPALVMVVVARYIPKENR
TCR_BACCE       AVYGKLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFFSLLIMARFQGAGAAAFPALVMVVVARYIPKENR
MDTL_SALAR      LFAGKIADRSGRKPVAIVGAIVFMMASLLCSQATEGSLFLSGRFLQGVGAGSCYVVAFAILRDTLDERRR
YI32_SCHPO      PFCGIMSEVVGRKIVLYTSIVLFLFGSAMCGAAQNMLWLVLCRAVQGIGGGGIMSLVTIVIATPLQTRPY
MDTM_ECOLI      WLLGPLSDRIGRRPVLITGALIFTLACAATMFTTSMTQFLIARAIQGTSICFIATVGYVTVQEAFGQTKG
MDTM_ECO57      WLLGPLSDRIGRKPVLITGALIFTLACAATMFTTSMTQFLIARAIQGTSICFIATVGYVTVQEAFGQTKG
YVKA_BACSU      PIAGKLGDMYGNKTMYLWGVGLFLIAXXXXXXXXXXXXXIVFRALQAVGGALLTPNSIAIIRHVVSEKRL
YCT4_SCHPO      VLFAPLSEVYGRLPLYSVTLVIFVVFQIGGGCSKNIWSLVIFRFFHGFFGCTPMSACGGTISDLFNPIQR
TCR_STRAG       AVYGKLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFFSLLIMARFQGAGAAAFPALVMVVVARYIPKENR
MDTL_SALPK      LFAGKIADQSGRKPVAIVGAIVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLDEHRR
MDTL_SALPA      LFAGKIADQSGRKPVAIVGAIVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLDEHRR
MDTL_SALEP      LFAGKIADQSGRKPVAIVGAIVFMMASLLCSRASEGSLFLSGRFLQGIGAGGCYVVAFAILRDTLDEHRR
MDTL_SALDC      LFAGKIADQSGRKPVAIVGAIVFMMASLLCSRASEGSLFLSGRFLQGIGAGGCYVVAFAILRDTLDEHRR
MDTL_SALTI      LFAGKIADQSGRKPVAIVGAIVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLDEHRR
TCRB_BACSU      ALYGKLSDQLGIKNLLLFGIMVNGLGSIIGFVGHSFFPILILARFQGIGAAAFPALVMVVVARYIPKENR
MDTL_SALTY      LFAGKIADQSGRKPVAIVGALVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLDEHRR
MDTL_SALPC      LFAGKIADQSGRKPVAIVGAIVFMMASLLCSRASEGSLFLSGRFLQGIGAGGCYVVAFAILRDTLDEHRR
MDTL_SALPB      LFAGKIADQSGRKPVAIVGALVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLDEHRR
MDTL_SALNS      LFAGKIADQSGRKPVAIVGALVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLDEHRR
MDTL_SALHS      LFAGKIADQSGRKPVAIVGALVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLDEHRR
MDTL_SALCH      LFAGKIADQSGRKPVAIVGAIVFMMASLLCSRASEGSLFLSGRFLQGIGAGGCYVVAFAILRDTLDEHRR
MDTL_SALA4      LFAGKIADQSGRKPVAIVGALVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLDEHRR
AZR1_YEAST      LIWGRIATPIGFKETMLFAIVIFEIGSLISALANSMSMLXXXXXXXXXXXXXXQSLSFVIGSTLVEESQR
MDTL_SALSV      LFAGKIADQSGRKPVAIVGALVFMTASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLDEHRR
MMR_BACSU       XXXXXXXDRFGSKTIYILGLAVFVMASCLCAASINGQMLIAGRLIQGIGXXXXXXXXXXXXXXXYLDERA
MDTL_VIBPA      LFAGKIADSVGRKPIAVVGAMIFVLASFLGGMAEQPNTFLIARFCQGIGAGSCYVVAFAILRDTLDDERR
YHX6_SCHPO      PLFGKFCDIYGRKKTLLAAYCVFGIGCFLCGTSRSLWQLVXXXXXXXXXXXXMNSTVSILMSDIVPLKQR
YHD3_SCHPO      LIAGRLGDIYGHKKMFVLGYIWFCIWSLISGFSYYAKSVIMFRALTGIXXXXXXXXXXXXXGRVYPGKKK
TCR_STAHY       AVYGKLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFFSLLIMARFQGAGAAAFPALVMVVVARYIPKENR
MDTL_ECOL6      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_ECO81      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
ATR1_YEAST      LISGRLGDIYGLKKMLLVGYVLVIIWSLICGISGSDTFFIISRAFQGLGIAFLPNVGNIYVGGTFRK---
ACT22_STRCO     VVGGRLGDIYGRKRMFVVGAVGFTAASVLCSVAAGPEMLTAARFLQGGLGALMIPQGLGLIKQMFPPKET
MDTL_ECOL5      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_ECO27      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_ECOUT      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_ECOK1      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_ECO45      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
YN42_SCHPO      LCSGPIIELSGRKPPILIGMLGFGIFNISVAVGKDIQTIMMCRFFAGFFASAPLTVVAAALADMYSNKYR
MDTL_KLEP3      LFAGRIADRSGRKPXXXXXXXXXXXXSLLCAQAHASSHFLVGRFIQGIGAGSCYVVAFAILRDTLDDRRR
MDTL_ESCF3      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_ECOSM      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_ECOLU      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
CMCT_NOCLA      XXXXXXXDIHGHRRVFLGGLAVFTLTSLIGGLATSPASXXXXXXXXXXXXXXXXXXXVTMLTTSFEGPRR
MDTL_SHISS      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_SHIFL      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_SHIF8      XXXXXXXDRSGRKPVAIPGSALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_SHIBS      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_SHIB3      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_ECOSE      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_ECOLI      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_ECOLC      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_ECOHS      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_ECODH      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_ECOBW      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_ECO8A      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_ECO7I      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_ECO55      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_ECO24      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_CITK8      LFAGKVADQSGRKPXXXXXXXXXXXXSMLCSRATDGSLFLTGRFIQGIGAGCCYVVAFAILRDTLDDRRR
MDTL_SHIDS      XXXXKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_ECO5E      XXXXKVADRSGRKPVAIPGAALFIITSVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
MDTL_ECO57      XXXXKVADRSGRKPVAIPGAALFIITSVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR
YFMO_BACSU      FFSGAISSRIGAKWTLILGLIFIIVFAGLGGSSSSIAQLVGYRGGWGLGNALFISTALAVIXXXXXXXXA
PHDK_NOCSK      LVSGPVADRWGRKGVTVVGFVLFCLATAGLGLTGDIHSFAALRIISCFGGAVMP-VALTIVADWMPKARR
YBIH_SCHPO      PAVGVFCNILGRKIVLYICIFFFMLGSALCGASQNMIWLIVCRAXXXXXXXXXXXXXXXXXXXXTPLRTR
YWOG_BACSU      --SGAIVERFGKKRMAIVSMALFALSSFLYMPIHNFSLLLGLRFFQGIWFSILTTVTGAIAADIIPAKRR
MDFA_ECOLI      WLLGPLSDRIGRRPVMLAGVVWFIVTCLAILLAQNIEQFTLLRFLQGISLCFIGAVGYAAIQESFEEAVC
MDFA_ECOL6      WLLGPLSDRIGRRPVMLAGVVWFIVTCLAILLAQNIEQFTLLRFLQGISLCFIGAVGYAAIQESFEEAVC
MDFA_ECO57      WLLGPLSDRIGRRPVMLAGVVWFIVTCLAILLAQNIEQFTLLRFLQGISLCFIGAVGYAAIQESFEEAVC
YQO5_SCHPO      CIAGPIVELSGRKLPLLIGMFGFGIFNISVAVAKDIQTIMMCRFFSGFFASAPLTVVAAAFADMYSNKHR
MDTL_KLEP7      LFAGRIADRSGRKPXXXXXXXXXXXXSLICAQVHTSSHFLIGRFIQGIAAGSCYVVAFAILRDTLDDRRR
YN41_SCHPO      ----------GRKTPLYIGLFLFSVFQIAVATAQDIQTIMICRFFGGYGACVPLCVVAAAFADMYPNRYR
VBA2_YEAST      PLYGSFSDALGRRNCLFFANGAFTIGCLACGFSKNIYMLSFMRAXXXXXXXXXXXXXXXVNSDVIPSSKR
BCR_HAEIN       LFWGPFGDSFGRKPIILLGVIVGALTALVLTEINSVGNFTALRFVQGFFGAAPVVLSGALLRDLFSKDQL
YN43_SCHPO      ILWAPISELVGRKIPLIVGMFMFSIFSIAVAVAKDVQTVMICRFFSGFCASSPLSVVAAAFADMFDNKTR
YDHC_ECOLI      ---GPLSDRYGRKPVLLIGLTIFALGSLGMLWVENAATLLVLRFVQAVGVCAAAVIWQALVTDYYPSQKV
NANT_SALTY      LLLGAMGDRYG-RRLAMVSSIIFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_SALTI      LLLGAMGDRYG-RRLAMVSSIIFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_SALSV      LLLGAMGDRYG-RRLAMVSSIIFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_SALPK      LLLGAMGDRYG-RRLAMVSSIIFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_SALPC      LLLGAMGDRYG-RRLAMVSSIIFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_SALPB      LLLGAMGDRYG-RRLAMVSSIIFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_SALPA      LLLGAMGDRYG-RRLAMVSSIIFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_SALNS      LLLGAMGDRYG-RRLAMVSSIIFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_SALHS      LLLGAMGDRYG-RRLAMVSSIIFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_SALG2      LLLGAMGDRYG-RRLAMVSSIIFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_SALEP      LLLGAMGDRYG-RRLAMVSSIIFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_SALDC      LLLGAMGDRYG-RRLAMVSSIIFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_SALCH      LLLGAMGDRYG-RRLAMVSSIIFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_SALAR      LLLGAMGDRYG-RRLAMVSSIIFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_ESCF3      LMLGAMGDRYGRRLAMVTSIVLFSVGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_CITK8      LMLGAMGDRYG-RRLAMVTSIIFSMGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
YYBF_BACSU      LVFGSLSEVWGRKPIMGISMLAASVLCLASAFSPSFHTLLVLRTIQGVALAGLPSIAMAYLGEEIEPGSL
YO378_YEAST     LIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSV-YSNQIFFRAFQGMGPAFLLPNAIAILGRTYKGRRK
YWOD_BACSU      PVTGKLGDLIGRKRLFLFGLILVAVSAIGAPFAPTFMTLLVMRLFQSVGSSAIYPSGVGLIRNHI-HERQ
Y466_BUCAI      IPFGILSDKFNRKKIILLGLFMFFIGNIISASIHSIWGLIIGRFFQGSGA--ISGVCMAFLSDLIREENR
NANT_SHIFL      LMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_SHIF8      LMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_SHIB3      LMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_ECOSM      LMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_ECOSE      LMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_ECOLI      LMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_ECOLC      LMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_ECOL5      LMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_ECOHS      LMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_ECODH      LMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_ECOBW      LMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_ECO8A      LMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_ECO7I      LMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_ECO5E      LMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_ECO57      LMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_ECO55      LMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_ECO45      LMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_ECO27      LMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT_ECO24      LMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
NANT1_ECOL6     LMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
YB30_YEAST      LFWGALADFGGRKFLYMVSSLMLIVNILLAAVPVNIAALFVLRIFQAFASSSVISLGAGTVTDVVPPKHR
TCR_STAES       --------------------------------------LIFGRLVQGVGSAAFPSLIMVVVARNITRKKQ
TCR_STAAU       --------------------------------------LIFGRLVQGVGSAAFPSLIMVVVARNITRKKQ
SPIN_DROME      PIFGYLGDRYSRPWIMAVGVGLWSTTTLLGSFMKQFGWFIAFRALVGIGEASYSTIAPTIISDLFVHDMR
YN2F_SCHPO      VVWAPMCELFGRRRPMIIAVFIFCIFHIAVATAKDIQTVMICRFFCGFFGSSPITTVAGSFSDMFSARTR
SMVA_SALTY      LPMGALGDRIGFKRLLMXXXXXXXXXXXXXXXXHTASWLIATRVLLAIGAAMIVPATLAGIRATFCEEKH
MIRC_EMENI      -----IADVFGRFEAFCVSILIYVLGYIQMAASTNVQTYASAQIFYAAGSTGLQILQQVFIADSSSXXXX
YYAJ_BACSU      SLGGRLSDRIGRKKALNLFVFVFSIASLCNAAAWDIPSLMTFRFLTGFGVAAAMVITNSYLAEFFPSSVR
FNX1_SCHPO      PLYGRLSDIFGRRPTVVFANAAFTLGTFWCGISRSLPELCMARALAXXXXXXXXXXXXXXXXDIVSLRER
YHA8_SCHPO      LVISPLSEMIGRRIVYLVTLMIYIVLQIPCALAPNIACLLIVRFFCGCFGCTPLTLAGGVISDVWETRER
YWTG_BACSU      GAAGKLTDRFGRKKAIMAAALLFCIGGLGVALAPNTGVMVLFRIILGLAVGTSTTIVPLYLSELAPKHKR
Y588_BUCAI      LFTGPLSDIIGRKSIMSTSLFIAAMLTMICSMMTSWISIVLLRALTGLALSGVVAVAMTYISEEIHPNSL
PCAK_ACIAD      LVSGPTADRFGRKIVLSMSMLVFGGFTLACAYSTNLDSLVIFRFLTGIGGAAMPN-ATTLFSEYCPARIR
NANT_YERPY      LVLGAMGDRYGRKLAMIISIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMR
BCR_ECOLI       LIYGPMADSFGRKPXXXXXXXXXXXXXXXXXXXNTIDQLIVMRFFHGLXXXXXSVVINALMRDIYPKEEF
BENK_ACIAD      MMFGALIEHLGVKKVIAVCIILFSLCTVLCGFSETTTQFSIFRFLAGVGGGVMPNVVSEYAPKKFKSFFV
YM8M_YEAST      LISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSNSDAFFITSRAFQGVGIAFILPNIMGLVGHVYKVGSF
MDTM_SALTY      WLLGPLSDRIGRRPVLIAGXXXXXXXXXXXXXXXSMTQFLVARFVQGTSICFIATVGYVTVQEAFGQTKA
MDTM_SALTI      WLLGPLSDRIGRRPVLIAGXXXXXXXXXXXXXXXSMTQFLVARFVQGTSICFIATVGYVTVQEAFGQTKA
NANT_YERPS      LVLGAMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMR
NANT_YERPP      LVLGAMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMR
NANT_YERPG      LVLGAMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMR
NANT_YERPB      LVLGAMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMR
NANT_YERP3      LVLGAMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMR
NANT2_ECOL6     LAIGALSDKMGRRMAMVLSIVLFSLGTLACGLAPGYAVMFIARIVIGLGMAGEYGSSVTYVIESWPVHLR
GALP_ECOLI      VGSGWLSFKLGRKKSLMIGAILFVAGSLFSAAAPNVEVLILSRVLLGLAVGVASYTAPLYLSEIAPEKIR
GALP_ECOL6      VGSGWLSFKLGRKKSLMIGAILFVAGSLFSAAAPNVEVLILSRVLLGLAVGVASYTAPLYLSEIAPEKIR
YVMA_BACSU      IILGAIIDFKGARIVLITGILATAAASIGCAVTTDFTLFLIFRMIQXXXXXXXXXXXXTTIGQLFTGNER
YUBD_BACSU      PAGPLLRKKFGARPVYLASLPVFILGSLLIACSGDIALMAAGRFLQGAATGXXXXXXXXXXXXSFPIERR
YHJO_BACSU      LQVPLVTEKLSMKTILFITYICYSLAAAGFACSTSLTMLLVTAAVMTVGESIGLTHIQTFISKLAPPHLL
TPO1_YEAST      VIYAPLSELYGRKGVLVLSAFGFALFQFAVATAENLQTXXXXXXXXXXXXXXXXXXXXXXXXXXXXTNVR
NANT_YERPE      LVLGAMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMR
NANT_YERPA      LVLGAMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMR
MDTL_SHESA      LFAGSLADRIGRKPITXXXXXXXXXXXXXXXXXQSSDLFLVARFVQGVGAGCCYVVAFAILRDALDDKRR
CSBC_BACSU      ALSGTCSDRWGRRKVVFVLSIIFIIGALACAFSQTIGMLIASRVILGLAVGGSTALVPVYLSEMAPTKIR
Y567_BUCAP      LFIGPLSDRIGRKSIMSSSLLIAAVLTIICSISNNWTVIVFLRALTGLALSGVVAVAMTYIVEEVHPNSV
NANT_SALA4      LLLGAMGDRYG-RRLAMVSSIIFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLR
YCEJ_BACSU      FIAGPISDRLNRKTVMLWGLAGFIVSTFLCGIAPSFAAMCLFRFAAGVSAAFVTPQIWASIPVIVQPSQI
VBA3_YEAST      ----------------------------------------------------------------------
TPO3_YEAST      -----VSDLYGRRVAYFVSMGLYVIFNIPCALAPNLGSLLACRFLCGVWSSSGLCLVGGSIADMFPSETR
BCRH_RICTY      LSLGRLSDIYGRRPIVLLGLXXXXXXXXXXXXXXXXEMLMIARFIQAFGVSVGSVIGQSMARDSYQGAEL
ARAE_KLEOX      LFNGWLSFRLGRKYSLMVGAVLFVAGSVGSAFATSVEMLLVARIVLGVAVGIASYTAPLYLSEMASENVR
EXUT_BACSU      FLGGVASDRYGAKLTLFVAMVVWSLFSGAVALAFGFVSLLIIRILFGMGEGPLSATINKMVNNWFPPTQR
ARAE_ECOLI      LFNGWLSFRLGRKYSLMAGAILFVLGSIGSAFATSVEMLIAARVVLGIAVGIASYTAPLYLSEMASENVR
ARAE_ECO57      LFNGWLSFRLGRKYSLMAGAILFVLGSIGSAFATSVEMLIAARVVLGIAVGIASYTAPLYLSEMASENVR
Y2171_CITK8     LLTGYLIKRLGFNRSYYIASLIFAAGCVGLGMMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNR
SVOPL_HUMAN     ILFGLLADRYGRWKILLISFLWGAYFSLLTSFAPSYIWFVFLRTMVGCGVS--GHSQGLIIKTEFLPTKY
MDTL_SHEON      LFAGSLADRIGRKPITXXXXXXXXXXXXXXXXXQTSDLFLIARFAQGIGAGCCYVVAFAILRDVLDDKRR
TPO2_YEAST      -----VSDLYGRRVAYFVSMGLYVIFNIPCALAPNLGCLLACRFLCGVWSSSGLCLVGGSIADMFPSETR
NANT_ENTS8      LMLGAMGDRYG-RRLAMISSIVFSVGTLACGLAPGYTTLFIARLVIGIGMAGEYGASATYVIESWPKALR
BSU1_SCHPO      MFLGPLSDIGGRKPVYFCSIFVYTVFNISCALPRNIVQMIISHFIIGVAGSTALTNVAGGIPDLFPEDTA
YCAD_SHIFL      LLTGYVIKRIGFNRSYYLSSFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNR
YCAD_SHIF8      LLTGYVIKRIGFNRSYYLSSFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNR
YCAD_SALTY      LFTGYLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNR
YCAD_SALTI      LFTGYLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNR
YCAD_SALSV      LFTGYLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNR
YCAD_SALPK      LFTGYLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNR
YCAD_SALPC      LFTGYLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNR
YCAD_SALPA      LFTGYLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNR
YCAD_SALNS      LFTGYLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNR
YCAD_SALHS      LFTGYLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNR
YCAD_SALCH      LFTGYLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNR
YCAD_SALA4      LFTGYLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNR
CYHR_CANMA      -------------------------------LSNHIAGLSVLRVIAGFFAAPALSTGGASYGDFIAMHYY
BCRH_RICPR      LSLGRLSDIYGRRPIVLLGLXXXXXXXXXXXXXXXXEMLMIARFIQAFGVSVGSVIGQSMARDSYQGAEL
YCAD_ESCF3      LLTGYLIKRLGFNRSYYLASLVFAAGCLGLGLMIGFWSWMAWRFVAGVGCAMIWVVVESALMCSGTSRNR
S17A5_MOUSE     --------------------------------------LVVLRALEGLGGVTFPAMHAMWSSWAPPLER-
MUCK_ACIAD      IFGGWACDRFGRVRIVVISILTFSILTCGLGLTQSFIQFGVLRFFASLGLGSLYIACNTYVPTKYRTTVL
YCAD_SHISS      LLTGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNR
YCAD_SHIDS      LLTGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNR
YCAD_ECOUT      LLTGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNR
YCAD_ECOSM      LLTGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNR
YCAD_ECOSE      LLTGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNR
YCAD_ECOLU      LLTGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLTWRFVAGVGCAMIWVVVESALMCSGTSRNR
YCAD_ECOLI      LLTGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNR
YCAD_ECOLC      LLTGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNR
YCAD_ECOL6      LLTGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNR
YCAD_ECOL5      LLTGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNR
YCAD_ECOK1      LLTGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNR
YCAD_ECOHS      LLTGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNR
YCAD_ECODH      LLTGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNR
YCAD_ECOBW      LLTGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNR
YCAD_ECO8A      LLTGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNR
YCAD_ECO81      LLTGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNR
YCAD_ECO7I      LLTGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNR
YCAD_ECO5E      LLTGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNR
YCAD_ECO57      LLTGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNR
YCAD_ECO55      LLTGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNR
YCAD_ECO45      LLTGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNR
YCAD_ECO27      LLTGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNR
YCAD_ECO24      LLTGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNR
SPNS1_DANRE     PLFGYLGDRYNRKLIMCVGIFFWSVVTLASSFKDHFWALLLTRGLVGVGEASYSTIAPTIIADLFVKEKR
YITG_BACSU      PIVGYLADRFSRKVIIIPCLILYXXXXXXXXXXXXXXDVMAGRALQGIGAAGTGPIAMALTGDLFKGAQE
YCAD_SALEP      LFTGYLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNR
VACHT_DANRE     -LSGTFIDRVGYDLPLLIGLLVMFLSTCIFAFAENYGTLFAARSLQGLGSAFADTSGIAMIADKFTEEER
PMRA_STRR6      -------DKVGNHRLLVVAQFYSVIIYLLCANASSPLQLGLYRFLFGLGGALIPGV-NALLSKMTPKAGI
PMRA_STRPN      -------DKVGNHRLLVVAQFYSVIIYLLCANASSPLQLGLYRFLFGLGGALIPGV-NALLSKMTPKAGI
BMR2_BACSU      PFAGRWVDRFGRKKMIILGLLIFSLSELIFGLGTHVSIFYFSRILGGVSAAFIMPAVTAYVADITTLKER
YCAD_SALPB      LFTGYLIKRIGFNHSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNR
MDTD_SHIDS      ----------------------------------------------------------------------
YCAD_SALAR      LFTGYLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNR
SVOPL_MOUSE     ILFGLLADRYGRWKILLLSFLWGAYFSLLTSFSPSYIWFVFLRTMVGCG---VSGHAQLIIKTEFLPTKY
S17A5_HUMAN     IPGGYVASKIGGKMLLGFGILGTAVLTLFTPIAADLGPLIVLRALEGLGGVTFPAMHAMWSSWAPPLER-
DGOT_ECOLI      IPGGWFLDRVGSRVTYFIAIFGWSVATLFQGFATGLMSLIGLRAITGIFEAPAFPTNNRMVTSWFPEHER
DGOT_ECOL6      IPGGWFLDRVGSRVTYFIAIFGWSVATLFQGFATGLMSLIGLRAITGIFEAPAFPTNNRMVTSWFPEHER
YAJR_ECOLI      IPFGLLSDRIGRKPLIVGGLAVFAAGSVIAALSDSIWGIILGRALQGSGA--IAAAVMALLSDLTREQNR
Y1560_METJA     ---GVLSDIYGKKFFIVCGTFFYGVSTLMYNFVSTVLGFLIVRIFTGIFSAFVTPVAGSYIAAIAPKTRL
S22A2_RAT       MMIGYLADRFGRKFCLLVTILINAISGALMAISPNYAWMLVFRFLQGLVSKAGWLIGYILI-TEFVGLGY
ITR2_SCHPO      TTSGWLADWVGRKRLLLCADAIFVIGSVIMAASRNVAMMVVGRFIVGYGIGLTSLIVPMYITELAPARLR
YFIS_BACSU      -VSGLLADRFDRKTIMFLSEIGRALTVISCVYVSELWQLYVLLSVQSCFSSLFLPAKNGKLKELAPEAHI
MSSP3_ARATH     TFSGPVSDKVGRRSMLILSSVLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIYISETAPSEIR
EMRD_ECOLI      LFYGPISDRVGRRPVILVGMSIFMXXXXXXXXXXXXXXXIAASAMQXXXXXXXXXXARTLPRDLYERTQL
BBEX_BACSU      -------DKGRMKFCVVTGMILLTLSFIALWWNHSFYFLFVFLSFGGIGGMALPAL-DALITEGIESEQC
YCAD_SALG2      LFTGYLIKRIGFNRSYYLASLIFAAGCVGLGGMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNR
YCAD_SALDC      LFTGYLIKRIGFNRSYYLASLIFAAGCVGLGGMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNR
AQR1_YEAST      TVSGGLADCFGRRPIILAGMLIYVIASIGLACAPSYGVIIFLRCIQSIGISPTIAISSGVVGDFTLKHER
SVOPL_DANRE     VLCGYIADKYGRWKVVFGGFVWAXXXXXXXXXXXXXGWFIFLRCMVGCGVA---ATSQGFVKTEFIPAKY
YUXJ_BACSU      LVSGRFGDKRGYKKILMATGTGIALSIFFMGFVTSVYQLFFLRMAMGLVTGFIPT-SLAMISAQTPKSSA
VMAT2_RAT       ---GILAHKMGRWLCALLGMVIVGISILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPYLVDLRHVSVY
UHPT_CHLPN      FVSGVMSDQSNPRYFMAIGLMITGLTNIFFGMSSSI---VLFALWWGLNGWFWPPCAR-LLTHWYAKSER
GTR9_HUMAN      LVGTLIVKMIGKRKHTLLANNGFAISAALCSLQAGAFEMIVGRFIMGIDGGVALSVLPMYLSEISPKEIR
BMRP_CANAL      ---------FGRTSIYIITLFLFVILQIPTALVNNIAGLCILRFLGGFFASPCLATGGASVADVVKFWNL
Y1421_ENT38     ------IKRFGFNRSYYLASLIFAAGCVGLGLMVGFWSWMTWRFIAGVGCAMIWVVVESALMCSGTSRNR
TPO4_YEAST      -------EVFGRKPVYLFSLPVSMLFTMGVGLSNGHMRIILLRFLSGVFASPALSVGSGTILDIFDVDQV
S17A4_MOUSE     -----------------------------------VALLIVLRVIQGMAQVMVLTGQYSLWAKWAPPQER
VACHT_DROME     --SGGLIDKIGYDLPMMIGLTIMFFSTAVFACGSSYSVLFFARSLQGAGSAFADTAGLAMIADRFTEEER
S22A2_MOUSE     ---GYLADRFGRKFCLLVTILINAISGVLMAISPNYAWMLVFRFLQGLVSKAGWLIGYILI-TEFVGLGY
PMRA_LACLA      ---GRLGDKYGSHRLILIGLVFTFIIYLPMAFVQSPLQLGILRFLLGFGGALTPSV-NSLLSKITPKEGV
GTR9_PONAB      LVGTLMVKMIGKRKHTLLANNGFAISAALCSLQAGAFEMIVGRFIMGIDGGIALSVLPMYLSEISPKEIR
FSLK_DICDI      ----------------------------------------------------------------------
YJHB_ECOLI      ---GAMADKYGRKPMMMWAIFIYSVGTGLSGIATNLYMLAVCRFIVGLGMSGEYACASTYAVESWPKNLQ
UHPT_CHLTR      FVSGVMSDQSNPRYFMAIGLIITGISNIFFGLSSTIPLFVLFWGFQGWG---WPPCAR-LLTHWYSKSER
SPNS1_XENLA     PVFGYLGDRYNRKLIMCVGISFWSLVTLLSSFVSNFWLFLITRGLVGVGEASYSTIAPTIIADLFLADQR
PLST3_ARATH     LFSGLVADGVGRRRAFQLSALPMIVGASVSASTESLMGMLLGRFLVGIGMGIGPSVTALYVSPAYVRGTY
OXLT_OXAFO      ---GFVSDKIGRYKTM---SVVFGINAVVLALFPTIAALMLAIAFFTWGGSYFPSTNSDIFGTAYSARNY
ANTR1_ARATH     IAGGIWADTVGGKRVLGFGVIWWSIATILTPVAAKLGYLLVVRAFMGVGEGVAMPAMNNILSKWVPVQER
HOL1_YEAST      ---------YGRKITYIVCTTXXXXXXXXXXXXKRTSDTIWSQLFVGISESCAEAQVQLSLSDIFFQHQL
YN22_SCHPO      PLSGI----YGRFVVYFCTLLMFTLFQIGGGCAQNIWTLVILRFFQGFFGSTPLSNCGGTLSDLFTPIQR
VMAT2_MOUSE     ---GILAHKMGRWLCALLGMIVVGISILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPYLVDLRHVSVY
VMAT2_BOVIN     ---GILAHKMGRWLCALLGMIIVGMSILCIPLAKNIYGLIAPNFGVGFAIGMVDSSMMPYLVDLRHVSVY
TUB4_AGRVI      VPSNLILNKVGIARVMITWGIVSGLMAFVQGTTSFYA----LRFLLGVAEAFFPGII-LYLSFWFPARRR
NPT1_HUMAN      --SGIYSTKKMIGFALCLSSVLSLLIPPAAGIG--VAWVVVCRAVQGAAQGIV-ATAQFEIYVKWAPPER
MHPT_ECOLI      LVGGMLADRYGRKRILIGSVALFGLFSLATAIAWDFPSLVFARLMTGVGGAALPNL--------------
LTAA_STAS1      LFLSKIIDKHGMYWVIFGGFVLYTLMIFALSLITNITIVWVLAVFIGLMYGILLPAWNTFMASHIHSDEQ
YQ92_SCHPO      IAAGFLADKFLTRKVPMLIGLIFLTSATLLTFGNSVPMLIVARVLQGLSAAVVWTXXXXXXXXXXXXXXX
YMPB_CAEEL      PFMSMLADRYGRKPIIVTTAILAFLANMAASFSPNFAIFLILRAFIGACSDSYLSVASVATCEYLSEKAR
YCEI_BACSU      -------DRIGRKKVFIITLLCFSIGSGISAFVTSLSAFLILRFVIGMGGGELP-VASTLVSEAVVPEKR
VMAT2_HUMAN     ---GILAHKMGRWLCALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPYLVDLRHVSVY
TUB3_AGRVI      VPSNLILNKVGIARVMITWGIVSGLMAFVQGTTS----FYILRFLLGVAEAFFPGII-LYLSFWFPARRR
CMLA_PSEAE      LLFGPLSDXXXXXXXXXXXXXAYVVASMGLALTSSAEVFLGLRILQACGAACLVSTFATVRDIYAGREES
YWFA_BACSU      PLLVPLGDKYSRELSLLAGLMIFIIGTVICALAQNIXXXXXXXXXXXXXXXXXVPTAYAVVGDTYRGKVM
YIQ6_YEAST      LPGNLLSKRFGPERVIPVQIVLWSVICITQAGLKNRGQFIATRCLLGMQGGFIPDNI-LYLSYYYTGAEL
YDGK_BACSU      ----------------------------------NITTLVAARFLQGFTASAGLVLSRAIVRDVFTGREL
Y411_BUCBP      ---GWLSDKYGQKLIINIGLLCFLLGNIIAWSSNSIWGIILGRGLQGSGA--ISSVCMTLLSELVLPHNR
Y2680_YERPY     LIAGRFIQQLGFNRSYHCSCILFALATCGLMLTVDFWSWLGWRFLAGIACALIWVIVESALLRSGTLTNR
Y2592_YERP3     LIAGRFIQQLGFNRSYHCSCILFALATCGLMLTVDFWSWLGWRFLAGIACALIWVIVESALLRSGTLTNR
Y2315_YERPP     LIAGRFIQQLGFNRSYHCSCILFALATCGLMLTVDFWSWLGWRFLAGIACALIWVIVESALLRSGTLTNR
Y1506_YERPB     LIAGRFIQQLGFNRSYHCSCILFALATCGLMLTVDFWSWLGWRFLAGIACALIWVIVESALLRSGTLTNR
Y1405_YERPS     LIAGRFIQQLGFNRSYHCSCILFALATCGLMLTVDFWSWLGWRFLAGIACALIWVIVESALLRSGTLTNR
Y1380_YERPE     LIAGRFIQQLGFNRSYHCSCILFALATCGLMLTVDFWSWLGWRFLAGIACALIWVIVESALLRSGTLTNR
XYLL3_ARATH     ALLGSI-SVYGVRRELIIAAVLYLLGSLITGCAPDLNILLVGRLLYGFGIGLAMHGAPLYIAETCPSQIR
SPNS3_MOUSE     PVFGYLGDRYNRKAILSFGILLWGLSSSFISYQYSWL-FFLSRGFVGTGAASYSTIAPTVLGDLFVKDQR
S22A1_RABIT     ---GYIADRFGRKLCLLLTTLINAVSGVLTAVAPDYTSMLLFRLLQGLKGSWMSGYT---LITEFVGSGY
GTR4_HUMAN      VLIGIISQWLGRKRAMLVNNVLAVLGGSLMGLANAAAEMLILGRFLGAYSGLTSGLVPMYVGEIAPTHLR
ANTR3_ARATH     VIGGALVDRYGGKRVLAWGVALWSLATLLTAAAHSTLALLCVRAFFGLAGVAMPSMT-TLLSRWFPMDER
Y450_BUCAP      IPFGILSDRFGRKQXXXXXXXXXXXXXXXXXXTNSIFGLIIGRAIQGSGA--ISGVSMALLSDLIRKENR
S17A5_SHEEP     --------------------------------------LVALRALEGLGEGVTYPAMHAMWSSWAPPLER
YOU1_CAEEL      TFWGKICDRFGRRKGLTFSTLVACIMGVISGMSPHFYVLLFFRGLTGFGIGGVPQSVTLY-AEFLPTAQR
YHK8_YEAST      ------------------------------------------------------------IADIFDKDQI
YFKF_BACSU      FPLGILSDKYGRRNVLLVILLTGALCFFIAGVFPSVIGGCFFIAGMAVGSTFTLGIS--YMTDLLPPHLL
UHPT_CHLMU      FVSGVMSDQSNPRYFMATGLIITGLSNIFFGLSSTVPLFVLFWGFQGWG---WPPCAR-LLTHWYSKSER
PLST1_ARATH     IVAGPLVDKFGYRRTFQIFTIPLILGALVSAQAHSLDEILCGRFLVGLGIGVNTVLVPIYISEVAPTKYR
NU4C_NEPOL      LLGALTMPFMGIQ------GVTFDMSTLAYREYSLPVEILLYTGFLIAYGVKLPAIVHTWLPDTHGEAHY
MFS1_SCHPO      PLSE--VPQIGRQKIYVLSLIVFICLQIPTALGSSLGVLLPMRFLAGVFGSPALSTGGASLADIWQPWLY


                         +         .         .         .         .         *         .:210
query           NKMMTIYSMVIVMGPIIGPVLGGAICENMSWEWIFYVNVPLCIVAFIIIAFMMEATQIKKIKIDYISFGF
EMRB_ECOLI      SIALALWSMTVIVAPICGPILGGYISDNYHWGWIFFINVPIAVVLMXXXXXXXXXXXXXXXXIDAVGLAL
EMRB_ECO57      SIALALWSMTVIVAPICGPILGGYISDNYHWGWIFFINVPIAVVLMXXXXXXXXXXXXXXXXIDAVGLAL
EMRB_HAEIN      GMALAFWSMTIVVAPIFGPILGGWISDNIHWGWIFFINVPIGL-SVVLISWKILGSRESEIPIDKXXXXX
EMRY_ECOLI      TFALALWSMTVIIAPICGPILGGYICDNFSWGWIFLINVPMGIIVLTLCLTLLKGTETSPVKMNXXXXXX
MDTD_YERPY      MAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPNHKMSTRRFDISGFIM
