[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD31053.1

[Show Plain Result]


## Summary of Sequence Search
    1::455
    1::455       0.0 100%  455 aa  HSLU_FRATW RecName: Full=ATP-dependent hsl protease ATP-binding
    1::455       0.0 100%  455 aa  HSLU_FRATT RecName: Full=ATP-dependent hsl protease ATP-binding
    1::455       0.0 100%  455 aa  HSLU_FRATO RecName: Full=ATP-dependent hsl protease ATP-binding
    1::455       0.0 100%  455 aa  HSLU_FRATM RecName: Full=ATP-dependent hsl protease ATP-binding
    1::455       0.0 100%  455 aa  HSLU_FRATH RecName: Full=ATP-dependent hsl protease ATP-binding
    1::455       0.0 100%  455 aa  HSLU_FRATF RecName: Full=ATP-dependent hsl protease ATP-binding
    1::455       0.0 100%  455 aa  HSLU_FRAT1 RecName: Full=ATP-dependent hsl protease ATP-binding
    1::455       0.0  99%  455 aa  HSLU_FRATN RecName: Full=ATP-dependent hsl protease ATP-binding
    1::455       0.0  89%  455 aa  HSLU_FRAP2 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-162  66%  443 aa  HSLU_MARAV RecName: Full=ATP-dependent hsl protease ATP-binding
    4::442     e-161  65%  442 aa  HSLU_HAHCH RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-157  63%  443 aa  HSLU_HAES1 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-157  63%  443 aa  HSLU_HAES2 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::440     e-157  69%  440 aa  HSLU_CELJU RecName: Full=ATP-dependent hsl protease ATP-binding
    4::438     e-156  68%  438 aa  HSLU_SACD2 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-156  64%  443 aa  HSLU_ECO5E RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-155  63%  443 aa  HSLU_SHIB3 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-155  63%  443 aa  HSLU_PECCP RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-155  63%  443 aa  HSLU_ERWCT RecName: Full=ATP-dependent hsl protease ATP-binding
    4::438     e-155  67%  438 aa  HSLU_TERTT RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-155  67%  443 aa  HSLU_PSEA6 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-155  63%  443 aa  HSLU_SHISS RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-155  63%  443 aa  HSLU_SHIFL RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-155  63%  443 aa  HSLU_SHIF8 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-155  63%  443 aa  HSLU_SHIBS RecName: Full=ATP-dependent hsl protease ATP-binding
    3::440     e-155  65%  440 aa  HSLU_HAEPS RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-155  63%  443 aa  HSLU_ECOLI RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-155  63%  443 aa  HSLU_ECOLC RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-155  63%  443 aa  HSLU_ECOHS RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-155  63%  443 aa  HSLU_ECODH RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-155  63%  443 aa  HSLU_ECOBW RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-155  63%  443 aa  HSLU_ECO57 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::450     e-155  62%  450 aa  HSLU_IDILO RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-155  63%  443 aa  HSLU_ESCF3 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-155  63%  443 aa  HSLU_CITK8 RecName: Full=ATP-dependent hsl protease ATP-binding
    3::447     e-155  66%  447 aa  HSLU_PSEU5 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-155  62%  443 aa  HSLU_PASMU RecName: Full=ATP-dependent hsl protease ATP-binding
    4::442     e-155  67%  442 aa  HSLU_ALTMD RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_SHIDS RecName: Full=ATP-dependent hsl protease ATP-binding
    1::443     e-154  62%  443 aa  HSLU_RALEH RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_ECOUT RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_ECOSM RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_ECOLU RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_ECOL6 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_ECOL5 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_ECOK1 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_ECO81 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_ECO7I RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_ECO45 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_ECO27 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_VIBVY RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_VIBVU RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_SALTY RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_SALTI RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_SALSV RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_SALPK RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_SALPC RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_SALPB RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_SALPA RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_SALNS RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_SALHS RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_SALG2 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_SALEP RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_SALDC RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_SALCH RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_SALA4 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_SALAR RecName: Full=ATP-dependent hsl protease ATP-binding
