[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD31051.1

[Show Plain Result]


## Summary of Sequence Search
    1::249
  119::221     7e-04  30%  267 aa  UPPP_WIGBR RecName: Full=Undecaprenyl-diphosphatase;       
    1::249

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
UPPP_WIGBR      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xFLIIMVATIFVYAMIIILQGIMIKHELKVSDALKIALQIFSKRVFAFLRAFLLSMIAMTLLTMFLQYIG
UPPP_WIGBR      -YFLILGSIFFILSEFISLKKIKIDNFKKIS-FLKYFI-IGSSQCFSLLPGVLGITISIGLILNIDRYVL


                         +         .         .         .         .         *         .:210
query           IFLAILLFLTVMPAVLLAQKGVFESLSANFYAVKNNFFYMxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
UPPP_WIGBR      FKFSMILFSSIMPAVLILE------VYKNFFYLKENIFFV------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
UPPP_WIGBR      ---------------------------------------