MDTD_YERPP      MAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPNHKMSTRRFDISGFIM
MDTD_YERPN      MAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPNHKMSTRRFDISGFIM
MDTD_YERPG      MAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPNHKMSTRRFDISGFIM
MDTD_YERPE      MAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPNHKMSTRRFDISGFIM
MDTD_YERPB      MAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPNHKMSTRRFDISGFIM
MDTD_YERPA      MAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPNHKMSTRRFDISGFIM
MDTD_YERP3      MAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPNHKMSTRRFDISGFIM
BMR3_BACSU      GKMSGMFGAVFGLSSVLGPLLGAIITDSISWHWVFYINVPIALSLFFIIRYYKESLEHRKQKIDWGGAIT
MDTD_YERPS      MAAMAFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPNHKMSTRRFDISGFIM
MDTD_PECCP      MAAMTFVTLPGQIGPLMGPALGGFLVEYASWHWIFLINLPVGIIGALATWFLMPNYTMRTQRFDISGFLW
MDTD_SERP5      MAAMTFVTLPGQIGPLMGPALGGFLVQYASWHWIFLINIPVGIAGAIATLLLMPNYRMQTRRFDISGFIL
MDTD_YERE8      MSAMAFVTLPGQIGPLVGPALGGFLVEYASWHWIFLINLPVGVVGALATLWLMPNYTTRTRRFDISGFIM
YHCA_BACSU      GKGMGIFGLAMMFAPAVGPTLSGWIIEHYTWRIMFYGLVPIXXXXXXXXXXXKNMVEPQKIKLDTLGAIL
YEBQ_ECOLI      GRGMGINSFIVAVSSAAGPTIAAAILSIASWKWLFLINVPLGIIALLLAMRFLNGSRASKPRFDLPSAVM
LMRB_LISIN      GSAMGMIGLVIMFAPAVGPTISGLILENLTWNWIFWISLPFLIIALLFMKFMQNVSVVTKPKIDILSIIL
MDTD_ECOL6      MAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIIGAITTLMLMPNYTMQTRRFDLSGFLL
MDTD_ECO81      MAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIIGAIATLMLMPNYTMQTRRFDLSGFLL
LMRB_LISMO      GSAMGMIGLVIMFAPAVGPTISGLILENLTWNWIFWISLPFLIIALLFMKFMQNVSVVTKPKIDILSIIL
MDTD_SHIF8      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPNYTMQTRRFDLSGFLL
MDTD_ESCF3      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPNYTMQTRRFDLSGFLL
MDTD_ECOUT      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPNYTMQTRRFDLSGFLL
MDTD_ECOLU      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPNYTMQTRRFDLSGFLL
MDTD_ECOK1      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPNYTMQTRRFDLSGFLL
MDTD_ECO45      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPNYTMQTRRFDLSGFLL
MDTD_SHISS      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMPNYTMQTRRFDLSGFLL
MDTD_SHIFL      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPNYTMQTRRFDLSGFLL
MDTD_SHIBS      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMPNYTMQTWRFDLSGFLL
MDTD_SHIB3      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMPNYTMQTRRFDLSGFLL
MDTD_ECOSM      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPNYTMQTRRFDLSGFLL
MDTD_ECOSE      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPNYTMQTRRFDLSGFLL
MDTD_ECOLI      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMPNYTMQTRRFDLSGFLL
MDTD_ECOLC      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMPNYTMQTRRFDLSGFLL
MDTD_ECOL5      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPNYTMQTRRFDLSGFLL
MDTD_ECOHS      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMPNYTMQTRRFDLSGFLL
MDTD_ECODH      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMPNYTMQTRRFDLSGFLL
MDTD_ECOBW      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMPNYTMQTRRFDLSGFLL
MDTD_ECO8A      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPNYTMQTRRFDLSGFLL
MDTD_ECO7I      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPNYTMQTRRFDLSGFLL
MDTD_ECO5E      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPNYTMQTRRFDLSGFLL
MDTD_ECO57      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPNYTMQTRRFDLSGFLL
MDTD_ECO55      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPNYTMQTRRFDLSGFLL
MDTD_ECO27      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPNYTMQTRRFDLSGFLL
MDTD_ECO24      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPNYTMQTRRFDLSGFLL
MDTD_CITK8      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIVGAIATLMLMPNYTMQTRRFDLSGFLL
MDTD_SALSV      MAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAIATFMLMPNYTIETRRFDLPGFLL
SGE1_YEAST      GIMITALAISYVIAEGVGPFIGGAFNEHLSWRWCFYINLPIGAFAFIILAFMWLPSKIKKIKLDMVGIIL
HSRA_ECOLI      LPVLNFVAMXXXXXXXXXXXXXXXXXTWATWHWIFLINIPIGIAGLLYARKHMPNFTTARRRFDXXXXXX
MDTD_SALTI      MAAMTFVAXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMPNYTIETRRFDLPGFLL
MDTD_SALPK      MAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMPNYTIETRRFDLPGFLL
MDTD_SALPB      MAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMPNYTIETRRFDLPGFLL
MDTD_SALPA      MAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMPNYTIETRRFDLPGFLL
MDTD_SALNS      MAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMPNYTIETRRFDLPGFLL
MDTD_SALHS      MAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMPNYTIETRRFDLPGFLL
MDTD_SALEP      MAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMPNYTIETRRFDLPGFLL
MDTD_SALDC      MAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMPNYTIETRRFDLPGFLL
MDTD_SALA4      MAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMPNYTIETRRFDLPGFLL
MDTD_SALTY      MAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMPNYIIETRRFDLPGFLL
MDTD_ERWCT      MAAMTFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINLPVGIIGALATWFLMPNYTMQTQRFDISGFVW
MDTD_ENT38      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINLPVGIVGAIATLWLMPNYKMQTRRFDIFGFVX
TCMA_STRGA      NMAIGIWSGVVGASTAAGPIIGGLLVQHVGWEAVFFINVP------------------------------
LMRB_BACSU      GAAMGTIGLVIMFAPAIGPTFSGLVLEHLNWHWIFWISLPFLVLALVFIAYMQNVSETTKPKIDVLSIIL
YUSP_BACSU      AKFQGVFGAIYGLASVIGPQIGGWIVDSLNWKWVFYINLPVGIIAVIFIARGLQGQQTGPINFDIAGIFT
HSRA_HAEIN      VNAWNLMATAXXXXXXXXXXXXXWLVIHASWHWIFLINIPIGALGILASGSVMNNIKGKAEKLDWTGFLL
YCNB_BACSU      GQAMGMVGLVISFAPAIGPTLSGWAVEAFSWRSLFYIILPFAVIDLILASILMKVTTLRKTQIDILS---
QACA_STAAU      ATALAVWSIASSIGAVFGPIIGGALLEQFSWHSAFLINVPFAIIAVVAGLFLLPESKLSKEKSDIPSTIL
QACA_STAAM      ATALAVWSIASSIGAVFGPIIGGALLEQFSWHSAFLINVPFAIIAVVAGLFLLPESKLSKEKSDIPSTIL
MDTD_ENTS8      MAAMTFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINLPVGIAGAAATLWLMPNYTMQTRRFDF-----
MDTD_KLEP3      MAAMTFVTXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIVGAIATLCLMPNYTLQTRRFDLSGF--
MDTD_KLEP7      MAAMTFVTXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIVGAIATLCLMPNYTMQTRRFDLSGF--
YFIU_BACSU      GKALGLLGAMNGMAAVLGPNIGSFLLDTGSWHWLFLINLPIAVLLVVFGACFIAETKAPEAKIFLLSLSI
BAIG_EUBSP      GKAFGLYMLISSGAVVVGPTCGGLIMNAAGWRVMMWVCVALCVVVFLICTFSIKKTAFEKKSMAGFDKPG
YJA1_SCHPO      GKAVAVMSLAPLLGPTIGPVVSGFIAEYTTYKWIFW----------------------------------
YAN6_SCHPO      YTMGVTWGLASVMGPLIG----GAISQKASWRWIFFINLPXXXXXXXXVPKPTVSFRVFLRDFDFVGIIT
VBA5_YEAST      PLVISILSCAFAVAAIVGPIIGGAFTTHVTWRWCFYINLPIGGLAIIMFLLTYKA---------------
MMR_STRCO       TRMLGLWSAIVATSSGLGPTVGGLMVSAFGWESIFLLNLPIGAIGMAMTYRYIAATESRATRLAVPGHLL
TCR_STRPN       GKAFGLIGSIVAMGEGVGPAIGGMIAHYIHWSYLLLIP----MITIITVPFLMKLLKKERIKGHFDIKGI
TCR_BACSU       GKAFGLIGSIVAMGEGVGPAIGGMIAHYIHWSYLLLIP----MITIITVPFLMKLLKKERIKGHFDIKGI
TCR_BACST       GKAFGLIGSIVAMGEGVGPAIGGMIAHYIHWSYLLLIP----MITIITVPFLMKLLKKERIKGHFDIKGI
TCR_BACCE       GKAFGLIGSIVAMGEGVGPAIGGMIAHYIHWSYLLLIP----MITIITVPFLMKLLKKERIKGHFDIKGI
MDTL_SALAR      AKVLSLLNGITCIVPVLAPVLGHLIMLRFPWQSLFYTMSAMGIIVCLLSLFILRETR-------------
YI32_SCHPO      YTMGVTWGVASVMGPLIG----GAISQNTTWRWIFFINLP------------------------------
MDTM_ECOLI      IKLMAIITSIVLIAPIIGPLSGAALMHFMHWKVLFAIIAVMGFISFVGLLLAMPET----VKRGAVPFSA
MDTM_ECO57      IKLMAIITSIVLIAPIIGPLSGAALMHFVHWKVLFAIIAVMGFISFVGLLLAMPET----VKRGAVPFSA
YVKA_BACSU      PKVXXXXXXXXXXXXXXXPFIGSILIDSFSWHSIFWVNIPFLAIALFTALTMFPQYKENKSDAPLDIIGS
YCT4_SCHPO      TGALLVFCAAAFVGPLVGPVMGGYITESLGWRWDFWINMIWAGLTWVIVCFTMPET--------------
TCR_STRAG       GKAFGLIGSIVAMGEGVGPAIVGMIAHYIHWSYLLLIP----MITIITVPFLMKLLKKERIKGHFDIKGI
MDTL_SALPK      AKVLSLLNGITCIVPVLAPVMGHLIMLRFPWQSLFYTMSTMGIIVGLLSLFILRETR-------------
MDTL_SALPA      AKVLSLLNGITCIVPVLAPVMGHLIMLRFPWQSLFYTMSTMGIIVGLLSLFILRETR-------------
MDTL_SALEP      AKVLSLLNGITCIVPVLAPVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILRETR-------------
MDTL_SALDC      AKVLSLLNGITCIVPVLAPVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILRETR-------------
MDTL_SALTI      AKVLSLLNGITCIVPVLAPVMGHLIMLRFPWQSLFYTMSTMGIMVGLLSLFILRETR-------------
TCRB_BACSU      GKAFGLIGSLVAMGEGVGPAIGGMVAHYIHWSYLLLIPTATIITVPFLIKLLKKEERIRG-HIDMAGIIL
MDTL_SALTY      AKVLSLLNGITCIVPVLAPVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILRETR-------------
MDTL_SALPC      AKVLSLLNGITCIVPVLAPVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILRETR-------------
MDTL_SALPB      AKVLSLLNGITCIVPVLAPVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILRETR-------------
MDTL_SALNS      AKVLSLLNGITCIVPVLAPVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILRETR-------------
MDTL_SALHS      AKVLSLLNGITCIVPVLAPVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILRETR-------------
MDTL_SALCH      AKVLSLLNGITCIVPVLAPVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILRETR-------------
MDTL_SALA4      AKVLSLLNGITCIVPVLAPVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILRETR-------------
AZR1_YEAST      GILIAVLSCSFAIASVVGPFLGGVFTSSVTWRWCFYVNLPI-----------------------------
MDTL_SALSV      AKVLSLLNGITCIVPVLAPVMGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILRETR-------------
MMR_BACSU       RRMFGLWXXXXXXXXXXGPFIGGVLVQLAGWQSIFLINVPIGAAALISAYRILSRVPGKSSRVNIIGHLL
MDTL_VIBPA      AKVLSMLNGITCIIPVIAPVIGHLIMLKFPWPSLFTTMAGMGILVSVLAIFVLK----------------
YHX6_SCHPO      GTYQGIINVFFAIGSSLGGPVGGYFADQYTWRIGFLIQVPLIAIAFLCVYFTL-----------------
YHD3_SCHPO      NLIFALFGATAPNGFLLGSVFSGIFAQLSWWPWTYWTTAIVCIV-FAIIGYFIEADEVEKQKFDYLGAFF
TCR_STAHY       GKAFGLIGSIVAMGEGVGPAIGGMIAHYIHWSY----XXXXXXXXXXXVPFLMKLLKKERIKGHFGSKGI
MDTL_ECOL6      AKVLSLLNGITCIIPVLAPVLGHLIMLNFPWQSLFWTMAIMGVAVLMLSLFILKETR-------------
MDTL_ECO81      AKVLSLLNGITCIIPVLAPVLGHLIMLNFPWQSLFWTMAIMGVAVLMLSLFILKETR-------------
ATR1_YEAST      NIVISFVGAMAPIGATLGCLFAGLIGDPKQWPWAFYAYSIAAFINFVLSIYAIPSTNIHHFSMDWI----
ACT22_STRCO     XXXXXXXXXXXXXXXVLGPIVAGFLVDGTGWRSVFLINXXXXXXXXXXXXXXXEGKAPVRPKFDVVGMAL
MDTL_ECOL5      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMATMGIAVLMLSLFILKETR-------------
MDTL_ECO27      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMATMGIAVLMLSLFILKETR-------------
MDTL_ECOUT      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMATMGIALLMLSLFILKETR-------------
MDTL_ECOK1      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMATMGIALLMLSLFILKETR-------------
MDTL_ECO45      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMATMGIALLMLSLFILKETR-------------
YN42_SCHPO      GTAITLFSAMVFDGPLVSPIVGGFLTKSLGWRWTEYITSFMGFFALIIVYLFCDETYSKAI---------
MDTL_KLEP3      AKVLSLLNGITCIIPVLAPVLGHLIMLKYPWQSLFYTMTGMGVMVGLLSVFILRETR-------------
MDTL_ESCF3      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMATMGIAVLMLSLFILKETR-------------
MDTL_ECOSM      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMATMGIAVLMLSLFILKETR-------------
MDTL_ECOLU      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMATMGIAVLMLSLFILKETR-------------
CMCT_NOCLA      TRALTISTAVALVGGASGNLLGGVFTEFLSWRSVLLVNVPIGIPVLFLAA--------------------
MDTL_SHISS      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETR-------------
MDTL_SHIFL      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETR-------------
MDTL_SHIF8      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETR-------------
MDTL_SHIBS      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETR-------------
MDTL_SHIB3      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETR-------------
MDTL_ECOSE      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETR-------------
MDTL_ECOLI      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETR-------------
MDTL_ECOLC      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETR-------------
MDTL_ECOHS      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETR-------------
MDTL_ECODH      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETR-------------
MDTL_ECOBW      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETR-------------
MDTL_ECO8A      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMAMMGIAVLMLSLFILKETR-------------
MDTL_ECO7I      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMATMGIAILMLSLFILKETR-------------
MDTL_ECO55      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETR-------------
MDTL_ECO24      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMAMMGIAVLMLSLFILKETR-------------
MDTL_CITK8      AKVLSLLNGITCIVPVLAPVLGHLIMLKFPWQSLFYTMIAMGIAVCLLSVFILKETR-------------
MDTL_SHIDS      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMAIMGIAVLMLSLFILKETR-------------
MDTL_ECO5E      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMAIMGIAVLMLSLFILKETR-------------
MDTL_ECO57      AKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMAIMGIAVLMLSLFILKETR-------------
YFMO_BACSU      QAII-LYEAALGLGISVGPLAGGEL-GSISWRAPFFGVSVLMFIALIAISFML-----------------
PHDK_NOCSK      AQMVSIAFAGVGVGSIIGAYLAAAVIPTLGWQ--------------------------------------
YBIH_SCHPO      PMYSGILATAWGAALVAGPIIGGAICQRTTWRWIFFINLPSGIATALIVVFLCERTSFKK----------
YWOG_BACSU      GEGLGYFAMSMNLAMAIGPFLGLNLMRVVSFP-VFFTAFALFMVAGLLVSFLIKVPQSKDSGTTVFRFAF
MDFA_ECOLI      IKITALMANVALIAPLLGPLVGAAWIHVLPWEGMFVLFAALAAISFFGLQRAMPET--------------
MDFA_ECOL6      IKITALMANVALIAPLLGPLVGAAWIHVLPWEGMFVLFAALAAISFFGLQRAMPET--------------
MDFA_ECO57      IKITALMANVALIAPLLGPLVGAAWIHVLPWEGMFVLFAALAAISFFGLQRAMPET--------------
YQO5_SCHPO      GTAITIFAALVFDGPLVSPIIGGFLTKSLGWRWTEYITSFMGFFALVIVYLFCDETYSKAI---------
MDTL_KLEP7      AKVLSLLNGITCIIPVLAPVLGHLIMLKYPWQSLFYTMTGMGVMVAVLSVFILRETR-------------
YN41_SCHPO      GTAITIFAAVIFVGPLVAPIVGGFLTKSLGWRWTEYITSFMGFLSIILIYLFCEETYLKTI---------
VBA2_YEAST      GIFQAFQNLLLGFGAICGASFGGTIASSIGWRWCFLIQVPISVISSILMNY-------------------
BCR_HAEIN       SKVMSTITLVFMLAPLVAPIIGGYIVKFFHWHAIFYVISLVGXXXXXXVFFIIPETHKKENRI-------
YN43_SCHPO      GPAVCIFACITFAGPLIGPIAGGFLAKSLGWRWTEYITSFMGFFSTLCLLFMKE----------------
YDHC_ECOLI      NRIFAAIMPLVGLSPALAPLLGSWLLVHFSWQAIFATLFAITVVLILPIFWLKPTTKARNNSQDGLTF--
NANT_SALTY      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_SALTI      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_SALSV      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_SALPK      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_SALPC      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_SALPB      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_SALPA      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_SALNS      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_SALHS      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_SALG2      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_SALEP      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_SALDC      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_SALCH      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_SALAR      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_ESCF3      NKASGFLISGFSVGAVVAAQVYSLVVPLWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_CITK8      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
YYBF_BACSU      GSAMGLYISGNAIGAVFGRIVSGLLSEYLNWHMIFFINLP------------------------------
YO378_YEAST     NMVFSLFGASAPGGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLFVIPHTPMPSRDASSFKLERIDFAG
YWOD_BACSU      ASALAVLSIFASAMTALGPTAGGFLIVWGGWPAIFIVNLPFIILSFLLGLYMFPKDQKK-----------
Y466_BUCAI      VKSIAAIGVSFAISFLIAVVSGPIIVHYFGFFSIFWISAFLSIVCMIIVCFFV-----------------
NANT_SHIFL      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_SHIF8      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_SHIB3      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_ECOSM      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_ECOSE      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_ECOLI      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_ECOLC      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_ECOL5      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_ECOHS      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_ECODH      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_ECOBW      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_ECO8A      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_ECO7I      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_ECO5E      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_ECO57      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_ECO55      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_ECO45      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_ECO27      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT_ECO24      NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
NANT1_ECOL6     NKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIGILPIIFALWLRKNIPEAEDWKE----------
YB30_YEAST      GKAIAYFMMGPNMGPIIAPIVAGLIMKGNYWRWLFGFTSIMTGIALILVTALLPET--------------
TCR_STAES       GKAFGFIGSIVALGEGLGPSIGGIIAHYIHWSYLLILPM-ITIVTIPFLIKVMVPGKSTKNTLDIVGIVL
TCR_STAAU       GKAFGFIGSIVALGEGLGPSIGGIIAHYIHWSYLLILPM-ITIVTIPFLIKVMVPGKSTKNTLDIVGIVL
SPIN_DROME      SKMLALFYFAIPVGSGLGYIVGSKTAHLANWRWALRVTPILGIVAVFLILLIKD----------------
YN2F_SCHPO      GLVIAVYSAIIFNGPLMSPIVGGFIGKSLGWRWTSYITAIMGFTAF------------------------
SMVA_SALTY      RNMXXXXXXXXXXXXXXXPLIGGILLEHFYWGSVFLINVPIVLVVMGLTA--------------------
MIRC_EMENI      XXXXXXXXXXXXVTVWIGPTIADVVLENSSWRWGYGMWSIIXXXXXXXXXXXXXXNQRKAKRLNLIKEGF
YYAJ_BACSU      GKYISFCAMIGLIGVPITNIVSAFVIPLGSWGWLVFVWGAVGLIYFFFIHRLEESPRWHENRGEY-----
FNX1_SCHPO      GTWQGITNIVWXXXXXXXXXXXXXIAQRWGWRTAFHFQVPMGILSTILVAWRVRVKPTVRSRIDYLGSFL
YHA8_SCHPO      GLAIAFFAAGPYAGPTLGPLVGGWIVGTGDFRWIFWVNMIYMFVMYLTL---------------------
YWTG_BACSU      GALSSLNQLMITVGILLSYIVNYIFADAEAWRWMXXXXXXXXXXXXIGILFMPES---------------
Y588_BUCAI      SFCMGLYISGNTIGGFLGRLLSSILAEKFSW---------------------------------------
PCAK_ACIAD      SLLVTCMFCGYNLGMAIGGFISSWLIPAFGWHSLFLLGAPL-ILMLLVIFFLPESYRFLIVK--------
NANT_YERPY      NKASGFLISGFSIGAVLAAQAYSYVVPAFGWRMLFYIGLLPIIFALWLRKNLPEAEDWEK----------
BCR_ECOLI       SRMMSFVMLVTTIAPLMAPIVGGWVLVWLSWHY-------------------------------------
BENK_ACIAD      TLMFSGYA----IGGMTAAFLGSILVPLYGWKIMFMI---------------------------------
YM8M_YEAST      RKNIVI-SFIGACAPTXXXXXXXXXXDPNQWPWVFYAFGIATFLSLLMAWYSIPPTNIHGLSMDWTGSAL
MDTM_SALTY      IKLMAIITSIVLVAPVIGPLSGAALMHFVHWKVLF-----------------------------------
MDTM_SALTI      IKLMAIITSIVLVAPVIGPLSGAALMHFVHWKVLF-----------------------------------
NANT_YERPS      NKASGFLISGFSIGAVLAAQAYSYVVPAFGWRMLFYIGLLPIIFALWLRKNLPEAEDWEK----------
NANT_YERPP      NKASGFLISGFSIGAVLAAQAYSYVVPAFGWRMLFYIGLLPIIFALWLRKNLPEAEDWEK----------
NANT_YERPG      NKASGFLISGFSIGAVLAAQAYSYVVPAFGWRMLFYIGLLPIIFALWLRKNLPEAEDWEK----------
NANT_YERPB      NKASGFLISGFSIGAVLAAQAYSYVVPAFGWRMLFYIGLLPIIFALWLRKNLPEAEDWEK----------
NANT_YERP3      NKASGFLISGFSIGAVLAAQAYSYVVPAFGWRMLFYIGLLPIIFALWLRKNLPEAEDWEK----------
NANT2_ECOL6     NKXXXXXXXXXXXXXXXXXQVYSIVVPLWGWRSLFFVGMLPILFAFYLRKNLPESDDWQKEKNKYINILL
GALP_ECOLI      GSMISMYQLMITIG-ILGAYLSDAFSYTGAWRWMLGVIIIPAILLLIGVFFLPDS---------------
GALP_ECOL6      GSMISMYQLMITIG-ILGAYLSDAFSYTGAWRWMLGVIIIPAILLLIGVFFLPDS---------------
YVMA_BACSU      GSAMGTYQMLLSVAPAIAPVL-------------------------------------------------
YUBD_BACSU      N-----YALLVLIGGFYGSVIIGTILGTIAWRWLFFIFGTLSLIGVAVSYFFL-----------------
YHJO_BACSU      GRFYAVYGLHWDISRSIGPLAGGLILTSFGGEVIFYALAVCLLTAGLSLTYTIEKLEHKVIR--------
TPO1_YEAST      GKAIALFSLGVFVGPILSPVMGSYIAQRTTWRWLEYVVGCFASAVFVAIVLFFEETHHPTILVN------
NANT_YERPE      NKASGFLISGFSIGAVLAAQAYSYVVLAFGWRMLFYIGLLPIIFALWLRKNLPEAEDWEK----------
NANT_YERPA      NKASGFLISGFSIGAVLAAQAYSYVVLAFGWRMLFYIGLLPIIFALWLRKNLPEAEDWEK----------
MDTL_SHESA      AKVLSMVNGVTCIIPVIAPVIGHLIMLRFPWPSLFY----------------------------------
CSBC_BACSU      GTLGTMNNLMIVTGILLAYIVNYLFTPFEAWRWM------------------------------------
Y567_BUCAP      SFCMGLYISGNTIGGCSGRILSSILAEYFSWH-----------IAFIVIGFFSLMSSCLFLYFLPSSKNF
NANT_SALA4      NK--------------------------------------------------------------------
YCEJ_BACSU      IKGMGIATAGLAASQMLGLPIGGFLA-SFTWHTPFFV---------------------------------
VBA3_YEAST      --VISILSCAFAVAAIVGPIIGGAFTTHVTWRWCFYINLPIGGLAIIMFLLTYKA---------------
TPO3_YEAST      GKAIAFFAFAPYVGPVVGPLVNGFISVSTGMDLIFWVNMAFAGVMWIISSAIPE------------TYAP
BCRH_RICTY      SYVYAILSPWLLFIPSLGSYIGGYIIEYSSWHYVF--------VFFSLIGTILLALYYKILETNY-----
ARAE_KLEOX      GKMISMYQLMVTLGIVMAFLSDTAFSYSGNW---------------------------------------
EXUT_BACSU      ASVIGVTNSGTPLGGAISGPIVGMIAVAFSWKVSFVLIMIIGLIAVLWFKFVKEKPQ-------------
ARAE_ECOLI      GKMISMYQLMVTLGIVLAFLSDTAFSYSGNW---------------------------------------
ARAE_ECO57      GKMISMYQLMVTLGIVLAFLSDTAFSYSGNW---------------------------------------
Y2171_CITK8     GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
SVOPL_HUMAN     RGYMLPLSQVFLAGSLLIIGLASVIIPTIGWRWLIRVSIPILIVAFKFI---------------------
MDTL_SHEON      AKVLSMVNGVTCIIPVIAPVIGHLIMLKFPWPSLFY----------------------------------
TPO2_YEAST      GKAIAFFAFAPYVGPVVGPLVNGFISVSTGMDLIFWVNMAFAGVMWIISSAIPE------------TYAP
NANT_ENTS8      NK--------------------------------------------------------------------
BSU1_SCHPO      GVPMSLFVWACAGGAIGAPMATGVINAKYGWRWLYYINIIVGGFFLIVILIIPETLPIKVI---------
YCAD_SHIFL      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_SHIF8      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_SALTY      GRLLAAYMMVYYMGTFLGQLL-------------------------------------------------
YCAD_SALTI      GRLLAAYMMVYYMGTFLGQLL-------------------------------------------------
YCAD_SALSV      GRLLAAYMMVYYMGTFLGQLL-------------------------------------------------
YCAD_SALPK      GRLLAAYMMVYYMGTFLGQLL-------------------------------------------------
YCAD_SALPC      GRLLAAYMMVYYMGTFLGQLL-------------------------------------------------
YCAD_SALPA      GRLLAAYMMVYYMGTFLGQLL-------------------------------------------------
YCAD_SALNS      GRLLAAYMMVYYMGTFLGQLL-------------------------------------------------
YCAD_SALHS      GRLLAAYMMVYYMGTFLGQLL-------------------------------------------------
YCAD_SALCH      GRLLAAYMMVYYMGTFLGQLL-------------------------------------------------
YCAD_SALA4      GRLLAAYMMVYYMGTFLGQLL-------------------------------------------------
CYHR_CANMA      SIALGVWSIFAVAGPSIGPLIGAAVINRSGWRWSFWFMAILSGVCFIVLSFSLPET--------------
BCRH_RICPR      SYVYAILSPWLLFIPALGSYIGGYIIEYLSWHYVF-----------------------------------
YCAD_ESCF3      GRLLAAYMMIYYVGTFLGQLL-------------------------------------------------
S17A5_MOUSE     SKLLTISYAGAQLGTVISLPLSGIICYYMNWTYVFYLFGIVGIVWFILWMWIVSDTPETHKTISHYEKEY
MUCK_ACIAD      GTLQAGWT----VGYIVATLLAGWLIPDHGWRVLFYVAIIPVLMAVLMHFFVPE----------------
YCAD_SHISS      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_SHIDS      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_ECOUT      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_ECOSM      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_ECOSE      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_ECOLU      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_ECOLI      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_ECOLC      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_ECOL6      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_ECOL5      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_ECOK1      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_ECOHS      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_ECODH      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_ECOBW      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_ECO8A      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_ECO81      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_ECO7I      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_ECO5E      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_ECO57      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_ECO55      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_ECO45      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_ECO27      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
YCAD_ECO24      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
SPNS1_DANRE     TNMLSIFYFAIPVGSGMGYIVGSKVTVAKDWHWALRV---------------------------------
YITG_BACSU      SKVLGLVEASNGMGKVLSPIIGSLIA-LLVWYGAFFAFPVFCIISIVL----------------------
YCAD_SALEP      GRLLAAYMMAYYMGTFLGQLL-------------------------------------------------
VACHT_DANRE     SRALGIALAFISFGSLVAPPFGGILYEFAGKRVPFIVLACVCLADGVLL---------------------
PMRA_STRR6      SRVFAFNQVFFYLGGVVGPMAGSAVAGQFGYHAVFYA-TSLC-VAFSCLFNLIQFRTLLKVK--------
PMRA_STRPN      SRVFAFNQVFFYLGGVVGPMAGSAVAGQFGYHAVFYA-TSLC-VAFSCLFNLIQFRTLLKVK--------
BMR2_BACSU      SKAMGYVSAAI-----------------------------------------------------------
YCAD_SALPB      GRLLAAYMMVYYMGTFLGQLL-------------------------------------------------
MDTD_SHIDS      --------------------------EYASWHWIFLINIPVGIIGAIATLMLMPNYTMQTRRFDLSGFLL
YCAD_SALAR      GRLLAAYMMVYYVGTFLGQLL-------------------------------------------------