    1::443     e-154  63%  443 aa  HSLU_RALPJ RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_ENTS8 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_ECOSE RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_ECO8A RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_ECO55 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-154  63%  443 aa  HSLU_ECO24 RecName: Full=ATP-dependent hsl protease ATP-binding
    3::440     e-154  64%  440 aa  HSLU_PASHA RecName: Full=ATP-dependent hsl protease ATP-binding
    4::440     e-154  65%  440 aa  HSLU_MARMS RecName: Full=ATP-dependent hsl protease ATP-binding
    3::440     e-154  64%  440 aa  HSLU_ACTPJ RecName: Full=ATP-dependent hsl protease ATP-binding
    3::440     e-154  64%  440 aa  HSLU_ACTP7 RecName: Full=ATP-dependent hsl protease ATP-binding
    3::440     e-154  64%  440 aa  HSLU_ACTP2 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-153  63%  443 aa  HSLU_SODGM RecName: Full=ATP-dependent hsl protease ATP-binding
    3::440     e-153  63%  440 aa  HSLU_MANSM RecName: Full=ATP-dependent hsl protease ATP-binding
    4::444     e-153  65%  444 aa  HSLU_HAEIN RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-153  62%  443 aa  HSLU_NITEU RecName: Full=ATP-dependent hsl protease ATP-binding
    4::444     e-153  64%  444 aa  HSLU_KLEP3 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-153  63%  443 aa  HSLU_ENT38 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::444     e-153  63%  444 aa  HSLU_KLEP7 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::445     e-153  63%  445 aa  HSLU_ALCBS RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-153  63%  443 aa  HSLU_PHOLL RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-152  63%  443 aa  HSLU_EDWI9 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-152  61%  443 aa  HSLU_TOLAT RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-152  63%  443 aa  HSLU_YERE8 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::444     e-152  63%  444 aa  HSLU_SERP5 RecName: Full=ATP-dependent hsl protease ATP-binding
    2::441     e-152  62%  441 aa  HSLU_LEGPL RecName: Full=ATP-dependent hsl protease ATP-binding
    2::441     e-152  62%  441 aa  HSLU_LEGPH RecName: Full=ATP-dependent hsl protease ATP-binding
    2::441     e-152  62%  441 aa  HSLU_LEGPA RecName: Full=ATP-dependent hsl protease ATP-binding
    4::446     e-152  65%  446 aa  HSLU_VIBSL RecName: Full=ATP-dependent hsl protease ATP-binding
    3::440     e-152  63%  440 aa  HSLU_HAEDU RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-152  63%  443 aa  HSLU_COLP3 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::442     e-151  61%  442 aa  HSLU_PSEHT RecName: Full=ATP-dependent hsl protease ATP-binding
    4::440     e-151  62%  440 aa  HSLU_METCA RecName: Full=ATP-dependent hsl protease ATP-binding
    3::446     e-151  63%  446 aa  HSLU_AZOVD RecName: Full=ATP-dependent hsl protease ATP-binding
    3::447     e-151  62%  447 aa  HSLU_PSEA7 RecName: Full=ATP-dependent hsl protease ATP-binding
    3::447     e-151  63%  447 aa  HSLU_COXBU RecName: Full=ATP-dependent hsl protease ATP-binding
    3::447     e-151  63%  447 aa  HSLU_COXBR RecName: Full=ATP-dependent hsl protease ATP-binding
    3::446     e-151  65%  446 aa  HSLU_PSEMY RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-151  65%  443 aa  HSLU_PHOPR RecName: Full=ATP-dependent hsl protease ATP-binding
    4::446     e-151  62%  446 aa  HSLU_PROMH RecName: Full=ATP-dependent hsl protease ATP-binding
    3::447     e-150  62%  447 aa  HSLU_PSEAE RecName: Full=ATP-dependent hsl protease ATP-binding
    3::447     e-150  62%  447 aa  HSLU_PSEAB RecName: Full=ATP-dependent hsl protease ATP-binding
    3::447     e-150  62%  447 aa  HSLU_PSEA8 RecName: Full=ATP-dependent hsl protease ATP-binding
    3::447     e-150  63%  447 aa  HSLU_COXBN RecName: Full=ATP-dependent hsl protease ATP-binding
    4::441     e-150  61%  441 aa  HSLU_SHEPW RecName: Full=ATP-dependent hsl protease ATP-binding
    4::447     e-150  62%  447 aa  HSLU_BURP8 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::442     e-150  65%  442 aa  HSLU_AERHH RecName: Full=ATP-dependent hsl protease ATP-binding
    4::441     e-150  62%  441 aa  HSLU_ACTSZ RecName: Full=ATP-dependent hsl protease ATP-binding
    4::444     e-150  63%  444 aa  HSLU_THISH RecName: Full=ATP-dependent hsl protease ATP-binding
    4::441     e-150  61%  441 aa  HSLU_SHEWM RecName: Full=ATP-dependent hsl protease ATP-binding
    4::441     e-150  62%  441 aa  HSLU_SHEHH RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-149  65%  443 aa  HSLU_VIBPA RecName: Full=ATP-dependent hsl protease ATP-binding
    4::441     e-149  62%  441 aa  HSLU_SHEPA RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-149  64%  443 aa  HSLU_VIBHB RecName: Full=ATP-dependent hsl protease ATP-binding