SVOPL_MOUSE     RGYMLPLSQVFLAGSLLIISMASVVIPTIGWRWLIRIASIPGIILIMAFKFIPESAR-------------
S17A5_HUMAN     SKLLSISYAGAQLGTVISLPLSGIICYYMNWTYVFYFFGTIGIFWFLLWIWLVSDTPQKHKRISHYEKEY
DGOT_ECOLI      ASAVGFYTSGQFVGLAFLTPLLIWIQEMLSWHWVFIVTGGIGIIWSLIWFKVYQPPRISKAELDYIR---
DGOT_ECOL6      ASAVGFYTSGQFVGLAFLTPLLIWIQEMLSWHWVFIVTGGIGIIWSLIWFKVYQPPRISKAELDYIR---
YAJR_ECOLI      TKAMAFFAIAMVLGPIITHKLG------------------------------------------------
Y1560_METJA     GEYMGIFNSAITLXXXXXXXXXXXLADMYGIKMPFYFCGFLGILAAIISYMKLEDIVFNKNK--------
S22A2_RAT       RRMVGIYQIAFTVGLLI---LAGVAYVIPNWRWLFAVTLP------------------------------
ITR2_SCHPO      GRLVIIYVVFITGGQLIAYSLNAAF-EHVHQGW-------------------------------------
YFIS_BACSU      QQAVSVSSIIDNSSKIFGPALGGTLIAAFSIHSVFYINAGAFFLSAVILFFLPRDAFLQK----------
MSSP3_ARATH     GLLNTFPQFCGSGGMFLSLVFGMSLQESPSWRLMLGVLSIPSIAYFVLAAFFL-----------------
EMRD_ECOLI      RHANSLLNMGILVSPLLAPLIGGLLDTMWNWRACYLFLLVLCAVTFSMARWMPETRPV------------
BBEX_BACSU      GTISSFYNSMRFIGVALGPPVFAALMSNANW-IIFILSAFCSIVSLFLVLFTVDAKKSEEEK--------
YCAD_SALG2      GRLLAAYMMAYYMGTFLGQLL-------------------------------------------------
YCAD_SALDC      GRLLAAYMMAYYMGTFLGQLL-------------------------------------------------
AQR1_YEAST      GTFVGATSGFVLLGQCFGSLIGAVLTARWDWRAIFWFLTIGCGSCFLIAFLILPETK-------------
SVOPL_DANRE     RALLPLASIFWMMGSILIIVLGMTVVPTMGWRWMIRFSVIPSLVLIGLFMFIPESARFQ-----------
YUXJ_BACSU      GKTLGTLQMGQVSGSLFGPLLGGMLAD-------------------------------------------
VMAT2_RAT       GSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTI-IGIIDIAFAPLCFFLRSPPAKEEKM-------
UHPT_CHLPN      GTWWSVWSTSHNIGGALIPILTGFIIDYSGWRGAMYVPGILCI---------------------------
GTR9_HUMAN      GSLGQVTAIFICIGVFTGQLLGELLGKESTWPYLFGVIVVPAVVQLLSLPFLPDS---------------
BMRP_CANAL      PVGLAAWSLGAVCGPSFGPFFGSILTVKASWRWTFWFMCIISGFSFVMLCFTLPET--------------
Y1421_ENT38     GRLLAAYMMVYYVGTVLGQLM-------------------------------------------------
TPO4_YEAST      SVAMTYFVLSPFLGPVLSPIMAGFATEAKGWRWSEWIQLIAGGLILPFIALMPE----------------
S17A4_MOUSE     SQLITIAASGSMLGTFLVLIAGGLICQALGWPYIFYI---------------------------------
VACHT_DROME     SQALGIALAFISFGCLVAPPFGGAL---------------------------------------------
S22A2_MOUSE     RRTVGIYQIAFTVGLLI---LAGVAYALPNWRWLFAVTLP------------------------------
PMRA_LACLA      SRIFAYAQMCSNLGMVTGPLVGSAIAGYISYR-AAIVGTSLFVIVNIIWSFINFRKYLRKRSI-------
GTR9_PONAB      GSLGQVTAIFICIGVFTGQLLGELLGKESTWPYLFGVIVVPAVVQLLSLPFLPDS---------------
FSLK_DICDI      ---------------IINAILWFSINSFELWFQIKFIKRKLHLIKFYILAVLVISIALS---VPLSAIGE
YJHB_ECOLI      SKASAFLVSGFSVGNIIAAQIIPQFAEVYGWRNSFFIGLPVLLVLWI-----------------------
UHPT_CHLTR      GTWWSVWSTSHNIGGALIPVLTGVAIDYTGW---------------------------------------
SPNS1_XENLA     TRMLSFFYFATPVGCGLGYIVGSEMTSAADWHWALRV---------------------------------
PLST3_ARATH     GSSTQIATCIGLLGSLFA---GIPAKDNLGWWRIFWISTVPAAMLAVFMELCVESPQ-------------
OXLT_OXAFO      G----FFWAAKATASIFGGGLGAAIATNFGWNTAFLITAITSFIAFALATFVI-----------------
ANTR1_ARATH     SRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFY----------------------------------
HOL1_YEAST      GSVLTVYIMCTSIGTFLGPLIAGYISAFTNFRWVGWVAVIISGGLLITIIFGCEET--------------
YN22_SCHPO      TYVLPGFCTXXXXXXXXXXXXXDFICQSLGWCWVFWINMIMGAVVIVIIFFFMPETHGDTI-LDY-----
VMAT2_MOUSE     GSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTI-IGIIDIVFAPLCFFLRSPPAKEEKM-------
VMAT2_BOVIN     GSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTI-IGIIDILFAPLCFFLRSPPAKEEKM-------
TUB4_AGRVI      AAVTAIFMAAAPLSTVLGSPISGALMEMAGWQWMFLIEAAPAVILGVVVLFYL-----------------
NPT1_HUMAN      GRLTSMSTSGFLLGPFIVLLVTGVICESLGWPMVFYIGCAVCLLWFVL----------------------
MHPT_ECOLI      ----------------------------------------------------------------------
LTAA_STAS1      EETWGVFNSVQGFGSMIGPLVGGLITE-------------------------------------------
YQ92_SCHPO      XSTMGGIFGFISLGEIIAPVFGGIVYESLGYYASFGVCFIILLLDIALRFLMIEPREMK-----------
YMPB_CAEEL      AWITVVYNVAWSLG-MVWTLLVTLMTDDWRWRY-FIVSLP-GVYGFALWYFLPESEKLKKISLVYFAISF
YCEI_BACSU      GRVIVLLESFWAVGWLAAALISYFVIPSFGWQ--------------------------------------
VMAT2_HUMAN     GSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTI-IGIIDILFAPLCFFLRSPPAKEEKM-------
TUB3_AGRVI      AAVTALFMAAAPLSTVLGSPISGALMEMAGWQWMFLIEAAPALILGVVVLFFL-----------------
CMLA_PSEAE      NVIYGILGSMLAMVPAVGPLLGALVDMWLGWRAIF-----------------------------------
YWFA_BACSU      GLIVSSWSLALIFGVPLGSFIGGV----LHWRWTFWI---------------------------------
YIQ6_YEAST      TFRLSFFWCAIPLFQILGSLLASGIIENLAWQYLFIIEGFLSLSVGVASFYLM-----------------
YDGK_BACSU      SKFFSLLMVITAVAPMVAPMTGGAILPFATWHTIFHVLMIIGFLLVLLIALRLKET--------------
Y411_BUCBP      IKIMGLLGVSFGISFFLAVILSPIIVNMFGFYCLFLINSLLSIFCLFFGMFYIPASLLNK----------
Y2680_YERPY     GQLLAAYMMVYYLGTVIGQLLLGIV---------------------------------------------
Y2592_YERP3     GQLLAAYMMVYYLGTVIGQLLLGIV---------------------------------------------
Y2315_YERPP     GQLLAAYMMVYYLGTVIGQLLLGIV---------------------------------------------
Y1506_YERPB     GQLLAAYMMVYYLGTVIGQLLLGIV---------------------------------------------
Y1405_YERPS     GQLLAAYMMVYYLGTVIGQLLLGIV---------------------------------------------
Y1380_YERPE     GQLLAAYMMVYYLGTVIGQLLLGIV---------------------------------------------
XYLL3_ARATH     GTLISLKELFIVLGILLGFSVGSFQIDVVGWRYMYGFGTPVALL--------------------------
SPNS3_MOUSE     TCALAVFYIFIPVGSGLGYVLGSTVAETGNWRW-------------------------------------
S22A1_RABIT     RRTVAIYQVAFSVGLV---ALSGVAYAIPNWRWLLTVSLPTFLCLF------------------------
GTR4_HUMAN      GALGTLNQLAIVIGILIAQVLG------------------------------------------------
ANTR3_ARATH     ASAVGISMAGFHMGNVVGLLL-------------------------------------------------
Y450_BUCAP      IKSISIIGVSFAVSFLISVVSAPIIAENFGFFSIFW----------------------------------
S17A5_SHEEP     SKLLSISYAGAQLGTVVSLPLSGVICYYMNWTYVFYFFGIVGIIWFIL----------------------
YOU1_CAEEL      AKCVVLIESFWAIGAVFEALLAYFVMESFGWRALMFLSLPLGIFA-------------------------
YHK8_YEAST      GIPMAIYTTSAFLGPSLGPIIGGAL-YHQSYKWTFITLLITSGCCLVMIIFTIPET--------------
YFKF_BACSU      PAGNLLCGITFSLGSILGPVAGGWYMQTFESANLFY----------------------------------
UHPT_CHLMU      GTWWSVWSTSHNIGGALIPVLTGIAIDYAGW---------------------------------------
PLST1_ARATH     GSLGTLCQIGTCLGIIFSLLLGIPAEDDPHW---------------------------------------
NU4C_NEPOL      STCMLLAGILLKMG-------GYALIRNMNMPWLIGVGV----VNIIYAALTSFAQRNLKRKIAYSSMGF
MFS1_SCHPO      PYFMCFWSXXXXXXXXXXXXXXXXMVVAKSWRWQFWLLMMISALVLVIITFFMPET--------------


                         .         .         .         +         .         .         .:280
query           MAIGVGCLELFIDNGNTNGWFSSIKMIILLAISLVSIGFFIWRGLIYSSXXXXXXXXXXXXXLACFLCFM
EMRB_ECOLI      LVIGIGSLQIMLDRGKELDWFSSQEXXXXXXXXXXXXCFLIWELTDDNPIVDLSLFKSRNFTIGCLCISL
EMRB_ECO57      LVIGIGSLQIMLDRGKELDWFSSQEXXXXXXXXXXXXCFLIWELTDDNPIVDLSLFKSRNFTIGCLCISL
EMRB_HAEIN      XXXXXXXXXXXXDQGREQDWFNSNEXXXXXXXXXXXXXXXXWELTDDNPVVDISLFHSRNFSVGCLCTSL
EMRY_ECOLI      XXXXXXXXQIMLDKGRDLDWFNXXXXXXXXXXXXXXXXXXXWESTSENPILDLSLFKSRNFTIGIVSITC
MDTD_YERPY      LAIGMATLTLALD-GHTGLGLSPLAIAGLILCGVIALGSYWWHAL-------------------------
MDTD_YERPP      LAIGMATLTLALD-GHTGLGLSPLAIAGLILCGVIALGSYWWHAL-------------------------
MDTD_YERPN      LAIGMATLTLALD-GHTGLGLSPLAIAGLILCGVIALGSYWWHAL-------------------------
MDTD_YERPG      LAIGMATLTLALD-GHTGLGLSPLAIAGLILCGVIALGSYWWHAL-------------------------
MDTD_YERPE      LAIGMATLTLALD-GHTGLGLSPLAIAGLILCGVIALGSYWWHAL-------------------------
MDTD_YERPB      LAIGMATLTLALD-GHTGLGLSPLAIAGLILCGVIALGSYWWHAL-------------------------
MDTD_YERPA      LAIGMATLTLALD-GHTGLGLSPLAIAGLILCGVIALGSYWWHAL-------------------------
MDTD_YERP3      LAIGMATLTLALD-GHTGLGLSPLAIAGLILCGVIALGSYWWHAL-------------------------
BMR3_BACSU      LVVSIVCLMFALELGGKTYDWNSIQIIGLXXXXXXXISFWMFKNRLFAT--------------AQILAFL
MDTD_YERPS      LAIGMATLTLALD-GHTGLGLSPLAIAGLILCGVIALGSYWWHAL-------------------------
MDTD_PECCP      LAVGMATLTLALD-GNRSLGIPPIAIFALITVGLIAL---------------------------------
MDTD_SERP5      LAVGMATLTLALD---------------------------------------------------------
MDTD_YERE8      LAIGMATLTLALD---------------------------------------------------------
YHCA_BACSU      SIVGFASLLYGVSEAGSDGWTDPIVLSTXXXXXXXXXXXXXQQLRHDDPMLDFRVFKYDIFSLSSVINII
YEBQ_ECOLI      NALTFGLLITAL-SGFAQG--QSLTLIAAELVVMVVVGIFFIRRQXXXXXXXXXXXXXXXXXFSLSIC-T
LMRB_LISIN      STLGFGGVVFAFSSAGENGW-GSATVLVSIIVGGIALGLFVWRQLMEKPLMDLKVFKYPMFTLGLILVFI
MDTD_ECOL6      LAVGMAVLTLALDGSKGTGF--------------------------------------------------
MDTD_ECO81      LAVGMAVLTLALDGSKGTGF--------------------------------------------------
LMRB_LISMO      STLGFGGVVFAFSSAGESGW-GSATVLVSIIVGGIALGLFVWRQLMEKPLMDLKVFKYPMFTLGLILVFI
MDTD_SHIF8      LAVGMAVLTLALDGSKGTG---------------------------------------------------
MDTD_ESCF3      LAVGMAVLTLALDGSKGTG---------------------------------------------------
MDTD_ECOUT      LAVGMAVLTLALDGSKGTGF--------------------------------------------------
MDTD_ECOLU      LAIGMAVLTLALDGSKGTG---------------------------------------------------
MDTD_ECOK1      LAVGMAVLTLALDGSKGTGF--------------------------------------------------
MDTD_ECO45      LAVGMAVLTLALDGSKGTGF--------------------------------------------------
MDTD_SHISS      LAVGMAVLTLALDGSKGTG---------------------------------------------------
MDTD_SHIFL      LAVGMAVLTLALDGSKGTG---------------------------------------------------
MDTD_SHIBS      LAVGMAVLTLALDGSKGTG---------------------------------------------------
MDTD_SHIB3      LAVGMAVLTLALDGSKGTG---------------------------------------------------
MDTD_ECOSM      LAVGMAVLTLALDGSKGTG---------------------------------------------------
MDTD_ECOSE      LAVGMAVLTLALDGSKGTG---------------------------------------------------
MDTD_ECOLI      LAVGMAVLTLALDGSKGTG---------------------------------------------------
MDTD_ECOLC      LAVGMAVLTLALDGSKGTG---------------------------------------------------
MDTD_ECOL5      LAVGMAVLTLALDGSKGTG---------------------------------------------------
MDTD_ECOHS      LAVGMAVLTLALDGSKGTG---------------------------------------------------
MDTD_ECODH      LAVGMAVLTLALDGSKGTG---------------------------------------------------
MDTD_ECOBW      LAVGMAVLTLALDGSKGTG---------------------------------------------------
MDTD_ECO8A      LAVGMAVLTLALDGSKGTG---------------------------------------------------
MDTD_ECO7I      LAVGMAVLTLALDGSKGTG---------------------------------------------------
MDTD_ECO5E      LAVGMAVLTLALDGSKGTG---------------------------------------------------
MDTD_ECO57      LAVGMAVLTLALDGSKGTG---------------------------------------------------
MDTD_ECO55      LAVGMAVLTLALDGSKGTG---------------------------------------------------
MDTD_ECO27      LAVGMAVLTLALDGSKGTG---------------------------------------------------
MDTD_ECO24      LAVGMAVLTLALDGSKGTG---------------------------------------------------
MDTD_CITK8      LAVGMAVLTMALDGSKGTG-LSPLSLGALVLCGILAIALYL-----------------------------
MDTD_SALSV      LAIGMAVLTLALDGSKSMG---------------------------------------------------
SGE1_YEAST      SSAGFTLLMLGLSGGNNFPWFFTVGPILLLLFCAYDFHFLSLSGLHYDNLLTWNIASNCGIFTSSITGFL
HSRA_ECOLI      XXXXXXXIELFGE--------KIVASWIALTVIVTSIGLL----LLYILHARRTPNPLISLDLFKTRTFS
MDTD_SALTI      LAIGMAVLTLALDGSKSMG---------------------------------------------------
MDTD_SALPK      LAIGMAVLTLALDGSKSMG---------------------------------------------------
MDTD_SALPB      LAIGMAVLTLALDGSKSMG---------------------------------------------------
MDTD_SALPA      LAIGMAVLTLALDGSKSMG---------------------------------------------------
MDTD_SALNS      LAIGMAVLTLALDGSKSMG---------------------------------------------------
MDTD_SALHS      LAIGMAVLTLALDGSKSMG---------------------------------------------------
MDTD_SALEP      LAIGMAVLTLALDGSKSMG---------------------------------------------------
MDTD_SALDC      LAIGMAVLTLALDGSKSMG---------------------------------------------------
MDTD_SALA4      LAIGMAVLTLALDGSKSMG---------------------------------------------------
MDTD_SALTY      LAIGMAVLTLALDGSKSMG---------------------------------------------------
MDTD_ERWCT      LAVGMATLTLALDGNRS-----------------------------------------------------
MDTD_ENT38      XXXXXXXXXXXXD-GQKGLGISTLTLCLLIVIGIVSILWYLW----------------------------
TCMA_STRGA      ----------------------------------------------------------------------
LMRB_BACSU      STIGFGGIVFGFSNAGSGGWSSPTXXXXXXXXXXXXXXXXXRQLTMKQPMMNLRAFKYPMFILGVIMVFI
YUSP_BACSU      MIVGVVSLLLALSGGKDYAWDSWQXXXXXXXXXXXXVSFIIVESKAKEPILPMYLFKNRTFTFLNLIGFF
HSRA_HAEIN      FALGLVGITLGLDLLGESQHNSSVTYSILVVGILLLVTYCGYAKNNENAILPLSLFRTRTFRLGIIANIF
YCNB_BACSU      ----------------------------------------------------------------------
QACA_STAAU      SIAGMIGLVWSIKEFSKEGLADIIPVVIVLAITMIVI--FVKRNL-------------------------
QACA_STAAM      SIAGMIGLVWSIKEFSKEGLADIIPVVIVLAITMIVI--FVKRNL-------------------------
MDTD_ENTS8      ----------------------------------------------------------------------
MDTD_KLEP3      ----------------------------------------------------------------------
MDTD_KLEP7      ----------------------------------------------------------------------
YFIU_BACSU      LAVMYGMTNL--DGANLLHSLGNPEV-----YGCIIFGILCFAALISYEKRVEMRGGDPILAYSLLRNHM
BAIG_EUBSP      AALVVVFFSLFLSFGQNIGWSSTXXXXXXXXXXXXXXXXXMVEKKAKSPIMNGKFMARKEFVLPVLILFL
YJA1_SCHPO      ----------------------------------------------------------------------
YAN6_SCHPO      ITTGVVLFLVGLNIGSTTGHWAHANVLCYLIFGILCIAGFVVNEFYTTRTRIITPSAFKTLSLTSVMSFL
VBA5_YEAST      ----------------------------------------------------------------------
MMR_STRCO       WIVALAAVSFALIEGPQLGW--------------------------------------------------
TCR_STRPN       ILMSVGIVFFML--------FTTSYSISFLIVSVLSFLIFVKHIRKVTDPFVDPGLGKNIPFMIGVLCGG
TCR_BACSU       ILMSVGIVFFML--------FTTSYSISFLIVSVLSFLIFVKHIRKVTDPFVDPGLGKNIPFMIGVLCGG
TCR_BACST       ILMSVGIVFFML--------FTTSYSISFLIVSVLSFLIFVKHIRKVTDPFVDPGLGKNIPFMIGVLCGG
TCR_BACCE       ILMSVGIVFFML--------FTTSYSISFLIVSVLSFLIFVKHIRKVTDPFVDPGLGKNIPFMIGVLCGG
MDTL_SALAR      ----------------------------------------------------------------------
YI32_SCHPO      ----------------------------------------------------------------------
MDTM_ECOLI      KSVNVFCNRLFLFGAATIS-LSYIPMMSWVAVSPV-----------------------------------
MDTM_ECO57      KSVNVFCNRLFLFGAATIS-LSYIPMMSWVAVSPV-----------------------------------
YVKA_BACSU      LLLAGSIVSIILLTKNEAPWYTVYSVLILLFVPL------------------------------------
YCT4_SCHPO      ----------------------------------------------------------------------
TCR_STRAG       ILMSVGIVFFML--------FTTSYSISFLIVSVLSFLIFVKHIRKVTDPFVDPGLGKNILFMIGVLCGG
MDTL_SALPK      ----------------------------------------------------------------------
MDTL_SALPA      ----------------------------------------------------------------------
MDTL_SALEP      ----------------------------------------------------------------------
MDTL_SALDC      ----------------------------------------------------------------------
MDTL_SALTI      ----------------------------------------------------------------------
TCRB_BACSU      MSAGIVFFMLF-----------------------------------------------------------
MDTL_SALTY      ----------------------------------------------------------------------
MDTL_SALPC      ----------------------------------------------------------------------
MDTL_SALPB      ----------------------------------------------------------------------
MDTL_SALNS      ----------------------------------------------------------------------
MDTL_SALHS      ----------------------------------------------------------------------
MDTL_SALCH      ----------------------------------------------------------------------
MDTL_SALA4      ----------------------------------------------------------------------
AZR1_YEAST      ----------------------------------------------------------------------
MDTL_SALSV      ----------------------------------------------------------------------
MMR_BACSU       GMMALGFLSYALIQGPSAGWRSPV----------------------------------------------
MDTL_VIBPA      ----------------------------------------------------------------------
YHX6_SCHPO      ----------------------------------------------------------------------
YHD3_SCHPO      GVSGLVLINFSWNQGPVVGW-QVPYVYILLIIGFLSLXXXXXXXXXXXQPILAPSMMNSEMGCVLICVAA
TCR_STAHY       ILMSVGIVFFML--------FTTSYSISFLIVSVLSFLIFVKHIRKVTDPFVDPGLGKNIPFMIGVLCGG
MDTL_ECOL6      ----------------------------------------------------------------------
MDTL_ECO81      ----------------------------------------------------------------------
ATR1_YEAST      ----------------------------------------------------------------------
ACT22_STRCO     VTSGLTLLIFPLVQGRERGW--------------------------------------------------
MDTL_ECOL5      ----------------------------------------------------------------------
MDTL_ECO27      ----------------------------------------------------------------------
MDTL_ECOUT      ----------------------------------------------------------------------
MDTL_ECOK1      ----------------------------------------------------------------------
MDTL_ECO45      ----------------------------------------------------------------------
YN42_SCHPO      ----------------------------------------------------------------------
MDTL_KLEP3      ----------------------------------------------------------------------
MDTL_ESCF3      ----------------------------------------------------------------------
MDTL_ECOSM      ----------------------------------------------------------------------
MDTL_ECOLU      ----------------------------------------------------------------------
CMCT_NOCLA      ----------------------------------------------------------------------
MDTL_SHISS      ----------------------------------------------------------------------
MDTL_SHIFL      ----------------------------------------------------------------------
MDTL_SHIF8      ----------------------------------------------------------------------
MDTL_SHIBS      ----------------------------------------------------------------------
MDTL_SHIB3      ----------------------------------------------------------------------
MDTL_ECOSE      ----------------------------------------------------------------------
MDTL_ECOLI      ----------------------------------------------------------------------
MDTL_ECOLC      ----------------------------------------------------------------------
MDTL_ECOHS      ----------------------------------------------------------------------
MDTL_ECODH      ----------------------------------------------------------------------
MDTL_ECOBW      ----------------------------------------------------------------------
MDTL_ECO8A      ----------------------------------------------------------------------
MDTL_ECO7I      ----------------------------------------------------------------------
MDTL_ECO55      ----------------------------------------------------------------------
MDTL_ECO24      ----------------------------------------------------------------------
MDTL_CITK8      ----------------------------------------------------------------------
MDTL_SHIDS      ----------------------------------------------------------------------
MDTL_ECO5E      ----------------------------------------------------------------------
MDTL_ECO57      ----------------------------------------------------------------------
YFMO_BACSU      ----------------------------------------------------------------------
PHDK_NOCSK      ----------------------------------------------------------------------
YBIH_SCHPO      ----------------------------------------------------------------------
YWOG_BACSU      SALKIATVGLFI----------------------------------------------------------
MDFA_ECOLI      ----------------------------------------------------------------------
MDFA_ECOL6      ----------------------------------------------------------------------
MDFA_ECO57      ----------------------------------------------------------------------
YQO5_SCHPO      ----------------------------------------------------------------------
MDTL_KLEP7      ----------------------------------------------------------------------
YN41_SCHPO      ----------------------------------------------------------------------
VBA2_YEAST      ----------------------------------------------------------------------
BCR_HAEIN       ----------------------------------------------------------------------
YN43_SCHPO      ----------------------------------------------------------------------
YDHC_ECOLI      ----------------------------------------------------------------------
NANT_SALTY      ----------------------------------------------------------------------
NANT_SALTI      ----------------------------------------------------------------------
NANT_SALSV      ----------------------------------------------------------------------
NANT_SALPK      ----------------------------------------------------------------------
NANT_SALPC      ----------------------------------------------------------------------
NANT_SALPB      ----------------------------------------------------------------------
NANT_SALPA      ----------------------------------------------------------------------
NANT_SALNS      ----------------------------------------------------------------------
NANT_SALHS      ----------------------------------------------------------------------
NANT_SALG2      ----------------------------------------------------------------------
NANT_SALEP      ----------------------------------------------------------------------
NANT_SALDC      ----------------------------------------------------------------------
NANT_SALCH      ----------------------------------------------------------------------
NANT_SALAR      ----------------------------------------------------------------------
NANT_ESCF3      ----------------------------------------------------------------------
NANT_CITK8      ----------------------------------------------------------------------
YYBF_BACSU      ----------------------------------------------------------------------
YO378_YEAST     SVTGVVGLILFWNQGPVVGWQTPYTYALLI----------------------------------------
YWOD_BACSU      ----------------------------------------------------------------------
Y466_BUCAI      ----------------------------------------------------------------------
NANT_SHIFL      ----------------------------------------------------------------------
NANT_SHIF8      ----------------------------------------------------------------------
NANT_SHIB3      ----------------------------------------------------------------------
NANT_ECOSM      ----------------------------------------------------------------------
NANT_ECOSE      ----------------------------------------------------------------------
NANT_ECOLI      ----------------------------------------------------------------------
NANT_ECOLC      ----------------------------------------------------------------------
NANT_ECOL5      ----------------------------------------------------------------------
NANT_ECOHS      ----------------------------------------------------------------------
NANT_ECODH      ----------------------------------------------------------------------
NANT_ECOBW      ----------------------------------------------------------------------
NANT_ECO8A      ----------------------------------------------------------------------
NANT_ECO7I      ----------------------------------------------------------------------
NANT_ECO5E      ----------------------------------------------------------------------
NANT_ECO57      ----------------------------------------------------------------------
NANT_ECO55      ----------------------------------------------------------------------
NANT_ECO45      ----------------------------------------------------------------------
NANT_ECO27      ----------------------------------------------------------------------
NANT_ECO24      ----------------------------------------------------------------------
NANT1_ECOL6     ----------------------------------------------------------------------
YB30_YEAST      ----------------------------------------------------------------------
TCR_STAES       MSISIICFMLFTTNYN------------------------------------------------------
TCR_STAAU       MSISIICFMLFTTNYN------------------------------------------------------
SPIN_DROME      ----------------------------------------------------------------------
YN2F_SCHPO      ----------------------------------------------------------------------
SMVA_SALTY      ----------------------------------------------------------------------
MIRC_EMENI      VAFGLALLSLTLAANTKNGWKSNVAMIVIGVVCLILLPFWETXXXXXXXXXXXXXXXXQRTALACLAFFY
YYAJ_BACSU      ----------------------------------------------------------------------
FNX1_SCHPO      LVTGITALVVTFNMG-------------------------------------------------------
YHA8_SCHPO      ----------------------------------------------------------------------
YWTG_BACSU      ----------------------------------------------------------------------
Y588_BUCAI      ----------------------------------------------------------------------
PCAK_ACIAD      ----------------------------------------------------------------------
NANT_YERPY      ----------------------------------------------------------------------
BCR_ECOLI       ----------------------------------------------------------------------
BENK_ACIAD      ----------------------------------------------------------------------
YM8M_YEAST      AIIGLILFNFVWNQAPIVGW--------------------------------------------------
MDTM_SALTY      ----------------------------------------------------------------------
MDTM_SALTI      ----------------------------------------------------------------------
NANT_YERPS      ----------------------------------------------------------------------
NANT_YERPP      ----------------------------------------------------------------------
NANT_YERPG      ----------------------------------------------------------------------
NANT_YERPB      ----------------------------------------------------------------------
NANT_YERP3      ----------------------------------------------------------------------
NANT2_ECOL6     SCIAFACLYVCFSGVTANAALITVMALCCAAVFI----SFIYQGM----------GKRWPTGIMLMLVVM
GALP_ECOLI      ----------------------------------------------------------------------
GALP_ECOL6      ----------------------------------------------------------------------
YVMA_BACSU      ------------------------------------------------------------------LSFV
YUBD_BACSU      ----------------------------------------------------------------------
YHJO_BACSU      ----------------------------------------------------------------------
TPO1_YEAST      ----------------------------------------------------------------------
NANT_YERPE      ----------------------------------------------------------------------
NANT_YERPA      ----------------------------------------------------------------------
MDTL_SHESA      ----------------------------------------------------------------------
CSBC_BACSU      ----------------------------------------------------------------------
Y567_BUCAP      YPISID-FNKFLKNFYLH--LKNPTLLILFAIGFMLMGSFI-----------------------------
NANT_SALA4      ----------------------------------------------------------------------
YCEJ_BACSU      ----------------------------------------------------------------------
VBA3_YEAST      ----------------------------------------------------------------------
TPO3_YEAST      VILKRKAARLRKETGNP-------KIMTEQEAQGVSMGEMMRACLL---RPLYFSVTEPVLVATCFVCLI
BCRH_RICTY      ----------YIDFSQSSKYFEVFNIIIILWLYAFIIGAF--NGIYY----------------GFFIEAP
ARAE_KLEOX      ----------------------------------------------------------------------
EXUT_BACSU      ----------------------------------------------------------------------
ARAE_ECOLI      ----------------------------------------------------------------------
ARAE_ECO57      ----------------------------------------------------------------------
Y2171_CITK8     ----------------------------------------------------------------------
SVOPL_HUMAN     ----------------------------------------------------------------------
MDTL_SHEON      ----------------------------------------------------------------------
TPO2_YEAST      VILKRKAARLRKETGNTEQEAQGVSMSEMMRACLLRPLYF--------------AVTEPVLVATCFVCLI
NANT_ENTS8      ----------------------------------------------------------------------
BSU1_SCHPO      ----------------------------------------------------------------------
YCAD_SHIFL      ----------------------------------------------------------------------
YCAD_SHIF8      ----------------------------------------------------------------------
YCAD_SALTY      ----------------------------------------------------------------------
YCAD_SALTI      ----------------------------------------------------------------------
YCAD_SALSV      ----------------------------------------------------------------------
YCAD_SALPK      ----------------------------------------------------------------------
YCAD_SALPC      ----------------------------------------------------------------------
YCAD_SALPA      ----------------------------------------------------------------------
YCAD_SALNS      ----------------------------------------------------------------------
YCAD_SALHS      ----------------------------------------------------------------------
YCAD_SALCH      ----------------------------------------------------------------------
YCAD_SALA4      ----------------------------------------------------------------------
CYHR_CANMA      ----------------------------------------------------------------------
BCRH_RICPR      ----------------------------------------------------------------------
YCAD_ESCF3      ----------------------------------------------------------------------
S17A5_MOUSE     I---VSSLKNQLSSQKVVPWGSILKSLPLWAIVVAHFSY-------------------------------
MUCK_ACIAD      ----------------------------------------------------------------------
YCAD_SHISS      ----------------------------------------------------------------------
YCAD_SHIDS      ----------------------------------------------------------------------
YCAD_ECOUT      ----------------------------------------------------------------------
YCAD_ECOSM      ----------------------------------------------------------------------
YCAD_ECOSE      ----------------------------------------------------------------------
YCAD_ECOLU      ----------------------------------------------------------------------
YCAD_ECOLI      ----------------------------------------------------------------------
YCAD_ECOLC      ----------------------------------------------------------------------
YCAD_ECOL6      ----------------------------------------------------------------------
YCAD_ECOL5      ----------------------------------------------------------------------
YCAD_ECOK1      ----------------------------------------------------------------------
YCAD_ECOHS      ----------------------------------------------------------------------
YCAD_ECODH      ----------------------------------------------------------------------
YCAD_ECOBW      ----------------------------------------------------------------------
YCAD_ECO8A      ----------------------------------------------------------------------
YCAD_ECO81      ----------------------------------------------------------------------
YCAD_ECO7I      ----------------------------------------------------------------------
YCAD_ECO5E      ----------------------------------------------------------------------
YCAD_ECO57      ----------------------------------------------------------------------
YCAD_ECO55      ----------------------------------------------------------------------
YCAD_ECO45      ----------------------------------------------------------------------
YCAD_ECO27      ----------------------------------------------------------------------
YCAD_ECO24      ----------------------------------------------------------------------
SPNS1_DANRE     ----------------------------------------------------------------------
YITG_BACSU      ----------------------------------------------------------------------
YCAD_SALEP      ----------------------------------------------------------------------
VACHT_DANRE     ----------------------------------------------------------------------
PMRA_STRR6      ----------------------------------------------------------------------
PMRA_STRPN      ----------------------------------------------------------------------
BMR2_BACSU      ----------------------------------------------------------------------
YCAD_SALPB      ----------------------------------------------------------------------
MDTD_SHIDS      LAVGMAVLTLALDGSKGTG---------------------------------------------------
YCAD_SALAR      ----------------------------------------------------------------------
SVOPL_MOUSE     ----------------------------------------------------------------------
S17A5_HUMAN     I---LSSLRNQLSSQKSVPWVPILKSLPLWAIVVAHFSY-------------------------------
DGOT_ECOLI      ------------DGGGLVDGDAPVKKEARQPLTAKDWKLVFHRKLI--------GVYLGQFAVASTLWFF
DGOT_ECOL6      ------------DGGGLVDGDAPVKKEARQPLTAKDWKLVFHRKLI--------GVYLGQFAVASTLWFF
YAJR_ECOLI      ----------------------------------------------------------------------
Y1560_METJA     ----------------------------------------------------------------------
S22A2_RAT       ----------------------------------------------------------------------
ITR2_SCHPO      ----------------------------------------------------------------------
YFIS_BACSU      ----------------------------------------------------------------------
MSSP3_ARATH     ----------------------------------------------------------------------
EMRD_ECOLI      ----------------------------------------------------------------------
BBEX_BACSU      ----------------------------------------------------------------------
YCAD_SALG2      ----------------------------------------------------------------------
YCAD_SALDC      ----------------------------------------------------------------------
AQR1_YEAST      ----------------------------------------------------------------------
SVOPL_DANRE     ----------------------------------------------------------------------
YUXJ_BACSU      ----------------------------------------------------------------------
VMAT2_RAT       ----------------------------------------------------------------------
UHPT_CHLPN      ----------------------------------------------------------------------
GTR9_HUMAN      ----------------------------------------------------------------------
BMRP_CANAL      ----------------------------------------------------------------------
Y1421_ENT38     ----------------------------------------------------------------------
TPO4_YEAST      ----------------------------------------------------------------------
S17A4_MOUSE     ----------------------------------------------------------------------
VACHT_DROME     ----------------------------------------------------------------------
S22A2_MOUSE     ----------------------------------------------------------------------
PMRA_LACLA      ----------------------------------------------------------------------
GTR9_PONAB      ----------------------------------------------------------------------
FSLK_DICDI      FNAGLGNFVVWIESGKYQNWFFWGPLGIVLTVGTTFIGLVIWEKIVSSTNKSDFFKLQLKPLMNMLLIYL
YJHB_ECOLI      ----------------------------------------------------------------------
UHPT_CHLTR      ----------------------------------------------------------------------
SPNS1_XENLA     ----------------------------------------------------------------------
PLST3_ARATH     ----------------------------------------------------------------------
OXLT_OXAFO      ----------------------------------------------------------------------
ANTR1_ARATH     ----------------------------------------------------------------------
HOL1_YEAST      ----------------------------------------------------------------------
YN22_SCHPO      ----------------------------------------------------------------------
VMAT2_MOUSE     ----------------------------------------------------------------------
VMAT2_BOVIN     ----------------------------------------------------------------------
TUB4_AGRVI      ----------------------------------------------------------------------
NPT1_HUMAN      ----------------------------------------------------------------------
MHPT_ECOLI      ----------------------------------------------------------------------
LTAA_STAS1      ----------------------------------------------------------------------
YQ92_SCHPO      ----------------------------------------------------------------------
YMPB_CAEEL      MSVELG----------------------------------------------------------------
YCEI_BACSU      ----------------------------------------------------------------------
VMAT2_HUMAN     ----------------------------------------------------------------------
TUB3_AGRVI      ----------------------------------------------------------------------
CMLA_PSEAE      ----------------------------------------------------------------------
YWFA_BACSU      ----------------------------------------------------------------------
YIQ6_YEAST      ----------------------------------------------------------------------
YDGK_BACSU      ----------------------------------------------------------------------
Y411_BUCBP      ----------------------------------------------------------------------
Y2680_YERPY     ----------------------------------------------------------------------
Y2592_YERP3     ----------------------------------------------------------------------
Y2315_YERPP     ----------------------------------------------------------------------
Y1506_YERPB     ----------------------------------------------------------------------
Y1405_YERPS     ----------------------------------------------------------------------
Y1380_YERPE     ----------------------------------------------------------------------
XYLL3_ARATH     ----------------------------------------------------------------------
SPNS3_MOUSE     ----------------------------------------------------------------------
S22A1_RABIT     ----------------------------------------------------------------------
GTR4_HUMAN      ----------------------------------------------------------------------
ANTR3_ARATH     ----------------------------------------------------------------------
Y450_BUCAP      ----------------------------------------------------------------------
S17A5_SHEEP     ----------------------------------------------------------------------
YOU1_CAEEL      ----------------------------------------------------------------------
YHK8_YEAST      ----------------------------------------------------------------------
YFKF_BACSU      ----------------------------------------------------------------------
UHPT_CHLMU      ----------------------------------------------------------------------
PLST1_ARATH     ----------------------------------------------------------------------
NU4C_NEPOL      VLIGIGSL----SEAGLNG-----AMLQMISHGLIGASLFFLAGTTYD--RTRTLVLEEMGGLATFMPKT
MFS1_SCHPO      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           FVLLFSAAMAYLPTMLQQVYGYPVDLAGYITAPRGIAAIIGAMLTQSILVKKLGVRKTISLGMITFGVSC
EMRB_ECOLI      AYMLYFGAIVLLPQLLQEVYGYTATWAGLASAPVGIIPVILSPII-GRFAHKLDMRRLVTFSFIMYAVCF
EMRB_ECO57      AYMLYFGAIVLLPQLLQEVYGYTATWAGLASAPVGIIPVILSPII-GRFAHKLDMRRLVTFSFIMYAVCF
EMRB_HAEIN      AFLIYLGSVVLIPLLLQQVFHYTATWAGLAASPVGLFPILLSPII-GRFGYKIDMRILVTISFIVYAITF
EMRY_ECOLI      AYLFYSGAIVLMPQLLQETMGYNAIWAGLAYAPIGIMPLLISPLI-GRYGNKIDMRLLVTFSFLMYAVCY
MDTD_YERPY      ----------------------------------------------------------------------
MDTD_YERPP      ----------------------------------------------------------------------
MDTD_YERPN      ----------------------------------------------------------------------
MDTD_YERPG      ----------------------------------------------------------------------
MDTD_YERPE      ----------------------------------------------------------------------
MDTD_YERPB      ----------------------------------------------------------------------
MDTD_YERPA      ----------------------------------------------------------------------
MDTD_YERP3      ----------------------------------------------------------------------
BMR3_BACSU      YGGTFIILAVFIPIFVQAVYGSSATSAGFILTPXXXXXXXXXXXXXXFQT-KASFRNLMLISVIAFFIGM
MDTD_YERPS      ----------------------------------------------------------------------
MDTD_PECCP      ----------------------------------------------------------------------
MDTD_SERP5      ----------------------------------------------------------------------
MDTD_YERE8      ----------------------------------------------------------------------
YHCA_BACSU      ITVALYTGMFLLPIYLQNLVGFTALQSGLLLLPGAIVMLIMSPIS-GILFDKFGPRPLAIIGXXXXXXXX
YEBQ_ECOLI      SVCSFCAAMVSLPFYLQTVLGRSEVETGLLLTPWPLATMVMAPLAGYLIERHAGLLGALGLFIMAAGLFS
LMRB_LISIN      SFMMILSTMILLPLYLQNSLALAAFSAXXXXXXXXXXXXXMSPFT-GRLFDAYGPRALVIPGFIVAVIAL
MDTD_ECOL6      ----------------------------------------------------------------------
MDTD_ECO81      ----------------------------------------------------------------------
LMRB_LISMO      SFMMILSTMILLPLYLQNSLALAAFSAXXXXXXXXXXXXXMSPFT-GRLFDAYGPRALVIPGFIVAVVAL
MDTD_SHIF8      ----------------------------------------------------------------------
MDTD_ESCF3      ----------------------------------------------------------------------
MDTD_ECOUT      ----------------------------------------------------------------------
MDTD_ECOLU      ----------------------------------------------------------------------
MDTD_ECOK1      ----------------------------------------------------------------------
MDTD_ECO45      ----------------------------------------------------------------------
MDTD_SHISS      ----------------------------------------------------------------------
MDTD_SHIFL      ----------------------------------------------------------------------
MDTD_SHIBS      ----------------------------------------------------------------------
MDTD_SHIB3      ----------------------------------------------------------------------
MDTD_ECOSM      ----------------------------------------------------------------------
MDTD_ECOSE      ----------------------------------------------------------------------
MDTD_ECOLI      ----------------------------------------------------------------------
MDTD_ECOLC      ----------------------------------------------------------------------
MDTD_ECOL5      ----------------------------------------------------------------------
MDTD_ECOHS      ----------------------------------------------------------------------
MDTD_ECODH      ----------------------------------------------------------------------
MDTD_ECOBW      ----------------------------------------------------------------------
MDTD_ECO8A      ----------------------------------------------------------------------
MDTD_ECO7I      ----------------------------------------------------------------------
MDTD_ECO5E      ----------------------------------------------------------------------
MDTD_ECO57      ----------------------------------------------------------------------
MDTD_ECO55      ----------------------------------------------------------------------
MDTD_ECO27      ----------------------------------------------------------------------
MDTD_ECO24      ----------------------------------------------------------------------
MDTD_CITK8      ----------------------------------------------------------------------
MDTD_SALSV      ----------------------------------------------------------------------
SGE1_YEAST      SCFAYELQSAYLVQLYQLVFKKKPTLASIHLWELSIPAMIATMAI-AYLNSKYGIIKP----AIVFGVLC
HSRA_ECOLI      IGIVGNIATRLMPLMLQVGFGYQAFIAGCMMAPTALGSIIASMVTQ--VLRRLGYRHTLVGITVIIGLMI
MDTD_SALTI      ----------------------------------------------------------------------
MDTD_SALPK      ----------------------------------------------------------------------
MDTD_SALPB      ----------------------------------------------------------------------
MDTD_SALPA      ----------------------------------------------------------------------
MDTD_SALNS      ----------------------------------------------------------------------
MDTD_SALHS      ----------------------------------------------------------------------
MDTD_SALEP      ----------------------------------------------------------------------
MDTD_SALDC      ----------------------------------------------------------------------
MDTD_SALA4      ----------------------------------------------------------------------
MDTD_SALTY      ----------------------------------------------------------------------
MDTD_ERWCT      ----------------------------------------------------------------------
MDTD_ENT38      ----------------------------------------------------------------------
TCMA_STRGA      ----------------------------------------------------------------------
LMRB_BACSU      CMMVILSSMLLLPMYLQGGLVLTAFASGLVLLPGGILNGFMSPVT-GRLFDKYGPKWLVIPGFVIVTVVL
YUSP_BACSU      MSIGMFGAITFVPFFMQGIVGVSASEXXXXXXXXXXXXXXXXXXXXQ-LVYKIGIKPQIITGMLVMAGGF
HSRA_HAEIN      IRLSASGVPFLLPLMFQLSFGYSAEMSGWLLAPIALISVMLKILIGRIL-NRWGYKTTLISSALLMAGSV
YCNB_BACSU      ----------------------------------------------------------------------
QACA_STAAU      ----------------------------------------------------------------------
QACA_STAAM      ----------------------------------------------------------------------
MDTD_ENTS8      ----------------------------------------------------------------------
MDTD_KLEP3      ----------------------------------------------------------------------
MDTD_KLEP7      ----------------------------------------------------------------------
YFIU_BACSU      FXXXXXAAVIFIPSYVEQYLGVPAAKAGYWMTPLALASGIGAWLGGALTDKKGPVKTVILSGIIS-----
BAIG_EUBSP      TQGLMMANMTNVIVFVRYTQPDNVIISSFAISIMYIGMSLGSVIIGPVADKK-EPKTVLTFSLVLTAIGC
YJA1_SCHPO      ----------------------------------------------------------------------
YAN6_SCHPO      HYYIVSTITYYIPVYFQNIKG-------------------------------------------------
VBA5_YEAST      ----------------------------------------------------------------------
MMR_STRCO       ----------------------------------------------------------------------
TCR_STRPN       IIFTVAGFVSMVPYMMKDVHQLSTAEIGSVIIFPGTMSVIIFGYIGGILVDRRGPLYVLNIGVTFLSVSF
TCR_BACSU       IIFTVAGFVSMVPYMMKDVHQLSTAEIGSVIIFPGTMSVIIFGYIGGILVDRRGPLYVLNIGVTFLSVSF
TCR_BACST       IIFTVAGFVSMVPYMMKDVHQLSTAEIGSVIIFPGTMSVIIFGYIGGILVDRRGPLYVLNIGVTFLSVSF
TCR_BACCE       IIFTVAGFVSMVPYMMKDVHQLSTAEIGSVIIFPGTMSVIIFGYIGGILVDRRGPLYVLNIGVTFLSVSF
MDTL_SALAR      ----------------------------------------------------------------------
YI32_SCHPO      ----------------------------------------------------------------------
MDTM_ECOLI      ----------------------------------------------------------------------
MDTM_ECO57      ----------------------------------------------------------------------
YVKA_BACSU      ----------------------------------------------------------------------
YCT4_SCHPO      ----------------------------------------------------------------------
TCR_STRAG       IIFTVAGFVSMVPYMMKDVHQLSTAEIGSVIIFPGTMSVIIFGYIGGILVDRRGPLYVLNIGVTFLSVSF
MDTL_SALPK      ----------------------------------------------------------------------
MDTL_SALPA      ----------------------------------------------------------------------
MDTL_SALEP      ----------------------------------------------------------------------
MDTL_SALDC      ----------------------------------------------------------------------
MDTL_SALTI      ----------------------------------------------------------------------
TCRB_BACSU      ----------------------------------------------------------------------
MDTL_SALTY      ----------------------------------------------------------------------
MDTL_SALPC      ----------------------------------------------------------------------
MDTL_SALPB      ----------------------------------------------------------------------
MDTL_SALNS      ----------------------------------------------------------------------
MDTL_SALHS      ----------------------------------------------------------------------
MDTL_SALCH      ----------------------------------------------------------------------
MDTL_SALA4      ----------------------------------------------------------------------
AZR1_YEAST      ----------------------------------------------------------------------
MDTL_SALSV      ----------------------------------------------------------------------
MMR_BACSU       ----------------------------------------------------------------------
MDTL_VIBPA      ----------------------------------------------------------------------
YHX6_SCHPO      ----------------------------------------------------------------------
YHD3_SCHPO      GWACFGIWMYYLWQFLENLFATPLLVTAQLT-PVGISG-CAAALTTGYLLKRLKPTKIMVVSMIAFTVGT
TCR_STAHY       IIFTVAGFVSMVPYMMKDVHQLSTAEIGSVIIFPGTMSVIIFGYIGGILVDRRVPLYALNIGVTFLSVSF
MDTL_ECOL6      ----------------------------------------------------------------------
MDTL_ECO81      ----------------------------------------------------------------------
ATR1_YEAST      ----------------------------------------------------------------------
ACT22_STRCO     ----------------------------------------------------------------------
MDTL_ECOL5      ----------------------------------------------------------------------
MDTL_ECO27      ----------------------------------------------------------------------
MDTL_ECOUT      ----------------------------------------------------------------------
MDTL_ECOK1      ----------------------------------------------------------------------
MDTL_ECO45      ----------------------------------------------------------------------
YN42_SCHPO      ----------------------------------------------------------------------
MDTL_KLEP3      ----------------------------------------------------------------------
MDTL_ESCF3      ----------------------------------------------------------------------
MDTL_ECOSM      ----------------------------------------------------------------------
MDTL_ECOLU      ----------------------------------------------------------------------