    4::440     e-149  61%  440 aa  HSLU_ALHEH RecName: Full=ATP-dependent hsl protease ATP-binding
    4::442     e-149  62%  442 aa  HSLU_SHESR RecName: Full=ATP-dependent hsl protease ATP-binding
    4::441     e-149  63%  441 aa  HSLU_SHESH RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-149  64%  443 aa  HSLU_YERPY RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-149  64%  443 aa  HSLU_YERPS RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-149  64%  443 aa  HSLU_YERPP RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-149  64%  443 aa  HSLU_YERPN RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-149  64%  443 aa  HSLU_YERPG RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-149  64%  443 aa  HSLU_YERPE RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-149  64%  443 aa  HSLU_YERPB RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-149  64%  443 aa  HSLU_YERPA RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-149  64%  443 aa  HSLU_YERP3 RecName: Full=ATP-dependent hsl protease ATP-binding
    6::455     e-149  61%  455 aa  HSLU_XANAC RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-149  64%  443 aa  HSLU_ERWT9 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::442     e-149  64%  442 aa  HSLU_AERS4 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::442     e-149  61%  442 aa  HSLU_SHEB8 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::446     e-148  64%  446 aa  HSLU_DECAR RecName: Full=ATP-dependent hsl protease ATP-binding
    4::444     e-148  62%  444 aa  HSLU_VIBF1 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-148  64%  443 aa  HSLU_VIBC3 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::444     e-148  64%  444 aa  HSLU_PSYIN RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-148  61%  443 aa  HSLU_NITMU RecName: Full=ATP-dependent hsl protease ATP-binding
    4::442     e-148  62%  442 aa  HSLU_SHESW RecName: Full=ATP-dependent hsl protease ATP-binding
    4::444     e-148  62%  444 aa  HSLU_VIBFM RecName: Full=ATP-dependent hsl protease ATP-binding
    4::442     e-148  62%  442 aa  HSLU_SHEPC RecName: Full=ATP-dependent hsl protease ATP-binding
    4::442     e-148  61%  442 aa  HSLU_SHEB9 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::442     e-148  61%  442 aa  HSLU_SHEB5 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::442     e-148  61%  442 aa  HSLU_SHEB2 RecName: Full=ATP-dependent hsl protease ATP-binding
    6::455     e-148  60%  455 aa  HSLU_XANOR RecName: Full=ATP-dependent hsl protease ATP-binding
    6::455     e-148  60%  455 aa  HSLU_XANOM RecName: Full=ATP-dependent hsl protease ATP-binding
    6::455     e-148  60%  455 aa  HSLU_XANC5 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::438     e-148  64%  438 aa  HSLU_ACIAC RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-148  64%  443 aa  HSLU_VIBCH RecName: Full=ATP-dependent hsl protease ATP-binding
    6::455     e-148  61%  455 aa  HSLU_XANCP RecName: Full=ATP-dependent hsl protease ATP-binding
    6::455     e-148  61%  455 aa  HSLU_XANCB RecName: Full=ATP-dependent hsl protease ATP-binding
    6::455     e-148  61%  455 aa  HSLU_XANC8 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::444     e-147  64%  444 aa  HSLU_HAEIE RecName: Full=ATP-dependent hsl protease ATP-binding
    4::444     e-147  64%  444 aa  HSLU_HAEI8 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-147  64%  443 aa  HSLU_VIBCM RecName: Full=ATP-dependent hsl protease ATP-binding
    1::443     e-147  60%  443 aa  HSLU_RALEJ RecName: Full=ATP-dependent hsl protease ATP-binding
    3::445     e-147  61%  445 aa  HSLU_PSESM RecName: Full=ATP-dependent hsl protease ATP-binding
    3::447     e-147  65%  447 aa  HSLU_PSEPW RecName: Full=ATP-dependent hsl protease ATP-binding
    4::441     e-147  61%  441 aa  HSLU_SHELP RecName: Full=ATP-dependent hsl protease ATP-binding
    4::442     e-147  61%  442 aa  HSLU_SHESM RecName: Full=ATP-dependent hsl protease ATP-binding
    4::442     e-147  61%  442 aa  HSLU_SHESA RecName: Full=ATP-dependent hsl protease ATP-binding
    4::440     e-146  61%  440 aa  HSLU_SHEON RecName: Full=ATP-dependent hsl protease ATP-binding
    4::441     e-146  61%  441 aa  HSLU_SHEAM RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-146  61%  443 aa  HSLU_HAMD5 RecName: Full=ATP-dependent hsl protease ATP-binding
    1::443     e-146  59%  443 aa  HSLU_CUPTR RecName: Full=ATP-dependent hsl protease ATP-binding
   12::459     e-146  60%  459 aa  HSLU_XYLFA RecName: Full=ATP-dependent hsl protease ATP-binding
   12::459     e-146  61%  459 aa  HSLU_XYLF2 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-146  60%  443 aa  HSLU_NITEC RecName: Full=ATP-dependent hsl protease ATP-binding
   12::459     e-145  60%  459 aa  HSLU_XYLFM RecName: Full=ATP-dependent hsl protease ATP-binding
    4::447     e-145  59%  447 aa  HSLU_BURTA RecName: Full=ATP-dependent hsl protease ATP-binding