CMCT_NOCLA      ----------------------------------------------------------------------
MDTL_SHISS      ----------------------------------------------------------------------
MDTL_SHIFL      ----------------------------------------------------------------------
MDTL_SHIF8      ----------------------------------------------------------------------
MDTL_SHIBS      ----------------------------------------------------------------------
MDTL_SHIB3      ----------------------------------------------------------------------
MDTL_ECOSE      ----------------------------------------------------------------------
MDTL_ECOLI      ----------------------------------------------------------------------
MDTL_ECOLC      ----------------------------------------------------------------------
MDTL_ECOHS      ----------------------------------------------------------------------
MDTL_ECODH      ----------------------------------------------------------------------
MDTL_ECOBW      ----------------------------------------------------------------------
MDTL_ECO8A      ----------------------------------------------------------------------
MDTL_ECO7I      ----------------------------------------------------------------------
MDTL_ECO55      ----------------------------------------------------------------------
MDTL_ECO24      ----------------------------------------------------------------------
MDTL_CITK8      ----------------------------------------------------------------------
MDTL_SHIDS      ----------------------------------------------------------------------
MDTL_ECO5E      ----------------------------------------------------------------------
MDTL_ECO57      ----------------------------------------------------------------------
YFMO_BACSU      ----------------------------------------------------------------------
PHDK_NOCSK      ----------------------------------------------------------------------
YBIH_SCHPO      ----------------------------------------------------------------------
YWOG_BACSU      ----------------------------------------------------------------------
MDFA_ECOLI      ----------------------------------------------------------------------
MDFA_ECOL6      ----------------------------------------------------------------------
MDFA_ECO57      ----------------------------------------------------------------------
YQO5_SCHPO      ----------------------------------------------------------------------
MDTL_KLEP7      ----------------------------------------------------------------------
YN41_SCHPO      ----------------------------------------------------------------------
VBA2_YEAST      ----------------------------------------------------------------------
BCR_HAEIN       ----------------------------------------------------------------------
YN43_SCHPO      ----------------------------------------------------------------------
YDHC_ECOLI      ----------------------------------------------------------------------
NANT_SALTY      ----------------------------------------------------------------------
NANT_SALTI      ----------------------------------------------------------------------
NANT_SALSV      ----------------------------------------------------------------------
NANT_SALPK      ----------------------------------------------------------------------
NANT_SALPC      ----------------------------------------------------------------------
NANT_SALPB      ----------------------------------------------------------------------
NANT_SALPA      ----------------------------------------------------------------------
NANT_SALNS      ----------------------------------------------------------------------
NANT_SALHS      ----------------------------------------------------------------------
NANT_SALG2      ----------------------------------------------------------------------
NANT_SALEP      ----------------------------------------------------------------------
NANT_SALDC      ----------------------------------------------------------------------
NANT_SALCH      ----------------------------------------------------------------------
NANT_SALAR      ----------------------------------------------------------------------
NANT_ESCF3      ----------------------------------------------------------------------
NANT_CITK8      ----------------------------------------------------------------------
YYBF_BACSU      ----------------------------------------------------------------------
YO378_YEAST     ----------------------------------------------------------------------
YWOD_BACSU      ----------------------------------------------------------------------
Y466_BUCAI      ----------------------------------------------------------------------
NANT_SHIFL      ----------------------------------------------------------------------
NANT_SHIF8      ----------------------------------------------------------------------
NANT_SHIB3      ----------------------------------------------------------------------
NANT_ECOSM      ----------------------------------------------------------------------
NANT_ECOSE      ----------------------------------------------------------------------
NANT_ECOLI      ----------------------------------------------------------------------
NANT_ECOLC      ----------------------------------------------------------------------
NANT_ECOL5      ----------------------------------------------------------------------
NANT_ECOHS      ----------------------------------------------------------------------
NANT_ECODH      ----------------------------------------------------------------------
NANT_ECOBW      ----------------------------------------------------------------------
NANT_ECO8A      ----------------------------------------------------------------------
NANT_ECO7I      ----------------------------------------------------------------------
NANT_ECO5E      ----------------------------------------------------------------------
NANT_ECO57      ----------------------------------------------------------------------
NANT_ECO55      ----------------------------------------------------------------------
NANT_ECO45      ----------------------------------------------------------------------
NANT_ECO27      ----------------------------------------------------------------------
NANT_ECO24      ----------------------------------------------------------------------
NANT1_ECOL6     ----------------------------------------------------------------------
YB30_YEAST      ----------------------------------------------------------------------
TCR_STAES       ----------------------------------------------------------------------
TCR_STAAU       ----------------------------------------------------------------------
SPIN_DROME      ----------------------------------------------------------------------
YN2F_SCHPO      ----------------------------------------------------------------------
SMVA_SALTY      ----------------------------------------------------------------------
MIRC_EMENI      FMAFYFSVQPYLYSYLQVVQGYDVATAGRVTQTFAFTSTIAAFGVSILIKYTRRYRVYVTLGCVIYMTGL
YYAJ_BACSU      ----------------------------------------------------------------------
FNX1_SCHPO      ----------------------------------------------------------------------
YHA8_SCHPO      ----------------------------------------------------------------------
YWTG_BACSU      ----------------------------------------------------------------------
Y588_BUCAI      ----------------------------------------------------------------------
PCAK_ACIAD      ----------------------------------------------------------------------
NANT_YERPY      ----------------------------------------------------------------------
BCR_ECOLI       ----------------------------------------------------------------------
BENK_ACIAD      ----------------------------------------------------------------------
YM8M_YEAST      ----------------------------------------------------------------------
MDTM_SALTY      ----------------------------------------------------------------------
MDTM_SALTI      ----------------------------------------------------------------------
NANT_YERPS      ----------------------------------------------------------------------
NANT_YERPP      ----------------------------------------------------------------------
NANT_YERPG      ----------------------------------------------------------------------
NANT_YERPB      ----------------------------------------------------------------------
NANT_YERP3      ----------------------------------------------------------------------
NANT2_ECOL6     FCFLYGPLQAFLPTWLKVDMQYSPETVALIFMLAGFGSAAGSCI-GGFMGDWLGTRKAYVISLL------
GALP_ECOLI      ----------------------------------------------------------------------
GALP_ECOL6      ----------------------------------------------------------------------
YVMA_BACSU      LFFIYFAVIVYLPILLTEHYHIDVGIAGLLYLPLALSTIAGTFLFKRIQA-KIGLH-TLFIGSNVIAACS
YUBD_BACSU      ----------------------------------------------------------------------
YHJO_BACSU      ----------------------------------------------------------------------
TPO1_YEAST      ----------------------------------------------------------------------
NANT_YERPE      ----------------------------------------------------------------------
NANT_YERPA      ----------------------------------------------------------------------
MDTL_SHESA      ----------------------------------------------------------------------
CSBC_BACSU      ----------------------------------------------------------------------
Y567_BUCAP      ----------------------------------------------------------------------
NANT_SALA4      ----------------------------------------------------------------------
YCEJ_BACSU      ----------------------------------------------------------------------
VBA3_YEAST      ----------------------------------------------------------------------
TPO3_YEAST      YSLLYAFFFAF-PVIFGELYGYKDNLVGLMFIPIVIGAL-------------------------------
BCRH_RICTY      FILI--DKMKVLPSF----YGKLAFLLSF-------SAIFGGFL-GGYLIKKRQVKKVMSIGFIFSLCGC
ARAE_KLEOX      ----------------------------------------------------------------------
EXUT_BACSU      ----------------------------------------------------------------------
ARAE_ECOLI      ----------------------------------------------------------------------
ARAE_ECO57      ----------------------------------------------------------------------
Y2171_CITK8     ----------------------------------------------------------------------
SVOPL_HUMAN     ----------------------------------------------------------------------
MDTL_SHEON      ----------------------------------------------------------------------
TPO2_YEAST      YSLLYAFFFAF-PVIFGELYGYKDNLVGLMFIPIVIGAL-------------------------------
NANT_ENTS8      ----------------------------------------------------------------------
BSU1_SCHPO      ----------------------------------------------------------------------
YCAD_SHIFL      ----------------------------------------------------------------------
YCAD_SHIF8      ----------------------------------------------------------------------
YCAD_SALTY      ----------------------------------------------------------------------
YCAD_SALTI      ----------------------------------------------------------------------
YCAD_SALSV      ----------------------------------------------------------------------
YCAD_SALPK      ----------------------------------------------------------------------
YCAD_SALPC      ----------------------------------------------------------------------
YCAD_SALPA      ----------------------------------------------------------------------
YCAD_SALNS      ----------------------------------------------------------------------
YCAD_SALHS      ----------------------------------------------------------------------
YCAD_SALCH      ----------------------------------------------------------------------
YCAD_SALA4      ----------------------------------------------------------------------
CYHR_CANMA      ----------------------------------------------------------------------
BCRH_RICPR      ----------------------------------------------------------------------
YCAD_ESCF3      ----------------------------------------------------------------------
S17A5_MOUSE     ----------------------------------------------------------------------
MUCK_ACIAD      ----------------------------------------------------------------------
YCAD_SHISS      ----------------------------------------------------------------------
YCAD_SHIDS      ----------------------------------------------------------------------
YCAD_ECOUT      ----------------------------------------------------------------------
YCAD_ECOSM      ----------------------------------------------------------------------
YCAD_ECOSE      ----------------------------------------------------------------------
YCAD_ECOLU      ----------------------------------------------------------------------
YCAD_ECOLI      ----------------------------------------------------------------------
YCAD_ECOLC      ----------------------------------------------------------------------
YCAD_ECOL6      ----------------------------------------------------------------------
YCAD_ECOL5      ----------------------------------------------------------------------
YCAD_ECOK1      ----------------------------------------------------------------------
YCAD_ECOHS      ----------------------------------------------------------------------
YCAD_ECODH      ----------------------------------------------------------------------
YCAD_ECOBW      ----------------------------------------------------------------------
YCAD_ECO8A      ----------------------------------------------------------------------
YCAD_ECO81      ----------------------------------------------------------------------
YCAD_ECO7I      ----------------------------------------------------------------------
YCAD_ECO5E      ----------------------------------------------------------------------
YCAD_ECO57      ----------------------------------------------------------------------
YCAD_ECO55      ----------------------------------------------------------------------
YCAD_ECO45      ----------------------------------------------------------------------
YCAD_ECO27      ----------------------------------------------------------------------
YCAD_ECO24      ----------------------------------------------------------------------
SPNS1_DANRE     ----------------------------------------------------------------------
YITG_BACSU      ----------------------------------------------------------------------
YCAD_SALEP      ----------------------------------------------------------------------
VACHT_DANRE     ----------------------------------------------------------------------
PMRA_STRR6      ----------------------------------------------------------------------
PMRA_STRPN      ----------------------------------------------------------------------
BMR2_BACSU      ----------------------------------------------------------------------
YCAD_SALPB      ----------------------------------------------------------------------
MDTD_SHIDS      ----------------------------------------------------------------------
YCAD_SALAR      ----------------------------------------------------------------------
SVOPL_MOUSE     ----------------------------------------------------------------------
S17A5_HUMAN     ----------------------------------------------------------------------
DGOT_ECOLI      --------LTWFPNYLTQEKGITALKAGFMTTVPFLAAFVGVLL--SGWVADLLVRKGFSLGFIICGLTC
DGOT_ECOL6      --------LTWFPNYLTQEKGITALKAGFMTTVPFLAAFVGVLL--SGWVADLLVRKGFSLGFIICGLTC
YAJR_ECOLI      ----------------------------------------------------------------------
Y1560_METJA     ----------------------------------------------------------------------
S22A2_RAT       ----------------------------------------------------------------------
ITR2_SCHPO      ----------------------------------------------------------------------
YFIS_BACSU      ----------------------------------------------------------------------
MSSP3_ARATH     ----------------------------------------------------------------------
EMRD_ECOLI      ----------------------------------------------------------------------
BBEX_BACSU      ----------------------------------------------------------------------
YCAD_SALG2      ----------------------------------------------------------------------
YCAD_SALDC      ----------------------------------------------------------------------
AQR1_YEAST      ----------------------------------------------------------------------
SVOPL_DANRE     ----------------------------------------------------------------------
YUXJ_BACSU      ----------------------------------------------------------------------
VMAT2_RAT       ----------------------------------------------------------------------
UHPT_CHLPN      ----------------------------------------------------------------------
GTR9_HUMAN      ----------------------------------------------------------------------
BMRP_CANAL      ----------------------------------------------------------------------
Y1421_ENT38     ----------------------------------------------------------------------
TPO4_YEAST      ----------------------------------------------------------------------
S17A4_MOUSE     ----------------------------------------------------------------------
VACHT_DROME     ----------------------------------------------------------------------
S22A2_MOUSE     ----------------------------------------------------------------------
PMRA_LACLA      ----------------------------------------------------------------------
GTR9_PONAB      ----------------------------------------------------------------------
FSLK_DICDI      FVYLFGYNF-YIHNSLNGFYGSSEEFKNCIISTDGKDCRIQGPPYSSILMFVFCLR--------IYGVYC
YJHB_ECOLI      ----------------------------------------------------------------------
UHPT_CHLTR      ----------------------------------------------------------------------
SPNS1_XENLA     ----------------------------------------------------------------------
PLST3_ARATH     ----------------------------------------------------------------------
OXLT_OXAFO      ----------------------------------------------------------------------
ANTR1_ARATH     ----------------------------------------------------------------------
HOL1_YEAST      ----------------------------------------------------------------------
YN22_SCHPO      ----------------------------------------------------------------------
VMAT2_MOUSE     ----------------------------------------------------------------------
VMAT2_BOVIN     ----------------------------------------------------------------------
TUB4_AGRVI      ----------------------------------------------------------------------
NPT1_HUMAN      ----------------------------------------------------------------------
MHPT_ECOLI      ----------------------------------------------------------------------
LTAA_STAS1      ----------------------------------------------------------------------
YQ92_SCHPO      ----------------------------------------------------------------------
YMPB_CAEEL      ----------------------------------------------------------------------
YCEI_BACSU      ----------------------------------------------------------------------
VMAT2_HUMAN     ----------------------------------------------------------------------
TUB3_AGRVI      ----------------------------------------------------------------------
CMLA_PSEAE      ----------------------------------------------------------------------
YWFA_BACSU      ----------------------------------------------------------------------
YIQ6_YEAST      ----------------------------------------------------------------------
YDGK_BACSU      ----------------------------------------------------------------------
Y411_BUCBP      ----------------------------------------------------------------------
Y2680_YERPY     ----------------------------------------------------------------------
Y2592_YERP3     ----------------------------------------------------------------------
Y2315_YERPP     ----------------------------------------------------------------------
Y1506_YERPB     ----------------------------------------------------------------------
Y1405_YERPS     ----------------------------------------------------------------------
Y1380_YERPE     ----------------------------------------------------------------------
XYLL3_ARATH     ----------------------------------------------------------------------
SPNS3_MOUSE     ----------------------------------------------------------------------
S22A1_RABIT     ----------------------------------------------------------------------
GTR4_HUMAN      ----------------------------------------------------------------------
ANTR3_ARATH     ----------------------------------------------------------------------
Y450_BUCAP      ----------------------------------------------------------------------
S17A5_SHEEP     ----------------------------------------------------------------------
YOU1_CAEEL      ----------------------------------------------------------------------
YHK8_YEAST      ----------------------------------------------------------------------
YFKF_BACSU      ----------------------------------------------------------------------
UHPT_CHLMU      ----------------------------------------------------------------------
PLST1_ARATH     ----------------------------------------------------------------------
NU4C_NEPOL      FALFTACSLASL----------------------------------------------------------
MFS1_SCHPO      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LMQANFSPTANEFDIILTTAIQGLGMMMFFVPFMSVLVVGVADEDMGDMXXXXXXXXXXXXXVGTAFVAT
EMRB_ECOLI      YWRATFEPGMDFGASAWPQFIQGFAVACFFMPLTTITLSGLPPERLAAASSLSNFTRTLAGSIGTSITTT
EMRB_ECO57      YWRATFEPGMDFGASAWPQFIQGFAVACFFMPLTTITLSGLPPERLAAASSLSNFTRTLAGSIGTSITTT
EMRB_HAEIN      YWRATFEPSMTFVDVALPQLVQGLAVSCFFMPLTTITLSGLPAHKMASASSLFNFLRTLAGSVGTS-LTT
EMRY_ECOLI      YWRSTFMPTIDFTGIILPQFFQGFAVACFFLPLTTISFSGLPDNKFANASSMSNFFRTLSGSVGTSLTMT
MDTD_YERPY      ----------------------------------------------------------------------
MDTD_YERPP      ----------------------------------------------------------------------
MDTD_YERPN      ----------------------------------------------------------------------
MDTD_YERPG      ----------------------------------------------------------------------
MDTD_YERPE      ----------------------------------------------------------------------
MDTD_YERPB      ----------------------------------------------------------------------
MDTD_YERPA      ----------------------------------------------------------------------
MDTD_YERP3      ----------------------------------------------------------------------
BMR3_BACSU      LLLSNMTPDTARVWLTVFMMISGFGV--------------------------------------------
MDTD_YERPS      ----------------------------------------------------------------------
MDTD_PECCP      ----------------------------------------------------------------------
MDTD_SERP5      ----------------------------------------------------------------------
MDTD_YERE8      ----------------------------------------------------------------------
YHCA_BACSU      XXXXXXXIDTPYTHIMLIYSIRAFGMSLLMMPVMTAGMNQLPARLNSHGTAMSNTLRQISGSIGTSLITT
YEBQ_ECOLI      LVLLPASPA--DINIIWPMILCGAGFGLFQSPNNHTIITSAPRERSGGASGMLGTARLLGQSSGAALVAL
LMRB_LISIN      FFLTRIEVGTSALTIIVLHSVLMIGISMVMMPAQTNGLNQLPPKLYPDGTAIMNTLQQVSGAIGTAVAIT
MDTD_ECOL6      ----------------------------------------------------------------------
MDTD_ECO81      ----------------------------------------------------------------------
LMRB_LISMO      FFLTRIEVGTSALTIIVLHSVLMIGISMVMMPAQTNGLNQLPPKLYPDGTAIMNTLQQVSGAIGTAVAIT
MDTD_SHIF8      ----------------------------------------------------------------------
MDTD_ESCF3      ----------------------------------------------------------------------
MDTD_ECOUT      ----------------------------------------------------------------------
MDTD_ECOLU      ----------------------------------------------------------------------
MDTD_ECOK1      ----------------------------------------------------------------------
MDTD_ECO45      ----------------------------------------------------------------------
MDTD_SHISS      ----------------------------------------------------------------------
MDTD_SHIFL      ----------------------------------------------------------------------
MDTD_SHIBS      ----------------------------------------------------------------------
MDTD_SHIB3      ----------------------------------------------------------------------
MDTD_ECOSM      ----------------------------------------------------------------------
MDTD_ECOSE      ----------------------------------------------------------------------
MDTD_ECOLI      ----------------------------------------------------------------------
MDTD_ECOLC      ----------------------------------------------------------------------
MDTD_ECOL5      ----------------------------------------------------------------------
MDTD_ECOHS      ----------------------------------------------------------------------