    4::448     e-145  58%  448 aa  HSLU_BURPP RecName: Full=ATP-dependent hsl protease ATP-binding
    1::443     e-145  60%  443 aa  HSLU_AZOSB RecName: Full=ATP-dependent hsl protease ATP-binding
    1::448     e-145  61%  448 aa  HSLU_CHRVO RecName: Full=ATP-dependent hsl protease ATP-binding
    4::441     e-144  62%  441 aa  HSLU_VEREI RecName: Full=ATP-dependent hsl protease ATP-binding
    4::448     e-144  58%  448 aa  HSLU_BURXL RecName: Full=ATP-dependent hsl protease ATP-binding
    4::444     e-144  61%  444 aa  HSLU_ALISL RecName: Full=ATP-dependent hsl protease ATP-binding
    4::441     e-144  61%  441 aa  HSLU_SHEDO RecName: Full=ATP-dependent hsl protease ATP-binding
    4::447     e-144  59%  447 aa  HSLU_BURVG RecName: Full=ATP-dependent hsl protease ATP-binding
    6::444     e-144  59%  444 aa  HSLU_BORA1 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::444     e-144  61%  444 aa  HSLU_BUCBP RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-143  61%  443 aa  HSLU_BUCAP RecName: Full=ATP-dependent hsl protease ATP-binding
    4::441     e-143  60%  441 aa  HSLU_SHEFN RecName: Full=ATP-dependent hsl protease ATP-binding
    4::446     e-142  60%  446 aa  HSLU_ACISJ RecName: Full=ATP-dependent hsl protease ATP-binding
    4::446     e-142  60%  446 aa  HSLU_DIAST RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-142  62%  443 aa  HSLU_BUCAT RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-142  62%  443 aa  HSLU_BUCAI RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-142  62%  443 aa  HSLU_BUCA5 RecName: Full=ATP-dependent hsl protease ATP-binding
    1::441     e-141  64%  441 aa  HSLU_CHRSD RecName: Full=ATP-dependent hsl protease ATP-binding
    4::446     e-141  61%  446 aa  HSLU_BAUCH RecName: Full=ATP-dependent hsl protease ATP-binding
    4::447     e-141  57%  447 aa  HSLU_BURS3 RecName: Full=ATP-dependent hsl protease ATP-binding
    1::442     e-141  59%  442 aa  HSLU_AZOSE RecName: Full=ATP-dependent hsl protease ATP-binding
    3::445     e-141  59%  445 aa  HSLU_PSE14 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::447     e-141  58%  447 aa  HSLU_BURPS RecName: Full=ATP-dependent hsl protease ATP-binding
    4::447     e-141  58%  447 aa  HSLU_BURP6 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::447     e-141  58%  447 aa  HSLU_BURP1 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::447     e-141  58%  447 aa  HSLU_BURP0 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::447     e-141  58%  447 aa  HSLU_BURMS RecName: Full=ATP-dependent hsl protease ATP-binding
    4::447     e-141  58%  447 aa  HSLU_BURMA RecName: Full=ATP-dependent hsl protease ATP-binding
    4::447     e-141  58%  447 aa  HSLU_BURM9 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::447     e-141  58%  447 aa  HSLU_BURM7 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::447     e-141  57%  447 aa  HSLU_BURCH RecName: Full=ATP-dependent hsl protease ATP-binding
    4::447     e-141  57%  447 aa  HSLU_BURCC RecName: Full=ATP-dependent hsl protease ATP-binding
    4::447     e-141  57%  447 aa  HSLU_BURCA RecName: Full=ATP-dependent hsl protease ATP-binding
    6::444     e-141  60%  444 aa  HSLU_BORPD RecName: Full=ATP-dependent hsl protease ATP-binding
    6::444     e-141  60%  444 aa  HSLU_BORBR RecName: Full=ATP-dependent hsl protease ATP-binding
    6::444     e-141  60%  444 aa  HSLU_BORPE RecName: Full=ATP-dependent hsl protease ATP-binding
    6::444     e-141  60%  444 aa  HSLU_BORPA RecName: Full=ATP-dependent hsl protease ATP-binding
    4::447     e-141  57%  447 aa  HSLU_BURCJ RecName: Full=ATP-dependent hsl protease ATP-binding
    1::443     e-140  58%  443 aa  HSLU_RALSO RecName: Full=ATP-dependent hsl protease ATP-binding
    4::443     e-140  59%  443 aa  HSLU_WIGBR RecName: Full=ATP-dependent hsl protease ATP-binding
    3::445     e-139  63%  445 aa  HSLU_PSEPF RecName: Full=ATP-dependent hsl protease ATP-binding
    3::447     e-139  62%  447 aa  HSLU_PSEPG RecName: Full=ATP-dependent hsl protease ATP-binding
    4::447     e-139  57%  447 aa  HSLU_BURCM RecName: Full=ATP-dependent hsl protease ATP-binding
    4::447     e-139  57%  447 aa  HSLU_BURA4 RecName: Full=ATP-dependent hsl protease ATP-binding
    3::447     e-138  62%  447 aa  HSLU_PSEPK RecName: Full=ATP-dependent hsl protease ATP-binding
    3::447     e-138  62%  447 aa  HSLU_PSEP1 RecName: Full=ATP-dependent hsl protease ATP-binding
    3::445     e-137  58%  445 aa  HSLU_PSEU2 RecName: Full=ATP-dependent hsl protease ATP-binding
    3::447     e-137  61%  447 aa  HSLU_PSEE4 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::444     e-137  64%  444 aa  HSLU_BUCCC RecName: Full=ATP-dependent hsl protease ATP-binding
    4::440     e-137  58%  440 aa  HSLU_ACIF5 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::440     e-137  58%  440 aa  HSLU_ACIF2 RecName: Full=ATP-dependent hsl protease ATP-binding
    3::445     e-134  62%  445 aa  HSLU_PSEFS RecName: Full=ATP-dependent hsl protease ATP-binding
    3::446     e-132  60%  446 aa  HSLU_PSEF5 RecName: Full=ATP-dependent hsl protease ATP-binding