MDTD_ECODH      ----------------------------------------------------------------------
MDTD_ECOBW      ----------------------------------------------------------------------
MDTD_ECO8A      ----------------------------------------------------------------------
MDTD_ECO7I      ----------------------------------------------------------------------
MDTD_ECO5E      ----------------------------------------------------------------------
MDTD_ECO57      ----------------------------------------------------------------------
MDTD_ECO55      ----------------------------------------------------------------------
MDTD_ECO27      ----------------------------------------------------------------------
MDTD_ECO24      ----------------------------------------------------------------------
MDTD_CITK8      ----------------------------------------------------------------------
MDTD_SALSV      ----------------------------------------------------------------------
SGE1_YEAST      ----------------------------------------------------------------------
HSRA_ECOLI      AQFSLQSPAMAIWMLILPLFILGMAMSTQFTAMNTITLADLTDDN-------------------------
MDTD_SALTI      ----------------------------------------------------------------------
MDTD_SALPK      ----------------------------------------------------------------------
MDTD_SALPB      ----------------------------------------------------------------------
MDTD_SALPA      ----------------------------------------------------------------------
MDTD_SALNS      ----------------------------------------------------------------------
MDTD_SALHS      ----------------------------------------------------------------------
MDTD_SALEP      ----------------------------------------------------------------------
MDTD_SALDC      ----------------------------------------------------------------------
MDTD_SALA4      ----------------------------------------------------------------------
MDTD_SALTY      ----------------------------------------------------------------------
MDTD_ERWCT      ----------------------------------------------------------------------
MDTD_ENT38      ----------------------------------------------------------------------
TCMA_STRGA      ----------------------------------------------------------------------
LMRB_BACSU      WFFSNVTTTSTAVLIIILHTCLMIGISMIMMP--------------------------------------
YUSP_BACSU      XXXXXXXXXXSKLVATSFMAIIGLGMGLVMPILTLALQESFSKEELG-----------------------
HSRA_HAEIN      ISMAWLDKQSSLTWIICNLMWYGACMSIIFTSINTLAVGDLSKQQSG-----------------------
YCNB_BACSU      ----------------------------------------------------------------------
QACA_STAAU      ----------------------------------------------------------------------
QACA_STAAM      ----------------------------------------------------------------------
MDTD_ENTS8      ----------------------------------------------------------------------
MDTD_KLEP3      ----------------------------------------------------------------------
MDTD_KLEP7      ----------------------------------------------------------------------
YFIU_BACSU      ----------------------------------------------------------------------
BAIG_EUBSP      ALMYLFKADSSVAIFAASLGILGFGLGGNATIFMKVALSGLSSEVAG-----------------------
YJA1_SCHPO      ----------------------------------------------------------------------
YAN6_SCHPO      ----------------------------------------------------------------------
VBA5_YEAST      ----------------------------------------------------------------------
MMR_STRCO       ----------------------------------------------------------------------
TCR_STRPN       LTASFLLETTSWFMTIIIVFVLG-----------------------------------------------
TCR_BACSU       LTASFLLETTSWFMTIIIVFVLG-----------------------------------------------
TCR_BACST       LTASFLLETTSWFMTIIIVFVLG-----------------------------------------------
TCR_BACCE       LTASFLLETTSWFMTIIIVFVLG-----------------------------------------------
MDTL_SALAR      ----------------------------------------------------------------------
YI32_SCHPO      ----------------------------------------------------------------------
MDTM_ECOLI      ----------------------------------------------------------------------
MDTM_ECO57      ----------------------------------------------------------------------
YVKA_BACSU      ----------------------------------------------------------------------
YCT4_SCHPO      ----------------------------------------------------------------------
TCR_STRAG       LTAFFLLETTSWFTIIIVFVLGGLSFTKTVIP--------------------------------------
MDTL_SALPK      ----------------------------------------------------------------------
MDTL_SALPA      ----------------------------------------------------------------------
MDTL_SALEP      ----------------------------------------------------------------------
MDTL_SALDC      ----------------------------------------------------------------------
MDTL_SALTI      ----------------------------------------------------------------------
TCRB_BACSU      ----------------------------------------------------------------------
MDTL_SALTY      ----------------------------------------------------------------------
MDTL_SALPC      ----------------------------------------------------------------------
MDTL_SALPB      ----------------------------------------------------------------------
MDTL_SALNS      ----------------------------------------------------------------------
MDTL_SALHS      ----------------------------------------------------------------------
MDTL_SALCH      ----------------------------------------------------------------------
MDTL_SALA4      ----------------------------------------------------------------------
AZR1_YEAST      ----------------------------------------------------------------------
MDTL_SALSV      ----------------------------------------------------------------------
MMR_BACSU       ----------------------------------------------------------------------
MDTL_VIBPA      ----------------------------------------------------------------------
YHX6_SCHPO      ----------------------------------------------------------------------
YHD3_SCHPO      ILIA------------------------------------------------------------------
TCR_STAHY       LTASFLLETTSWFMTIIIVFVLG-----------------------------------------------
MDTL_ECOL6      ----------------------------------------------------------------------
MDTL_ECO81      ----------------------------------------------------------------------
ATR1_YEAST      ----------------------------------------------------------------------
ACT22_STRCO     ----------------------------------------------------------------------
MDTL_ECOL5      ----------------------------------------------------------------------
MDTL_ECO27      ----------------------------------------------------------------------
MDTL_ECOUT      ----------------------------------------------------------------------
MDTL_ECOK1      ----------------------------------------------------------------------
MDTL_ECO45      ----------------------------------------------------------------------
YN42_SCHPO      ----------------------------------------------------------------------
MDTL_KLEP3      ----------------------------------------------------------------------
MDTL_ESCF3      ----------------------------------------------------------------------
MDTL_ECOSM      ----------------------------------------------------------------------
MDTL_ECOLU      ----------------------------------------------------------------------
CMCT_NOCLA      ----------------------------------------------------------------------
MDTL_SHISS      ----------------------------------------------------------------------
MDTL_SHIFL      ----------------------------------------------------------------------
MDTL_SHIF8      ----------------------------------------------------------------------
MDTL_SHIBS      ----------------------------------------------------------------------
MDTL_SHIB3      ----------------------------------------------------------------------
MDTL_ECOSE      ----------------------------------------------------------------------
MDTL_ECOLI      ----------------------------------------------------------------------
MDTL_ECOLC      ----------------------------------------------------------------------
MDTL_ECOHS      ----------------------------------------------------------------------
MDTL_ECODH      ----------------------------------------------------------------------
MDTL_ECOBW      ----------------------------------------------------------------------
MDTL_ECO8A      ----------------------------------------------------------------------
MDTL_ECO7I      ----------------------------------------------------------------------
MDTL_ECO55      ----------------------------------------------------------------------
MDTL_ECO24      ----------------------------------------------------------------------
MDTL_CITK8      ----------------------------------------------------------------------
MDTL_SHIDS      ----------------------------------------------------------------------
MDTL_ECO5E      ----------------------------------------------------------------------
MDTL_ECO57      ----------------------------------------------------------------------
YFMO_BACSU      ----------------------------------------------------------------------
PHDK_NOCSK      ----------------------------------------------------------------------
YBIH_SCHPO      ----------------------------------------------------------------------
YWOG_BACSU      ----------------------------------------------------------------------
MDFA_ECOLI      ----------------------------------------------------------------------
MDFA_ECOL6      ----------------------------------------------------------------------
MDFA_ECO57      ----------------------------------------------------------------------
YQO5_SCHPO      ----------------------------------------------------------------------
MDTL_KLEP7      ----------------------------------------------------------------------
YN41_SCHPO      ----------------------------------------------------------------------
VBA2_YEAST      ----------------------------------------------------------------------
BCR_HAEIN       ----------------------------------------------------------------------
YN43_SCHPO      ----------------------------------------------------------------------
YDHC_ECOLI      ----------------------------------------------------------------------
NANT_SALTY      ----------------------------------------------------------------------
NANT_SALTI      ----------------------------------------------------------------------
NANT_SALSV      ----------------------------------------------------------------------
NANT_SALPK      ----------------------------------------------------------------------
NANT_SALPC      ----------------------------------------------------------------------
NANT_SALPB      ----------------------------------------------------------------------
NANT_SALPA      ----------------------------------------------------------------------
NANT_SALNS      ----------------------------------------------------------------------
NANT_SALHS      ----------------------------------------------------------------------
NANT_SALG2      ----------------------------------------------------------------------
NANT_SALEP      ----------------------------------------------------------------------
NANT_SALDC      ----------------------------------------------------------------------
NANT_SALCH      ----------------------------------------------------------------------
NANT_SALAR      ----------------------------------------------------------------------
NANT_ESCF3      ----------------------------------------------------------------------
NANT_CITK8      ----------------------------------------------------------------------
YYBF_BACSU      ----------------------------------------------------------------------
YO378_YEAST     ----------------------------------------------------------------------
YWOD_BACSU      ----------------------------------------------------------------------
Y466_BUCAI      ----------------------------------------------------------------------
NANT_SHIFL      ----------------------------------------------------------------------
NANT_SHIF8      ----------------------------------------------------------------------
NANT_SHIB3      ----------------------------------------------------------------------
NANT_ECOSM      ----------------------------------------------------------------------
NANT_ECOSE      ----------------------------------------------------------------------
NANT_ECOLI      ----------------------------------------------------------------------
NANT_ECOLC      ----------------------------------------------------------------------
NANT_ECOL5      ----------------------------------------------------------------------
NANT_ECOHS      ----------------------------------------------------------------------
NANT_ECODH      ----------------------------------------------------------------------
NANT_ECOBW      ----------------------------------------------------------------------
NANT_ECO8A      ----------------------------------------------------------------------
NANT_ECO7I      ----------------------------------------------------------------------
NANT_ECO5E      ----------------------------------------------------------------------
NANT_ECO57      ----------------------------------------------------------------------
NANT_ECO55      ----------------------------------------------------------------------
NANT_ECO45      ----------------------------------------------------------------------
NANT_ECO27      ----------------------------------------------------------------------
NANT_ECO24      ----------------------------------------------------------------------
NANT1_ECOL6     ----------------------------------------------------------------------
YB30_YEAST      ----------------------------------------------------------------------
TCR_STAES       ----------------------------------------------------------------------
TCR_STAAU       ----------------------------------------------------------------------
SPIN_DROME      ----------------------------------------------------------------------
YN2F_SCHPO      ----------------------------------------------------------------------
SMVA_SALTY      ----------------------------------------------------------------------
MIRC_EMENI      LLMLLYKEGSSPLQVLGTQVIVGMGGGLLNVP--------------------------------------
YYAJ_BACSU      ----------------------------------------------------------------------
FNX1_SCHPO      ----------------------------------------------------------------------
YHA8_SCHPO      ----------------------------------------------------------------------
YWTG_BACSU      ----------------------------------------------------------------------
Y588_BUCAI      ----------------------------------------------------------------------
PCAK_ACIAD      ----------------------------------------------------------------------
NANT_YERPY      ----------------------------------------------------------------------
BCR_ECOLI       ----------------------------------------------------------------------
BENK_ACIAD      ----------------------------------------------------------------------
YM8M_YEAST      ----------------------------------------------------------------------
MDTM_SALTY      ----------------------------------------------------------------------
MDTM_SALTI      ----------------------------------------------------------------------
NANT_YERPS      ----------------------------------------------------------------------
NANT_YERPP      ----------------------------------------------------------------------
NANT_YERPG      ----------------------------------------------------------------------
NANT_YERPB      ----------------------------------------------------------------------
NANT_YERP3      ----------------------------------------------------------------------
NANT2_ECOL6     ----------------------------------------------------------------------
GALP_ECOLI      ----------------------------------------------------------------------
GALP_ECOL6      ----------------------------------------------------------------------
YVMA_BACSU      IILFAVTHSVSLVLMALTLALFGISMGV-IPPLYSTMITNEFEHNRG-----------------------
YUBD_BACSU      ----------------------------------------------------------------------
YHJO_BACSU      ----------------------------------------------------------------------
TPO1_YEAST      ----------------------------------------------------------------------
NANT_YERPE      ----------------------------------------------------------------------
NANT_YERPA      ----------------------------------------------------------------------
MDTL_SHESA      ----------------------------------------------------------------------
CSBC_BACSU      ----------------------------------------------------------------------
Y567_BUCAP      ----------------------------------------------------------------------
NANT_SALA4      ----------------------------------------------------------------------
YCEJ_BACSU      ----------------------------------------------------------------------
VBA3_YEAST      ----------------------------------------------------------------------
TPO3_YEAST      ----------------------------------------------------------------------
BCRH_RICTY      ILF-----VVNAFILEFILVSNGLAISMIFVPMM------------------------------------
ARAE_KLEOX      ----------------------------------------------------------------------
EXUT_BACSU      ----------------------------------------------------------------------
ARAE_ECOLI      ----------------------------------------------------------------------
ARAE_ECO57      ----------------------------------------------------------------------
Y2171_CITK8     ----------------------------------------------------------------------
SVOPL_HUMAN     ----------------------------------------------------------------------
MDTL_SHEON      ----------------------------------------------------------------------
TPO2_YEAST      ----------------------------------------------------------------------
NANT_ENTS8      ----------------------------------------------------------------------
BSU1_SCHPO      ----------------------------------------------------------------------
YCAD_SHIFL      ----------------------------------------------------------------------
YCAD_SHIF8      ----------------------------------------------------------------------
YCAD_SALTY      ----------------------------------------------------------------------
YCAD_SALTI      ----------------------------------------------------------------------
YCAD_SALSV      ----------------------------------------------------------------------
YCAD_SALPK      ----------------------------------------------------------------------
YCAD_SALPC      ----------------------------------------------------------------------
YCAD_SALPA      ----------------------------------------------------------------------
YCAD_SALNS      ----------------------------------------------------------------------
YCAD_SALHS      ----------------------------------------------------------------------
YCAD_SALCH      ----------------------------------------------------------------------
YCAD_SALA4      ----------------------------------------------------------------------
CYHR_CANMA      ----------------------------------------------------------------------
BCRH_RICPR      ----------------------------------------------------------------------
YCAD_ESCF3      ----------------------------------------------------------------------
S17A5_MOUSE     ----------------------------------------------------------------------
MUCK_ACIAD      ----------------------------------------------------------------------
YCAD_SHISS      ----------------------------------------------------------------------
YCAD_SHIDS      ----------------------------------------------------------------------
YCAD_ECOUT      ----------------------------------------------------------------------
YCAD_ECOSM      ----------------------------------------------------------------------
YCAD_ECOSE      ----------------------------------------------------------------------
YCAD_ECOLU      ----------------------------------------------------------------------
YCAD_ECOLI      ----------------------------------------------------------------------
YCAD_ECOLC      ----------------------------------------------------------------------
YCAD_ECOL6      ----------------------------------------------------------------------
YCAD_ECOL5      ----------------------------------------------------------------------
YCAD_ECOK1      ----------------------------------------------------------------------
YCAD_ECOHS      ----------------------------------------------------------------------
YCAD_ECODH      ----------------------------------------------------------------------
YCAD_ECOBW      ----------------------------------------------------------------------
YCAD_ECO8A      ----------------------------------------------------------------------
YCAD_ECO81      ----------------------------------------------------------------------
YCAD_ECO7I      ----------------------------------------------------------------------
YCAD_ECO5E      ----------------------------------------------------------------------
YCAD_ECO57      ----------------------------------------------------------------------
YCAD_ECO55      ----------------------------------------------------------------------
YCAD_ECO45      ----------------------------------------------------------------------
YCAD_ECO27      ----------------------------------------------------------------------
YCAD_ECO24      ----------------------------------------------------------------------
SPNS1_DANRE     ----------------------------------------------------------------------
YITG_BACSU      ----------------------------------------------------------------------
YCAD_SALEP      ----------------------------------------------------------------------
VACHT_DANRE     ----------------------------------------------------------------------
PMRA_STRR6      ----------------------------------------------------------------------
PMRA_STRPN      ----------------------------------------------------------------------
BMR2_BACSU      ----------------------------------------------------------------------
YCAD_SALPB      ----------------------------------------------------------------------
MDTD_SHIDS      ----------------------------------------------------------------------
YCAD_SALAR      ----------------------------------------------------------------------
SVOPL_MOUSE     ----------------------------------------------------------------------
S17A5_HUMAN     ----------------------------------------------------------------------
DGOT_ECOLI      IMGANYTNDPMMIMCLMALAFFGNG---------------------------------------------
DGOT_ECOL6      IMGANYTNDPMMIMCLMALAFFGNG---------------------------------------------
YAJR_ECOLI      ----------------------------------------------------------------------
Y1560_METJA     ----------------------------------------------------------------------
S22A2_RAT       ----------------------------------------------------------------------
ITR2_SCHPO      ----------------------------------------------------------------------
YFIS_BACSU      ----------------------------------------------------------------------
MSSP3_ARATH     ----------------------------------------------------------------------
EMRD_ECOLI      ----------------------------------------------------------------------
BBEX_BACSU      ----------------------------------------------------------------------
YCAD_SALG2      ----------------------------------------------------------------------
YCAD_SALDC      ----------------------------------------------------------------------
AQR1_YEAST      ----------------------------------------------------------------------
SVOPL_DANRE     ----------------------------------------------------------------------
YUXJ_BACSU      ----------------------------------------------------------------------
VMAT2_RAT       ----------------------------------------------------------------------
UHPT_CHLPN      ----------------------------------------------------------------------
GTR9_HUMAN      ----------------------------------------------------------------------
BMRP_CANAL      ----------------------------------------------------------------------
Y1421_ENT38     ----------------------------------------------------------------------
TPO4_YEAST      ----------------------------------------------------------------------
S17A4_MOUSE     ----------------------------------------------------------------------
VACHT_DROME     ----------------------------------------------------------------------
S22A2_MOUSE     ----------------------------------------------------------------------
PMRA_LACLA      ----------------------------------------------------------------------
GTR9_PONAB      ----------------------------------------------------------------------
FSLK_DICDI      IALYGFSP--------------------------------------------------------------
YJHB_ECOLI      ----------------------------------------------------------------------
UHPT_CHLTR      ----------------------------------------------------------------------
SPNS1_XENLA     ----------------------------------------------------------------------
PLST3_ARATH     ----------------------------------------------------------------------
OXLT_OXAFO      ----------------------------------------------------------------------
ANTR1_ARATH     ----------------------------------------------------------------------
HOL1_YEAST      ----------------------------------------------------------------------
YN22_SCHPO      ----------------------------------------------------------------------
VMAT2_MOUSE     ----------------------------------------------------------------------
VMAT2_BOVIN     ----------------------------------------------------------------------
TUB4_AGRVI      ----------------------------------------------------------------------
NPT1_HUMAN      ----------------------------------------------------------------------
MHPT_ECOLI      ----------------------------------------------------------------------
LTAA_STAS1      ----------------------------------------------------------------------
YQ92_SCHPO      ----------------------------------------------------------------------
YMPB_CAEEL      ----------------------------------------------------------------------
YCEI_BACSU      ----------------------------------------------------------------------
VMAT2_HUMAN     ----------------------------------------------------------------------
TUB3_AGRVI      ----------------------------------------------------------------------
CMLA_PSEAE      ----------------------------------------------------------------------
YWFA_BACSU      ----------------------------------------------------------------------
YIQ6_YEAST      ----------------------------------------------------------------------
YDGK_BACSU      ----------------------------------------------------------------------
Y411_BUCBP      ----------------------------------------------------------------------
Y2680_YERPY     ----------------------------------------------------------------------
Y2592_YERP3     ----------------------------------------------------------------------
Y2315_YERPP     ----------------------------------------------------------------------
Y1506_YERPB     ----------------------------------------------------------------------
Y1405_YERPS     ----------------------------------------------------------------------
Y1380_YERPE     ----------------------------------------------------------------------
XYLL3_ARATH     ----------------------------------------------------------------------
SPNS3_MOUSE     ----------------------------------------------------------------------
S22A1_RABIT     ----------------------------------------------------------------------
GTR4_HUMAN      ----------------------------------------------------------------------
ANTR3_ARATH     ----------------------------------------------------------------------
Y450_BUCAP      ----------------------------------------------------------------------
S17A5_SHEEP     ----------------------------------------------------------------------
YOU1_CAEEL      ----------------------------------------------------------------------
YHK8_YEAST      ----------------------------------------------------------------------
YFKF_BACSU      ----------------------------------------------------------------------
UHPT_CHLMU      ----------------------------------------------------------------------
PLST1_ARATH     ----------------------------------------------------------------------
NU4C_NEPOL      ----------------------------------------------------------------------
MFS1_SCHPO      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           FISRNQQTTYLELSQNISSLNNNFQSWSHSLPMPDLATVALAKQQVLHQSSLLSYINSFYVVGILSLILA
EMRB_ECOLI      MWTNRESMHHAQLTESVNPFNPNAQSQLEGLGMTQQQASGWIAQQITNQGLIISANEIFWMAGIFLVLLG
EMRB_ECO57      MWTNRESMHHAQLTESVNPFNPNAQSQLEGLGMTQQQASGWIAQQITNQGLIISANEIFWMAGIFLVLLG
EMRB_HAEIN      FMWYNREAVHTQLTEHINPYNPISQSFYHQMGLSDTQTSAYLAQQITSQGFIIGANEIFWLSAMGFLGLL
EMRY_ECOLI      LWGRRESLHHSQLTATIDQFNPVFNSSSQIMDYGSLSGVLNEINNEITQQSLSISANEIFRMAAIAFILL
MDTD_YERPY      ----------------------------------------------------------------------
MDTD_YERPP      ----------------------------------------------------------------------
MDTD_YERPN      ----------------------------------------------------------------------
MDTD_YERPG      ----------------------------------------------------------------------
MDTD_YERPE      ----------------------------------------------------------------------
MDTD_YERPB      ----------------------------------------------------------------------
MDTD_YERPA      ----------------------------------------------------------------------
MDTD_YERP3      ----------------------------------------------------------------------
BMR3_BACSU      ----------------------------------------------------------------------
MDTD_YERPS      ----------------------------------------------------------------------
MDTD_PECCP      ----------------------------------------------------------------------
MDTD_SERP5      ----------------------------------------------------------------------
MDTD_YERE8      ----------------------------------------------------------------------
YHCA_BACSU      IYTNRTTFHYSQIADKTSTADPNF----------------------------------------------
YEBQ_ECOLI      MLNQ------------------------------------------------------------------
LMRB_LISIN      IMSAGQK-AYMETAQGV-----------------------------------------------------
MDTD_ECOL6      ----------------------------------------------------------------------
MDTD_ECO81      ----------------------------------------------------------------------
LMRB_LISMO      IMSAGQK-AYMETAQGV-----------------------------------------------------
MDTD_SHIF8      ----------------------------------------------------------------------
MDTD_ESCF3      ----------------------------------------------------------------------
MDTD_ECOUT      ----------------------------------------------------------------------
MDTD_ECOLU      ----------------------------------------------------------------------
MDTD_ECOK1      ----------------------------------------------------------------------
MDTD_ECO45      ----------------------------------------------------------------------
MDTD_SHISS      ----------------------------------------------------------------------
MDTD_SHIFL      ----------------------------------------------------------------------
MDTD_SHIBS      ----------------------------------------------------------------------
MDTD_SHIB3      ----------------------------------------------------------------------
MDTD_ECOSM      ----------------------------------------------------------------------
MDTD_ECOSE      ----------------------------------------------------------------------
MDTD_ECOLI      ----------------------------------------------------------------------
MDTD_ECOLC      ----------------------------------------------------------------------
MDTD_ECOL5      ----------------------------------------------------------------------
MDTD_ECOHS      ----------------------------------------------------------------------
MDTD_ECODH      ----------------------------------------------------------------------
MDTD_ECOBW      ----------------------------------------------------------------------
MDTD_ECO8A      ----------------------------------------------------------------------
MDTD_ECO7I      ----------------------------------------------------------------------
MDTD_ECO5E      ----------------------------------------------------------------------
MDTD_ECO57      ----------------------------------------------------------------------
MDTD_ECO55      ----------------------------------------------------------------------
MDTD_ECO27      ----------------------------------------------------------------------
MDTD_ECO24      ----------------------------------------------------------------------
MDTD_CITK8      ----------------------------------------------------------------------
MDTD_SALSV      ----------------------------------------------------------------------
SGE1_YEAST      ----------------------------------------------------------------------
HSRA_ECOLI      ----------------------------------------------------------------------
MDTD_SALTI      ----------------------------------------------------------------------
MDTD_SALPK      ----------------------------------------------------------------------
MDTD_SALPB      ----------------------------------------------------------------------
MDTD_SALPA      ----------------------------------------------------------------------
MDTD_SALNS      ----------------------------------------------------------------------
MDTD_SALHS      ----------------------------------------------------------------------
MDTD_SALEP      ----------------------------------------------------------------------
MDTD_SALDC      ----------------------------------------------------------------------
MDTD_SALA4      ----------------------------------------------------------------------
MDTD_SALTY      ----------------------------------------------------------------------
MDTD_ERWCT      ----------------------------------------------------------------------
MDTD_ENT38      ----------------------------------------------------------------------
TCMA_STRGA      ----------------------------------------------------------------------
LMRB_BACSU      ----------------------------------------------------------------------
YUSP_BACSU      ----------------------------------------------------------------------
HSRA_HAEIN      ----------------------------------------------------------------------
YCNB_BACSU      ----------------------------------------------------------------------
QACA_STAAU      ----------------------------------------------------------------------
QACA_STAAM      ----------------------------------------------------------------------
MDTD_ENTS8      ----------------------------------------------------------------------
MDTD_KLEP3      ----------------------------------------------------------------------
MDTD_KLEP7      ----------------------------------------------------------------------
YFIU_BACSU      ----------------------------------------------------------------------
BAIG_EUBSP      ----------------------------------------------------------------------
YJA1_SCHPO      ----------------------------------------------------------------------
YAN6_SCHPO      ----------------------------------------------------------------------
VBA5_YEAST      ----------------------------------------------------------------------
MMR_STRCO       ----------------------------------------------------------------------
TCR_STRPN       ----------------------------------------------------------------------
TCR_BACSU       ----------------------------------------------------------------------
TCR_BACST       ----------------------------------------------------------------------
TCR_BACCE       ----------------------------------------------------------------------
MDTL_SALAR      ----------------------------------------------------------------------
YI32_SCHPO      ----------------------------------------------------------------------
MDTM_ECOLI      ----------------------------------------------------------------------
MDTM_ECO57      ----------------------------------------------------------------------
YVKA_BACSU      ----------------------------------------------------------------------
YCT4_SCHPO      ----------------------------------------------------------------------
TCR_STRAG       ----------------------------------------------------------------------
MDTL_SALPK      ----------------------------------------------------------------------
MDTL_SALPA      ----------------------------------------------------------------------
MDTL_SALEP      ----------------------------------------------------------------------
MDTL_SALDC      ----------------------------------------------------------------------
MDTL_SALTI      ----------------------------------------------------------------------
TCRB_BACSU      ----------------------------------------------------------------------
MDTL_SALTY      ----------------------------------------------------------------------
MDTL_SALPC      ----------------------------------------------------------------------
MDTL_SALPB      ----------------------------------------------------------------------
MDTL_SALNS      ----------------------------------------------------------------------
MDTL_SALHS      ----------------------------------------------------------------------
MDTL_SALCH      ----------------------------------------------------------------------
MDTL_SALA4      ----------------------------------------------------------------------
AZR1_YEAST      ----------------------------------------------------------------------
MDTL_SALSV      ----------------------------------------------------------------------
MMR_BACSU       ----------------------------------------------------------------------
MDTL_VIBPA      ----------------------------------------------------------------------
YHX6_SCHPO      ----------------------------------------------------------------------
YHD3_SCHPO      ----------------------------------------------------------------------
TCR_STAHY       ----------------------------------------------------------------------
MDTL_ECOL6      ----------------------------------------------------------------------
MDTL_ECO81      ----------------------------------------------------------------------
ATR1_YEAST      ----------------------------------------------------------------------
ACT22_STRCO     ----------------------------------------------------------------------
MDTL_ECOL5      ----------------------------------------------------------------------
MDTL_ECO27      ----------------------------------------------------------------------
MDTL_ECOUT      ----------------------------------------------------------------------
MDTL_ECOK1      ----------------------------------------------------------------------
MDTL_ECO45      ----------------------------------------------------------------------
YN42_SCHPO      ----------------------------------------------------------------------
MDTL_KLEP3      ----------------------------------------------------------------------
MDTL_ESCF3      ----------------------------------------------------------------------
MDTL_ECOSM      ----------------------------------------------------------------------
MDTL_ECOLU      ----------------------------------------------------------------------
CMCT_NOCLA      ----------------------------------------------------------------------
MDTL_SHISS      ----------------------------------------------------------------------
MDTL_SHIFL      ----------------------------------------------------------------------
MDTL_SHIF8      ----------------------------------------------------------------------
MDTL_SHIBS      ----------------------------------------------------------------------
MDTL_SHIB3      ----------------------------------------------------------------------
MDTL_ECOSE      ----------------------------------------------------------------------
MDTL_ECOLI      ----------------------------------------------------------------------
MDTL_ECOLC      ----------------------------------------------------------------------
MDTL_ECOHS      ----------------------------------------------------------------------
MDTL_ECODH      ----------------------------------------------------------------------
MDTL_ECOBW      ----------------------------------------------------------------------
MDTL_ECO8A      ----------------------------------------------------------------------
MDTL_ECO7I      ----------------------------------------------------------------------
MDTL_ECO55      ----------------------------------------------------------------------
MDTL_ECO24      ----------------------------------------------------------------------
MDTL_CITK8      ----------------------------------------------------------------------
MDTL_SHIDS      ----------------------------------------------------------------------
MDTL_ECO5E      ----------------------------------------------------------------------
MDTL_ECO57      ----------------------------------------------------------------------
YFMO_BACSU      ----------------------------------------------------------------------
PHDK_NOCSK      ----------------------------------------------------------------------
YBIH_SCHPO      ----------------------------------------------------------------------
YWOG_BACSU      ----------------------------------------------------------------------
MDFA_ECOLI      ----------------------------------------------------------------------
MDFA_ECOL6      ----------------------------------------------------------------------
MDFA_ECO57      ----------------------------------------------------------------------
YQO5_SCHPO      ----------------------------------------------------------------------
MDTL_KLEP7      ----------------------------------------------------------------------
YN41_SCHPO      ----------------------------------------------------------------------
VBA2_YEAST      ----------------------------------------------------------------------
BCR_HAEIN       ----------------------------------------------------------------------
YN43_SCHPO      ----------------------------------------------------------------------
YDHC_ECOLI      ----------------------------------------------------------------------
NANT_SALTY      ----------------------------------------------------------------------
NANT_SALTI      ----------------------------------------------------------------------
NANT_SALSV      ----------------------------------------------------------------------
NANT_SALPK      ----------------------------------------------------------------------
NANT_SALPC      ----------------------------------------------------------------------
NANT_SALPB      ----------------------------------------------------------------------
NANT_SALPA      ----------------------------------------------------------------------
NANT_SALNS      ----------------------------------------------------------------------
NANT_SALHS      ----------------------------------------------------------------------
NANT_SALG2      ----------------------------------------------------------------------
NANT_SALEP      ----------------------------------------------------------------------
NANT_SALDC      ----------------------------------------------------------------------
NANT_SALCH      ----------------------------------------------------------------------
NANT_SALAR      ----------------------------------------------------------------------
NANT_ESCF3      ----------------------------------------------------------------------
NANT_CITK8      ----------------------------------------------------------------------
YYBF_BACSU      ----------------------------------------------------------------------
YO378_YEAST     ----------------------------------------------------------------------
YWOD_BACSU      ----------------------------------------------------------------------
Y466_BUCAI      ----------------------------------------------------------------------
NANT_SHIFL      ----------------------------------------------------------------------
NANT_SHIF8      ----------------------------------------------------------------------
NANT_SHIB3      ----------------------------------------------------------------------
NANT_ECOSM      ----------------------------------------------------------------------
NANT_ECOSE      ----------------------------------------------------------------------
NANT_ECOLI      ----------------------------------------------------------------------
NANT_ECOLC      ----------------------------------------------------------------------
NANT_ECOL5      ----------------------------------------------------------------------
NANT_ECOHS      ----------------------------------------------------------------------
NANT_ECODH      ----------------------------------------------------------------------
NANT_ECOBW      ----------------------------------------------------------------------
NANT_ECO8A      ----------------------------------------------------------------------
NANT_ECO7I      ----------------------------------------------------------------------
NANT_ECO5E      ----------------------------------------------------------------------
NANT_ECO57      ----------------------------------------------------------------------
NANT_ECO55      ----------------------------------------------------------------------
NANT_ECO45      ----------------------------------------------------------------------
NANT_ECO27      ----------------------------------------------------------------------
NANT_ECO24      ----------------------------------------------------------------------
NANT1_ECOL6     ----------------------------------------------------------------------
YB30_YEAST      ----------------------------------------------------------------------
TCR_STAES       ----------------------------------------------------------------------
TCR_STAAU       ----------------------------------------------------------------------
SPIN_DROME      ----------------------------------------------------------------------
YN2F_SCHPO      ----------------------------------------------------------------------
SMVA_SALTY      ----------------------------------------------------------------------
MIRC_EMENI      ----------------------------------------------------------------------
YYAJ_BACSU      ----------------------------------------------------------------------
FNX1_SCHPO      ----------------------------------------------------------------------
YHA8_SCHPO      ----------------------------------------------------------------------
YWTG_BACSU      ----------------------------------------------------------------------
Y588_BUCAI      ----------------------------------------------------------------------
PCAK_ACIAD      ----------------------------------------------------------------------
NANT_YERPY      ----------------------------------------------------------------------
BCR_ECOLI       ----------------------------------------------------------------------
BENK_ACIAD      ----------------------------------------------------------------------
YM8M_YEAST      ----------------------------------------------------------------------
MDTM_SALTY      ----------------------------------------------------------------------
MDTM_SALTI      ----------------------------------------------------------------------
NANT_YERPS      ----------------------------------------------------------------------
NANT_YERPP      ----------------------------------------------------------------------
NANT_YERPG      ----------------------------------------------------------------------
NANT_YERPB      ----------------------------------------------------------------------
NANT_YERP3      ----------------------------------------------------------------------
NANT2_ECOL6     ----------------------------------------------------------------------
GALP_ECOLI      ----------------------------------------------------------------------
GALP_ECOL6      ----------------------------------------------------------------------
YVMA_BACSU      ----------------------------------------------------------------------
YUBD_BACSU      ----------------------------------------------------------------------
YHJO_BACSU      ----------------------------------------------------------------------
TPO1_YEAST      ----------------------------------------------------------------------
NANT_YERPE      ----------------------------------------------------------------------
NANT_YERPA      ----------------------------------------------------------------------
MDTL_SHESA      ----------------------------------------------------------------------
CSBC_BACSU      ----------------------------------------------------------------------
Y567_BUCAP      ----------------------------------------------------------------------
NANT_SALA4      ----------------------------------------------------------------------
YCEJ_BACSU      ----------------------------------------------------------------------
VBA3_YEAST      ----------------------------------------------------------------------
TPO3_YEAST      ----------------------------------------------------------------------
BCRH_RICTY      ----------------------------------------------------------------------