    1::465     e-132  57%  465 aa  HSLU_GEOSW RecName: Full=ATP-dependent hsl protease ATP-binding
    4::453     e-132  54%  453 aa  HSLU_DESAH RecName: Full=ATP-dependent hsl protease ATP-binding
    4::433     e-131  57%  433 aa  HSLU_RHOS5 RecName: Full=ATP-dependent hsl protease ATP-binding
    1::464     e-131  56%  464 aa  HSLU_GEOTN RecName: Full=ATP-dependent hsl protease ATP-binding
   12::451     e-131  58%  451 aa  HSLU_DICNV RecName: Full=ATP-dependent hsl protease ATP-binding
    4::435     e-131  59%  435 aa  HSLU_ROSDO RecName: Full=ATP-dependent hsl protease ATP-binding
    4::433     e-131  57%  433 aa  HSLU_RHOS1 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::433     e-131  57%  433 aa  HSLU_RHOSK RecName: Full=ATP-dependent hsl protease ATP-binding
    4::433     e-131  57%  433 aa  HSLU_RHOS4 RecName: Full=ATP-dependent hsl protease ATP-binding
    5::461     e-131  57%  461 aa  HSLU_MAGSM RecName: Full=ATP-dependent hsl protease ATP-binding
    2::465     e-131  56%  465 aa  HSLU_GEOKA RecName: Full=ATP-dependent hsl protease ATP-binding
    7::466     e-131  54%  466 aa  HSLU_BACP2 RecName: Full=ATP-dependent hsl protease ATP-binding
    5::435     e-130  60%  435 aa  HSLU_RHIME RecName: Full=ATP-dependent hsl protease ATP-binding
    5::435     e-130  58%  435 aa  HSLU_RHORT RecName: Full=ATP-dependent hsl protease ATP-binding
    5::436     e-130  59%  436 aa  HSLU_RHILO RecName: Full=ATP-dependent hsl protease ATP-binding
    5::435     e-130  57%  435 aa  HSLU_BEII9 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::445     e-130  55%  445 aa  HSLU_THEYD RecName: Full=ATP-dependent hsl protease ATP-binding
    4::434     e-130  59%  434 aa  HSLU_HYPNA RecName: Full=ATP-dependent hsl protease ATP-binding
    5::435     e-129  58%  435 aa  HSLU_SINMW RecName: Full=ATP-dependent hsl protease ATP-binding
    4::435     e-129  58%  435 aa  HSLU_SILPO RecName: Full=ATP-dependent hsl protease ATP-binding
    5::459     e-129  53%  459 aa  HSLU_MYXXD RecName: Full=ATP-dependent hsl protease ATP-binding
    5::436     e-129  60%  436 aa  HSLU_MESSB RecName: Full=ATP-dependent hsl protease ATP-binding
    7::448     e-129  56%  448 aa  HSLU_SULSY RecName: Full=ATP-dependent hsl protease ATP-binding
    4::436     e-129  58%  436 aa  HSLU_SILST RecName: Full=ATP-dependent hsl protease ATP-binding
    5::434     e-129  61%  434 aa  HSLU_RHISN RecName: Full=ATP-dependent hsl protease ATP-binding
    6::463     e-129  54%  463 aa  HSLU_BACWK RecName: Full=ATP-dependent hsl protease ATP-binding
    6::463     e-129  53%  463 aa  HSLU_BACC2 RecName: Full=ATP-dependent hsl protease ATP-binding
    8::464     e-129  52%  464 aa  HSLU_CYTH3 RecName: Full=ATP-dependent hsl protease ATP-binding
    6::463     e-129  53%  463 aa  HSLU_BACCQ RecName: Full=ATP-dependent hsl protease ATP-binding
    6::463     e-129  53%  463 aa  HSLU_BACC7 RecName: Full=ATP-dependent hsl protease ATP-binding
    5::437     e-128  58%  437 aa  HSLU_METSB RecName: Full=ATP-dependent hsl protease ATP-binding
    6::467     e-128  52%  467 aa  HSLU_BACSU RecName: Full=ATP-dependent hsl protease ATP-binding
    6::463     e-128  53%  463 aa  HSLU_BACC3 RecName: Full=ATP-dependent hsl protease ATP-binding
    6::463     e-128  53%  463 aa  HSLU_BACHK RecName: Full=ATP-dependent hsl protease ATP-binding
    6::463     e-128  53%  463 aa  HSLU_BACCZ RecName: Full=ATP-dependent hsl protease ATP-binding
    6::463     e-128  53%  463 aa  HSLU_BACCR RecName: Full=ATP-dependent hsl protease ATP-binding
    6::463     e-128  53%  463 aa  HSLU_BACC0 RecName: Full=ATP-dependent hsl protease ATP-binding
    6::463     e-128  53%  463 aa  HSLU_BACAN RecName: Full=ATP-dependent hsl protease ATP-binding
    6::463     e-128  53%  463 aa  HSLU_BACAC RecName: Full=ATP-dependent hsl protease ATP-binding
    6::463     e-128  53%  463 aa  HSLU_BACAA RecName: Full=ATP-dependent hsl protease ATP-binding
    5::435     e-128  61%  435 aa  HSLU_AGRVS RecName: Full=ATP-dependent hsl protease ATP-binding
    6::463     e-128  53%  463 aa  HSLU_BACC4 RecName: Full=ATP-dependent hsl protease ATP-binding
    5::445     e-128  54%  445 aa  HSLU_PELCD RecName: Full=ATP-dependent hsl protease ATP-binding
    4::437     e-128  57%  437 aa  HSLU_DINSH RecName: Full=ATP-dependent hsl protease ATP-binding
    6::467     e-128  53%  467 aa  HSLU_BACLD RecName: Full=ATP-dependent hsl protease ATP-binding
    5::435     e-127  58%  435 aa  HSLU_RHIE6 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::458     e-127  54%  458 aa  HSLU_DESHD RecName: Full=ATP-dependent hsl protease ATP-binding
    5::437     e-126  57%  437 aa  HSLU_RHOCS RecName: Full=ATP-dependent hsl protease ATP-binding
   10::469     e-126  51%  469 aa  HSLU_LISMO RecName: Full=ATP-dependent hsl protease ATP-binding
    5::433     e-126  57%  433 aa  HSLU_RHOPT RecName: Full=ATP-dependent hsl protease ATP-binding
    5::433     e-126  57%  433 aa  HSLU_RHOPA RecName: Full=ATP-dependent hsl protease ATP-binding
   10::469     e-126  51%  469 aa  HSLU_LISMH RecName: Full=ATP-dependent hsl protease ATP-binding
   10::469     e-126  51%  469 aa  HSLU_LISIN RecName: Full=ATP-dependent hsl protease ATP-binding
    4::438     e-126  57%  438 aa  HSLU_JANSC RecName: Full=ATP-dependent hsl protease ATP-binding
    4::457     e-126  51%  457 aa  HSLU_DESAA RecName: Full=ATP-dependent hsl protease ATP-binding
    5::433     e-126  57%  433 aa  HSLU_RHOP5 RecName: Full=ATP-dependent hsl protease ATP-binding
    5::433     e-126  56%  433 aa  HSLU_RHOP2 RecName: Full=ATP-dependent hsl protease ATP-binding
    7::457     e-126  55%  457 aa  HSLU_DESPS RecName: Full=ATP-dependent hsl protease ATP-binding
    6::463     e-126  56%  463 aa  HSLU_BACCN RecName: Full=ATP-dependent hsl protease ATP-binding
    7::467     e-126  51%  467 aa  HSLU_ENTFA RecName: Full=ATP-dependent hsl protease ATP-binding
    5::435     e-126  56%  435 aa  HSLU_PARL1 RecName: Full=ATP-dependent hsl protease ATP-binding
   10::469     e-126  51%  469 aa  HSLU_LISMF RecName: Full=ATP-dependent hsl protease ATP-binding
   10::469     e-126  51%  469 aa  HSLU_LISMC RecName: Full=ATP-dependent hsl protease ATP-binding
    5::434     e-125  56%  434 aa  HSLU_BRAJA RecName: Full=ATP-dependent hsl protease ATP-binding
    2::466     e-125  55%  466 aa  HSLU_DESRM RecName: Full=ATP-dependent hsl protease ATP-binding
    6::465     e-125  51%  465 aa  HSLU_OCEIH RecName: Full=ATP-dependent hsl protease ATP-binding
    5::433     e-124  56%  433 aa  HSLU_RHOPS RecName: Full=ATP-dependent hsl protease ATP-binding
   10::469     e-124  50%  469 aa  HSLU_LISW6 RecName: Full=ATP-dependent hsl protease ATP-binding
    5::437     e-124  59%  437 aa  HSLU_METPB RecName: Full=ATP-dependent hsl protease ATP-binding
    5::435     e-124  57%  435 aa  HSLU_AGRT5 RecName: Full=ATP-dependent hsl protease ATP-binding
    5::435     e-124  57%  435 aa  HSLU_RHIEC RecName: Full=ATP-dependent hsl protease ATP-binding
    1::433     e-124  56%  433 aa  HSLU_NITWN RecName: Full=ATP-dependent hsl protease ATP-binding
    4::465     e-124  54%  465 aa  HSLU_PELTS RecName: Full=ATP-dependent hsl protease ATP-binding
    4::456     e-123  54%  456 aa  HSLU_DESOH RecName: Full=ATP-dependent hsl protease ATP-binding
    5::437     e-123  56%  437 aa  HSLU_METS4 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::457     e-123  53%  457 aa  HSLU_DESAD RecName: Full=ATP-dependent hsl protease ATP-binding
    5::435     e-123  56%  435 aa  HSLU_AZOC5 RecName: Full=ATP-dependent hsl protease ATP-binding
    5::435     e-123  57%  435 aa  HSLU_RHILW RecName: Full=ATP-dependent hsl protease ATP-binding
    5::434     e-123  58%  434 aa  HSLU_OCHA4 RecName: Full=ATP-dependent hsl protease ATP-binding
    5::434     e-123  59%  434 aa  HSLU_BRUSU RecName: Full=ATP-dependent hsl protease ATP-binding
    5::434     e-123  59%  434 aa  HSLU_BRUSI RecName: Full=ATP-dependent hsl protease ATP-binding
    5::434     e-123  58%  434 aa  HSLU_BRUME RecName: Full=ATP-dependent hsl protease ATP-binding
    5::434     e-123  58%  434 aa  HSLU_BRUMB RecName: Full=ATP-dependent hsl protease ATP-binding
    5::434     e-123  58%  434 aa  HSLU_BRUAB RecName: Full=ATP-dependent hsl protease ATP-binding
    5::434     e-123  58%  434 aa  HSLU_BRUA2 RecName: Full=ATP-dependent hsl protease ATP-binding
    5::434     e-123  58%  434 aa  HSLU_BRUA1 RecName: Full=ATP-dependent hsl protease ATP-binding
    5::435     e-123  57%  435 aa  HSLU_RHIL3 RecName: Full=ATP-dependent hsl protease ATP-binding
    5::433     e-122  56%  433 aa  HSLU_NITHX RecName: Full=ATP-dependent hsl protease ATP-binding
    7::448     e-122  53%  448 aa  HSLU_PERMH RecName: Full=ATP-dependent hsl protease ATP-binding
    5::437     e-122  58%  437 aa  HSLU_METEP RecName: Full=ATP-dependent hsl protease ATP-binding
    5::437     e-122  58%  437 aa  HSLU_METC4 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::461     e-122  53%  461 aa  HSLU_CARHZ RecName: Full=ATP-dependent hsl protease ATP-binding
    6::467     e-122  51%  467 aa  HSLU_BACA2 RecName: Full=ATP-dependent hsl protease ATP-binding
    5::434     e-122  58%  434 aa  HSLU_BRUO2 RecName: Full=ATP-dependent hsl protease ATP-binding
    5::436     e-122  56%  436 aa  HSLU_AGRRK RecName: Full=ATP-dependent hsl protease ATP-binding
    5::435     e-122  55%  435 aa  HSLU_XANP2 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::465     e-121  54%  465 aa  HSLU_CALS8 RecName: Full=ATP-dependent hsl protease ATP-binding
    5::435     e-121  56%  435 aa  HSLU_MARMM RecName: Full=ATP-dependent hsl protease ATP-binding
    5::434     e-121  56%  434 aa  HSLU_BRASO RecName: Full=ATP-dependent hsl protease ATP-binding
    5::434     e-121  56%  434 aa  HSLU_BRASB RecName: Full=ATP-dependent hsl protease ATP-binding
    5::459     e-121  55%  459 aa  HSLU_THEP3 RecName: Full=ATP-dependent hsl protease ATP-binding
    5::434     e-121  55%  434 aa  HSLU_RHOPB RecName: Full=ATP-dependent hsl protease ATP-binding
    5::459     e-121  54%  459 aa  HSLU_THEPX RecName: Full=ATP-dependent hsl protease ATP-binding