ARAE_KLEOX      ----------------------------------------------------------------------
EXUT_BACSU      ----------------------------------------------------------------------
ARAE_ECOLI      ----------------------------------------------------------------------
ARAE_ECO57      ----------------------------------------------------------------------
Y2171_CITK8     ----------------------------------------------------------------------
SVOPL_HUMAN     ----------------------------------------------------------------------
MDTL_SHEON      ----------------------------------------------------------------------
TPO2_YEAST      ----------------------------------------------------------------------
NANT_ENTS8      ----------------------------------------------------------------------
BSU1_SCHPO      ----------------------------------------------------------------------
YCAD_SHIFL      ----------------------------------------------------------------------
YCAD_SHIF8      ----------------------------------------------------------------------
YCAD_SALTY      ----------------------------------------------------------------------
YCAD_SALTI      ----------------------------------------------------------------------
YCAD_SALSV      ----------------------------------------------------------------------
YCAD_SALPK      ----------------------------------------------------------------------
YCAD_SALPC      ----------------------------------------------------------------------
YCAD_SALPA      ----------------------------------------------------------------------
YCAD_SALNS      ----------------------------------------------------------------------
YCAD_SALHS      ----------------------------------------------------------------------
YCAD_SALCH      ----------------------------------------------------------------------
YCAD_SALA4      ----------------------------------------------------------------------
CYHR_CANMA      ----------------------------------------------------------------------
BCRH_RICPR      ----------------------------------------------------------------------
YCAD_ESCF3      ----------------------------------------------------------------------
S17A5_MOUSE     ----------------------------------------------------------------------
MUCK_ACIAD      ----------------------------------------------------------------------
YCAD_SHISS      ----------------------------------------------------------------------
YCAD_SHIDS      ----------------------------------------------------------------------
YCAD_ECOUT      ----------------------------------------------------------------------
YCAD_ECOSM      ----------------------------------------------------------------------
YCAD_ECOSE      ----------------------------------------------------------------------
YCAD_ECOLU      ----------------------------------------------------------------------
YCAD_ECOLI      ----------------------------------------------------------------------
YCAD_ECOLC      ----------------------------------------------------------------------
YCAD_ECOL6      ----------------------------------------------------------------------
YCAD_ECOL5      ----------------------------------------------------------------------
YCAD_ECOK1      ----------------------------------------------------------------------
YCAD_ECOHS      ----------------------------------------------------------------------
YCAD_ECODH      ----------------------------------------------------------------------
YCAD_ECOBW      ----------------------------------------------------------------------
YCAD_ECO8A      ----------------------------------------------------------------------
YCAD_ECO81      ----------------------------------------------------------------------
YCAD_ECO7I      ----------------------------------------------------------------------
YCAD_ECO5E      ----------------------------------------------------------------------
YCAD_ECO57      ----------------------------------------------------------------------
YCAD_ECO55      ----------------------------------------------------------------------
YCAD_ECO45      ----------------------------------------------------------------------
YCAD_ECO27      ----------------------------------------------------------------------
YCAD_ECO24      ----------------------------------------------------------------------
SPNS1_DANRE     ----------------------------------------------------------------------
YITG_BACSU      ----------------------------------------------------------------------
YCAD_SALEP      ----------------------------------------------------------------------
VACHT_DANRE     ----------------------------------------------------------------------
PMRA_STRR6      ----------------------------------------------------------------------
PMRA_STRPN      ----------------------------------------------------------------------
BMR2_BACSU      ----------------------------------------------------------------------
YCAD_SALPB      ----------------------------------------------------------------------
MDTD_SHIDS      ----------------------------------------------------------------------
YCAD_SALAR      ----------------------------------------------------------------------
SVOPL_MOUSE     ----------------------------------------------------------------------
S17A5_HUMAN     ----------------------------------------------------------------------
DGOT_ECOLI      ----------------------------------------------------------------------
DGOT_ECOL6      ----------------------------------------------------------------------
YAJR_ECOLI      ----------------------------------------------------------------------
Y1560_METJA     ----------------------------------------------------------------------
S22A2_RAT       ----------------------------------------------------------------------
ITR2_SCHPO      ----------------------------------------------------------------------
YFIS_BACSU      ----------------------------------------------------------------------
MSSP3_ARATH     ----------------------------------------------------------------------
EMRD_ECOLI      ----------------------------------------------------------------------
BBEX_BACSU      ----------------------------------------------------------------------
YCAD_SALG2      ----------------------------------------------------------------------
YCAD_SALDC      ----------------------------------------------------------------------
AQR1_YEAST      ----------------------------------------------------------------------
SVOPL_DANRE     ----------------------------------------------------------------------
YUXJ_BACSU      ----------------------------------------------------------------------
VMAT2_RAT       ----------------------------------------------------------------------
UHPT_CHLPN      ----------------------------------------------------------------------
GTR9_HUMAN      ----------------------------------------------------------------------
BMRP_CANAL      ----------------------------------------------------------------------
Y1421_ENT38     ----------------------------------------------------------------------
TPO4_YEAST      ----------------------------------------------------------------------
S17A4_MOUSE     ----------------------------------------------------------------------
VACHT_DROME     ----------------------------------------------------------------------
S22A2_MOUSE     ----------------------------------------------------------------------
PMRA_LACLA      ----------------------------------------------------------------------
GTR9_PONAB      ----------------------------------------------------------------------
FSLK_DICDI      ----------------------------------------------------------------------
YJHB_ECOLI      ----------------------------------------------------------------------
UHPT_CHLTR      ----------------------------------------------------------------------
SPNS1_XENLA     ----------------------------------------------------------------------
PLST3_ARATH     ----------------------------------------------------------------------
OXLT_OXAFO      ----------------------------------------------------------------------
ANTR1_ARATH     ----------------------------------------------------------------------
HOL1_YEAST      ----------------------------------------------------------------------
YN22_SCHPO      ----------------------------------------------------------------------
VMAT2_MOUSE     ----------------------------------------------------------------------
VMAT2_BOVIN     ----------------------------------------------------------------------
TUB4_AGRVI      ----------------------------------------------------------------------
NPT1_HUMAN      ----------------------------------------------------------------------
MHPT_ECOLI      ----------------------------------------------------------------------
LTAA_STAS1      ----------------------------------------------------------------------
YQ92_SCHPO      ----------------------------------------------------------------------
YMPB_CAEEL      ----------------------------------------------------------------------
YCEI_BACSU      ----------------------------------------------------------------------
VMAT2_HUMAN     ----------------------------------------------------------------------
TUB3_AGRVI      ----------------------------------------------------------------------
CMLA_PSEAE      ----------------------------------------------------------------------
YWFA_BACSU      ----------------------------------------------------------------------
YIQ6_YEAST      ----------------------------------------------------------------------
YDGK_BACSU      ----------------------------------------------------------------------
Y411_BUCBP      ----------------------------------------------------------------------
Y2680_YERPY     ----------------------------------------------------------------------
Y2592_YERP3     ----------------------------------------------------------------------
Y2315_YERPP     ----------------------------------------------------------------------
Y1506_YERPB     ----------------------------------------------------------------------
Y1405_YERPS     ----------------------------------------------------------------------
Y1380_YERPE     ----------------------------------------------------------------------
XYLL3_ARATH     ----------------------------------------------------------------------
SPNS3_MOUSE     ----------------------------------------------------------------------
S22A1_RABIT     ----------------------------------------------------------------------
GTR4_HUMAN      ----------------------------------------------------------------------
ANTR3_ARATH     ----------------------------------------------------------------------
Y450_BUCAP      ----------------------------------------------------------------------
S17A5_SHEEP     ----------------------------------------------------------------------
YOU1_CAEEL      ----------------------------------------------------------------------
YHK8_YEAST      ----------------------------------------------------------------------
YFKF_BACSU      ----------------------------------------------------------------------
UHPT_CHLMU      ----------------------------------------------------------------------
PLST1_ARATH     ----------------------------------------------------------------------
NU4C_NEPOL      ----------------------------------------------------------------------
MFS1_SCHPO      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           IVPFLLKEPPxxxxxxxxx
EMRB_ECOLI      LVWF--AKPP---------
EMRB_ECO57      LVWF--AKPP---------
EMRB_HAEIN      IVIWFAKPP----------
EMRY_ECOLI      TVLVWFAKPP---------
MDTD_YERPY      -------------------
MDTD_YERPP      -------------------
MDTD_YERPN      -------------------
MDTD_YERPG      -------------------
MDTD_YERPE      -------------------
MDTD_YERPB      -------------------
MDTD_YERPA      -------------------
MDTD_YERP3      -------------------
BMR3_BACSU      -------------------
MDTD_YERPS      -------------------
MDTD_PECCP      -------------------
MDTD_SERP5      -------------------
MDTD_YERE8      -------------------
YHCA_BACSU      -------------------
YEBQ_ECOLI      -------------------
LMRB_LISIN      -------------------
MDTD_ECOL6      -------------------
MDTD_ECO81      -------------------
LMRB_LISMO      -------------------
MDTD_SHIF8      -------------------
MDTD_ESCF3      -------------------
MDTD_ECOUT      -------------------
MDTD_ECOLU      -------------------
MDTD_ECOK1      -------------------
MDTD_ECO45      -------------------
MDTD_SHISS      -------------------
MDTD_SHIFL      -------------------
MDTD_SHIBS      -------------------
MDTD_SHIB3      -------------------
MDTD_ECOSM      -------------------
MDTD_ECOSE      -------------------
MDTD_ECOLI      -------------------
MDTD_ECOLC      -------------------
MDTD_ECOL5      -------------------
MDTD_ECOHS      -------------------
MDTD_ECODH      -------------------
MDTD_ECOBW      -------------------
MDTD_ECO8A      -------------------
MDTD_ECO7I      -------------------
MDTD_ECO5E      -------------------
MDTD_ECO57      -------------------
MDTD_ECO55      -------------------
MDTD_ECO27      -------------------
MDTD_ECO24      -------------------
MDTD_CITK8      -------------------
MDTD_SALSV      -------------------
SGE1_YEAST      -------------------
HSRA_ECOLI      -------------------
MDTD_SALTI      -------------------
MDTD_SALPK      -------------------
MDTD_SALPB      -------------------
MDTD_SALPA      -------------------
MDTD_SALNS      -------------------
MDTD_SALHS      -------------------
MDTD_SALEP      -------------------
MDTD_SALDC      -------------------
MDTD_SALA4      -------------------
MDTD_SALTY      -------------------
MDTD_ERWCT      -------------------
MDTD_ENT38      -------------------
TCMA_STRGA      -------------------
LMRB_BACSU      -------------------
YUSP_BACSU      -------------------
HSRA_HAEIN      -------------------
YCNB_BACSU      -------------------
QACA_STAAU      -------------------
QACA_STAAM      -------------------
MDTD_ENTS8      -------------------
MDTD_KLEP3      -------------------
MDTD_KLEP7      -------------------
YFIU_BACSU      -------------------
BAIG_EUBSP      -------------------
YJA1_SCHPO      -------------------
YAN6_SCHPO      -------------------
VBA5_YEAST      -------------------
MMR_STRCO       -------------------
TCR_STRPN       -------------------
TCR_BACSU       -------------------
TCR_BACST       -------------------
TCR_BACCE       -------------------
MDTL_SALAR      -------------------
YI32_SCHPO      -------------------
MDTM_ECOLI      -------------------
MDTM_ECO57      -------------------
YVKA_BACSU      -------------------
YCT4_SCHPO      -------------------
TCR_STRAG       -------------------
MDTL_SALPK      -------------------
MDTL_SALPA      -------------------
MDTL_SALEP      -------------------
MDTL_SALDC      -------------------
MDTL_SALTI      -------------------
TCRB_BACSU      -------------------
MDTL_SALTY      -------------------
MDTL_SALPC      -------------------
MDTL_SALPB      -------------------
MDTL_SALNS      -------------------
MDTL_SALHS      -------------------
MDTL_SALCH      -------------------
MDTL_SALA4      -------------------
AZR1_YEAST      -------------------
MDTL_SALSV      -------------------
MMR_BACSU       -------------------
MDTL_VIBPA      -------------------
YHX6_SCHPO      -------------------
YHD3_SCHPO      -------------------
TCR_STAHY       -------------------
MDTL_ECOL6      -------------------
MDTL_ECO81      -------------------
ATR1_YEAST      -------------------
ACT22_STRCO     -------------------
MDTL_ECOL5      -------------------
MDTL_ECO27      -------------------
MDTL_ECOUT      -------------------
MDTL_ECOK1      -------------------
MDTL_ECO45      -------------------
YN42_SCHPO      -------------------
MDTL_KLEP3      -------------------
MDTL_ESCF3      -------------------
MDTL_ECOSM      -------------------
MDTL_ECOLU      -------------------
CMCT_NOCLA      -------------------
MDTL_SHISS      -------------------
MDTL_SHIFL      -------------------
MDTL_SHIF8      -------------------
MDTL_SHIBS      -------------------
MDTL_SHIB3      -------------------
MDTL_ECOSE      -------------------
MDTL_ECOLI      -------------------
MDTL_ECOLC      -------------------
MDTL_ECOHS      -------------------
MDTL_ECODH      -------------------
MDTL_ECOBW      -------------------
MDTL_ECO8A      -------------------
MDTL_ECO7I      -------------------
MDTL_ECO55      -------------------
MDTL_ECO24      -------------------
MDTL_CITK8      -------------------
MDTL_SHIDS      -------------------
MDTL_ECO5E      -------------------
MDTL_ECO57      -------------------
YFMO_BACSU      -------------------
PHDK_NOCSK      -------------------
YBIH_SCHPO      -------------------
YWOG_BACSU      -------------------
MDFA_ECOLI      -------------------
MDFA_ECOL6      -------------------
MDFA_ECO57      -------------------
YQO5_SCHPO      -------------------
MDTL_KLEP7      -------------------
YN41_SCHPO      -------------------
VBA2_YEAST      -------------------
BCR_HAEIN       -------------------
YN43_SCHPO      -------------------
YDHC_ECOLI      -------------------
NANT_SALTY      -------------------
NANT_SALTI      -------------------
NANT_SALSV      -------------------
NANT_SALPK      -------------------
NANT_SALPC      -------------------
NANT_SALPB      -------------------
NANT_SALPA      -------------------
NANT_SALNS      -------------------
NANT_SALHS      -------------------
NANT_SALG2      -------------------
NANT_SALEP      -------------------
NANT_SALDC      -------------------
NANT_SALCH      -------------------
NANT_SALAR      -------------------
NANT_ESCF3      -------------------
NANT_CITK8      -------------------
YYBF_BACSU      -------------------
YO378_YEAST     -------------------
YWOD_BACSU      -------------------
Y466_BUCAI      -------------------
NANT_SHIFL      -------------------
NANT_SHIF8      -------------------
NANT_SHIB3      -------------------
NANT_ECOSM      -------------------
NANT_ECOSE      -------------------
NANT_ECOLI      -------------------
NANT_ECOLC      -------------------
NANT_ECOL5      -------------------
NANT_ECOHS      -------------------
NANT_ECODH      -------------------
NANT_ECOBW      -------------------
NANT_ECO8A      -------------------
NANT_ECO7I      -------------------
NANT_ECO5E      -------------------
NANT_ECO57      -------------------
NANT_ECO55      -------------------
NANT_ECO45      -------------------
NANT_ECO27      -------------------
NANT_ECO24      -------------------
NANT1_ECOL6     -------------------
YB30_YEAST      -------------------
TCR_STAES       -------------------
TCR_STAAU       -------------------
SPIN_DROME      -------------------
YN2F_SCHPO      -------------------
SMVA_SALTY      -------------------
MIRC_EMENI      -------------------
YYAJ_BACSU      -------------------
FNX1_SCHPO      -------------------
YHA8_SCHPO      -------------------
YWTG_BACSU      -------------------
Y588_BUCAI      -------------------
PCAK_ACIAD      -------------------
NANT_YERPY      -------------------
BCR_ECOLI       -------------------
BENK_ACIAD      -------------------
YM8M_YEAST      -------------------
MDTM_SALTY      -------------------
MDTM_SALTI      -------------------
NANT_YERPS      -------------------
NANT_YERPP      -------------------
NANT_YERPG      -------------------
NANT_YERPB      -------------------
NANT_YERP3      -------------------
NANT2_ECOL6     -------------------
GALP_ECOLI      -------------------
GALP_ECOL6      -------------------
YVMA_BACSU      -------------------
YUBD_BACSU      -------------------
YHJO_BACSU      -------------------
TPO1_YEAST      -------------------
NANT_YERPE      -------------------
NANT_YERPA      -------------------
MDTL_SHESA      -------------------
CSBC_BACSU      -------------------
Y567_BUCAP      -------------------
NANT_SALA4      -------------------
YCEJ_BACSU      -------------------
VBA3_YEAST      -------------------
TPO3_YEAST      -------------------
BCRH_RICTY      -------------------
ARAE_KLEOX      -------------------
EXUT_BACSU      -------------------
ARAE_ECOLI      -------------------
ARAE_ECO57      -------------------
Y2171_CITK8     -------------------
SVOPL_HUMAN     -------------------
MDTL_SHEON      -------------------
TPO2_YEAST      -------------------
NANT_ENTS8      -------------------
BSU1_SCHPO      -------------------
YCAD_SHIFL      -------------------
YCAD_SHIF8      -------------------
YCAD_SALTY      -------------------
YCAD_SALTI      -------------------
YCAD_SALSV      -------------------
YCAD_SALPK      -------------------
YCAD_SALPC      -------------------
YCAD_SALPA      -------------------
YCAD_SALNS      -------------------
YCAD_SALHS      -------------------
YCAD_SALCH      -------------------
YCAD_SALA4      -------------------
CYHR_CANMA      -------------------
BCRH_RICPR      -------------------
YCAD_ESCF3      -------------------
S17A5_MOUSE     -------------------
MUCK_ACIAD      -------------------
YCAD_SHISS      -------------------
YCAD_SHIDS      -------------------
YCAD_ECOUT      -------------------
YCAD_ECOSM      -------------------
YCAD_ECOSE      -------------------
YCAD_ECOLU      -------------------
YCAD_ECOLI      -------------------
YCAD_ECOLC      -------------------
YCAD_ECOL6      -------------------
YCAD_ECOL5      -------------------
YCAD_ECOK1      -------------------
YCAD_ECOHS      -------------------
YCAD_ECODH      -------------------
YCAD_ECOBW      -------------------
YCAD_ECO8A      -------------------
YCAD_ECO81      -------------------
YCAD_ECO7I      -------------------
YCAD_ECO5E      -------------------
YCAD_ECO57      -------------------
YCAD_ECO55      -------------------
YCAD_ECO45      -------------------
YCAD_ECO27      -------------------
YCAD_ECO24      -------------------
SPNS1_DANRE     -------------------
YITG_BACSU      -------------------
YCAD_SALEP      -------------------
VACHT_DANRE     -------------------
PMRA_STRR6      -------------------
PMRA_STRPN      -------------------
BMR2_BACSU      -------------------
YCAD_SALPB      -------------------
MDTD_SHIDS      -------------------
YCAD_SALAR      -------------------
SVOPL_MOUSE     -------------------
S17A5_HUMAN     -------------------
DGOT_ECOLI      -------------------
DGOT_ECOL6      -------------------
YAJR_ECOLI      -------------------
Y1560_METJA     -------------------
S22A2_RAT       -------------------
ITR2_SCHPO      -------------------
YFIS_BACSU      -------------------
MSSP3_ARATH     -------------------
EMRD_ECOLI      -------------------
BBEX_BACSU      -------------------
YCAD_SALG2      -------------------
YCAD_SALDC      -------------------
AQR1_YEAST      -------------------
SVOPL_DANRE     -------------------
YUXJ_BACSU      -------------------
VMAT2_RAT       -------------------
UHPT_CHLPN      -------------------
GTR9_HUMAN      -------------------
BMRP_CANAL      -------------------
Y1421_ENT38     -------------------
TPO4_YEAST      -------------------
S17A4_MOUSE     -------------------
VACHT_DROME     -------------------
S22A2_MOUSE     -------------------
PMRA_LACLA      -------------------
GTR9_PONAB      -------------------
FSLK_DICDI      -------------------
YJHB_ECOLI      -------------------
UHPT_CHLTR      -------------------
SPNS1_XENLA     -------------------
PLST3_ARATH     -------------------
OXLT_OXAFO      -------------------
ANTR1_ARATH     -------------------
HOL1_YEAST      -------------------
YN22_SCHPO      -------------------
VMAT2_MOUSE     -------------------
VMAT2_BOVIN     -------------------
TUB4_AGRVI      -------------------
NPT1_HUMAN      -------------------
MHPT_ECOLI      -------------------
LTAA_STAS1      -------------------
YQ92_SCHPO      -------------------
YMPB_CAEEL      -------------------
YCEI_BACSU      -------------------
VMAT2_HUMAN     -------------------
TUB3_AGRVI      -------------------
CMLA_PSEAE      -------------------
YWFA_BACSU      -------------------
YIQ6_YEAST      -------------------
YDGK_BACSU      -------------------
Y411_BUCBP      -------------------
Y2680_YERPY     -------------------
Y2592_YERP3     -------------------
Y2315_YERPP     -------------------
Y1506_YERPB     -------------------
Y1405_YERPS     -------------------
Y1380_YERPE     -------------------
XYLL3_ARATH     -------------------
SPNS3_MOUSE     -------------------
S22A1_RABIT     -------------------
GTR4_HUMAN      -------------------
ANTR3_ARATH     -------------------
Y450_BUCAP      -------------------
S17A5_SHEEP     -------------------
YOU1_CAEEL      -------------------
YHK8_YEAST      -------------------
YFKF_BACSU      -------------------
UHPT_CHLMU      -------------------
PLST1_ARATH     -------------------
NU4C_NEPOL      -------------------
MFS1_SCHPO      -------------------