    1::436     e-121  55%  436 aa  HSLU_BARBK RecName: Full=ATP-dependent hsl protease ATP-binding
    7::467     e-121  51%  467 aa  HSLU_LACS1 RecName: Full=ATP-dependent hsl protease ATP-binding
   15::450     e-120  55%  450 aa  HSLU_RICCN RecName: Full=ATP-dependent hsl protease ATP-binding
    1::436     e-119  58%  436 aa  HSLU_BARHE RecName: Full=ATP-dependent hsl protease ATP-binding
   15::450     e-119  55%  450 aa  HSLU_RICAE RecName: Full=ATP-dependent hsl protease ATP-binding
   15::450     e-119  55%  450 aa  HSLU_RICPU RecName: Full=ATP-dependent hsl protease ATP-binding
    5::437     e-119  55%  437 aa  HSLU_METNO RecName: Full=ATP-dependent hsl protease ATP-binding
   15::450     e-119  55%  450 aa  HSLU_RICM5 RecName: Full=ATP-dependent hsl protease ATP-binding
    1::464     e-119  49%  464 aa  HSLU_LACGA RecName: Full=ATP-dependent hsl protease ATP-binding
   15::450     e-118  55%  450 aa  HSLU_RICFE RecName: Full=ATP-dependent hsl protease ATP-binding
    4::437     e-118  53%  437 aa  HSLU_DESDA RecName: Full=ATP-dependent hsl protease ATP-binding
   15::450     e-118  55%  450 aa  HSLU_RICRS RecName: Full=ATP-dependent hsl protease ATP-binding
   15::450     e-118  55%  450 aa  HSLU_RICRO RecName: Full=ATP-dependent hsl protease ATP-binding
    1::464     e-118  49%  464 aa  HSLU_LACJO RecName: Full=ATP-dependent hsl protease ATP-binding
    4::435     e-118  54%  435 aa  HSLU_PARDP RecName: Full=ATP-dependent hsl protease ATP-binding
   15::450     e-118  55%  450 aa  HSLU_RICCK RecName: Full=ATP-dependent hsl protease ATP-binding
   15::450     e-118  55%  450 aa  HSLU_RICAH RecName: Full=ATP-dependent hsl protease ATP-binding
   18::479     e-118  54%  479 aa  HSLU_LEPIC RecName: Full=ATP-dependent hsl protease ATP-binding
   14::450     e-118  54%  450 aa  HSLU_AQUAE RecName: Full=ATP-dependent hsl protease ATP-binding
    8::461     e-118  50%  461 aa  HSLU_THETN RecName: Full=ATP-dependent hsl protease ATP-binding
   18::479     e-118  54%  479 aa  HSLU_LEPIN RecName: Full=ATP-dependent hsl protease ATP-binding
   17::452     e-117  57%  452 aa  HSLU_RICBR RecName: Full=ATP-dependent hsl protease ATP-binding
    5::437     e-117  55%  437 aa  HSLU_METRJ RecName: Full=ATP-dependent hsl protease ATP-binding
   15::450     e-116  55%  450 aa  HSLU_RICTY RecName: Full=ATP-dependent hsl protease ATP-binding
    4::433     e-116  54%  433 aa  HSLU_LAWIP RecName: Full=ATP-dependent hsl protease ATP-binding
    5::456     e-116  52%  456 aa  HSLU_EXIS2 RecName: Full=ATP-dependent hsl protease ATP-binding
    4::441     e-115  53%  441 aa  HSLU_DESVV RecName: Full=ATP-dependent hsl protease ATP-binding
    4::466     e-115  49%  466 aa  HSLU_SYNWW RecName: Full=ATP-dependent hsl protease ATP-binding
    4::441     e-115  53%  441 aa  HSLU_DESVH RecName: Full=ATP-dependent hsl protease ATP-binding
   15::450     e-115  54%  450 aa  HSLU_RICPR RecName: Full=ATP-dependent hsl protease ATP-binding
    3::449     e-115  50%  449 aa  HSLU_DESDG RecName: Full=ATP-dependent hsl protease ATP-binding
    1::464     e-114  49%  464 aa  HSLU_BACHD RecName: Full=ATP-dependent hsl protease ATP-binding
    8::467     e-114  48%  467 aa  HSLU_STAAW RecName: Full=ATP-dependent hsl protease ATP-binding
    8::467     e-114  48%  467 aa  HSLU_STAAT RecName: Full=ATP-dependent hsl protease ATP-binding
    8::467     e-114  48%  467 aa  HSLU_STAAS RecName: Full=ATP-dependent hsl protease ATP-binding
    8::467     e-114  48%  467 aa  HSLU_STAAE RecName: Full=ATP-dependent hsl protease ATP-binding
    8::467     e-114  48%  467 aa  HSLU_STAAC RecName: Full=ATP-dependent hsl protease ATP-binding
    8::467     e-114  48%  467 aa  HSLU_STAA9 RecName: Full=ATP-dependent hsl protease ATP-binding
    8::467     e-114  48%  467 aa  HSLU_STAA8 RecName: Full=ATP-dependent hsl protease ATP-binding
    8::467     e-114  48%  467 aa  HSLU_STAA3 RecName: Full=ATP-dependent hsl protease ATP-binding
    8::467     e-114  48%  467 aa  HSLU_STAA2 RecName: Full=ATP-dependent hsl protease ATP-binding
    5::464     e-114  50%  464 aa  HSLU_LACDA RecName: Full=ATP-dependent hsl protease ATP-binding
    8::467     e-114  48%  467 aa  HSLU_STAAR RecName: Full=ATP-dependent hsl protease ATP-binding
    8::467     e-114  47%  467 aa  HSLU_STAAB RecName: Full=ATP-dependent hsl protease ATP-binding
    1::436     e-114  54%  436 aa  HSLU_BART1 RecName: Full=ATP-dependent hsl protease ATP-binding
    8::467     e-114  47%  467 aa  HSLU_STAAN RecName: Full=ATP-dependent hsl protease ATP-binding
    8::467     e-114  47%  467 aa  HSLU_STAAM RecName: Full=ATP-dependent hsl protease ATP-binding
    8::467     e-114  47%  467 aa  HSLU_STAA1 RecName: Full=ATP-dependent hsl protease ATP-binding
    5::464     e-114  50%  464 aa  HSLU_LACLE RecName: Full=ATP-dependent hsl protease ATP-binding
    8::467     e-114  47%  467 aa  HSLU_STAHJ RecName: Full=ATP-dependent hsl protease ATP-binding
   20::491     e-114  52%  491 aa  HSLU_CHLTE RecName: Full=ATP-dependent hsl protease ATP-binding
    8::485     e-114  50%  485 aa  HSLU_TREDE RecName: Full=ATP-dependent hsl protease ATP-binding
    1::436     e-113  56%  436 aa  HSLU_BARQU RecName: Full=ATP-dependent hsl protease ATP-binding
    8::470     e-113  49%  470 aa  HSLU_STAS1 RecName: Full=ATP-dependent hsl protease ATP-binding
    8::468     e-112  53%  468 aa  HSLU_STACT RecName: Full=ATP-dependent hsl protease ATP-binding
    8::467     e-112  48%  467 aa  HSLU_STAES RecName: Full=ATP-dependent hsl protease ATP-binding
    8::467     e-112  48%  467 aa  HSLU_STAEQ RecName: Full=ATP-dependent hsl protease ATP-binding
    7::462     e-111  48%  462 aa  HSLU_THELT RecName: Full=ATP-dependent hsl protease ATP-binding
    7::463     e-110  52%  463 aa  HSLU_THESQ RecName: Full=ATP-dependent hsl protease ATP-binding
    7::463     e-110  52%  463 aa  HSLU_THEP1 RecName: Full=ATP-dependent hsl protease ATP-binding
    7::463     e-110  53%  463 aa  HSLU_THENN RecName: Full=ATP-dependent hsl protease ATP-binding
    5::464     e-110  49%  464 aa  HSLU_LACDB RecName: Full=ATP-dependent hsl protease ATP-binding
    7::463     e-110  52%  463 aa  HSLU_THEMA RecName: Full=ATP-dependent hsl protease ATP-binding
    7::472     e-109  48%  472 aa  HSLU_LACPL RecName: Full=ATP-dependent hsl protease ATP-binding
    6::443     e-107  47%  443 aa  HSLU_HELPY RecName: Full=ATP-dependent hsl protease ATP-binding
    6::443     e-107  47%  443 aa  HSLU_HELPJ RecName: Full=ATP-dependent hsl protease ATP-binding
    3::467     e-107  48%  467 aa  HSLU_LACH4 RecName: Full=ATP-dependent hsl protease ATP-binding
    6::443     e-107  47%  443 aa  HSLU_HELPG RecName: Full=ATP-dependent hsl protease ATP-binding
    6::443     e-107  47%  443 aa  HSLU_HELP2 RecName: Full=ATP-dependent hsl protease ATP-binding
    7::459     e-106  48%  459 aa  HSLU_THEAB RecName: Full=ATP-dependent hsl protease ATP-binding
    6::443     e-106  47%  443 aa  HSLU_HELAH RecName: Full=ATP-dependent hsl protease ATP-binding
    6::443     e-106  47%  443 aa  HSLU_HELPH RecName: Full=ATP-dependent hsl protease ATP-binding
    6::443     e-106  47%  443 aa  HSLU_HELPS RecName: Full=ATP-dependent hsl protease ATP-binding
    3::439     e-106  50%  439 aa  HSLU_CAMJD RecName: Full=ATP-dependent hsl protease ATP-binding
    3::466     e-106  47%  466 aa  HSLU_LACAC RecName: Full=ATP-dependent hsl protease ATP-binding
    3::439     e-106  50%  439 aa  HSLU_CAMJE RecName: Full=ATP-dependent hsl protease ATP-binding
    3::439     e-105  50%  439 aa  HSLU_CAMJ8 RecName: Full=ATP-dependent hsl protease ATP-binding
    3::439     e-105  50%  439 aa  HSLU_CAMJJ RecName: Full=ATP-dependent hsl protease ATP-binding
    3::439     e-105  50%  439 aa  HSLU_CAMJR RecName: Full=ATP-dependent hsl protease ATP-binding
    5::430     e-105  54%  430 aa  HSLU_CAUCR RecName: Full=ATP-dependent hsl protease ATP-binding
    5::430     e-105  54%  430 aa  HSLU_CAUCN RecName: Full=ATP-dependent hsl protease ATP-binding
    5::434     e-105  53%  434 aa  HSLU_PHEZH RecName: Full=ATP-dependent hsl protease ATP-binding
    5::448     e-104  45%  448 aa  HSLU_NATTJ RecName: Full=ATP-dependent hsl protease ATP-binding
    5::431     e-100  50%  431 aa  HSLU_CAUSK RecName: Full=ATP-dependent hsl protease ATP-binding
    9::448     e-100  50%  448 aa  HSLU_BORBU RecName: Full=ATP-dependent hsl protease ATP-binding
    4::110     3e-79  56%  483 aa  HSLU_DESVM RecName: Full=ATP-dependent hsl protease ATP-binding
    1::138     1e-69  60%  463 aa  HSLU_BACSK RecName: Full=ATP-dependent hsl protease ATP-binding
    7::110     4e-69  57%  469 aa  HSLU_PETMO RecName: Full=ATP-dependent hsl protease ATP-binding
   77::436     3e-32  35%  451 aa  CLPX_PROMT RecName: Full=ATP-dependent Clp protease ATP-binding
   77::436     3e-32  35%  451 aa  CLPX_PROM1 RecName: Full=ATP-dependent Clp protease ATP-binding
   76::435     3e-31  34%  450 aa  CLPX_PROMA RecName: Full=ATP-dependent Clp protease ATP-binding
  166::417     1e-29  45%  417 aa  CLPX_CAMJE RecName: Full=ATP-dependent Clp protease ATP-binding
   78::438     7e-29  34%  450 aa  CLPX_SYNS9 RecName: Full=ATP-dependent Clp protease ATP-binding
  189::445     4e-28  45%  446 aa  CLPX_HELPY RecName: Full=ATP-dependent Clp protease ATP-binding
  151::391     2e-26  43%  403 aa  CLPX_DEIRA RecName: Full=ATP-dependent Clp protease ATP-binding
   96::409     2e-26  37%  431 aa  CLPX_CLONN RecName: Full=ATP-dependent Clp protease ATP-binding
   95::388     2e-26  42%  421 aa  CLPX_METFK RecName: Full=ATP-dependent Clp protease ATP-binding
  105::386     3e-26  39%  416 aa  CLPX_LEUMM RecName: Full=ATP-dependent Clp protease ATP-binding
  159::403     4e-26  45%  414 aa  CLPX_BACTN RecName: Full=ATP-dependent Clp protease ATP-binding
   94::410     5e-26  38%  430 aa  CLPX_KINRD RecName: Full=ATP-dependent Clp protease ATP-binding
  109::403     7e-26  40%  423 aa  CLPX_TROWT RecName: Full=ATP-dependent Clp protease ATP-binding
  109::403     7e-26  40%  423 aa  CLPX_TROW8 RecName: Full=ATP-dependent Clp protease ATP-binding
   59::167     1e-25  45%  408 aa  CLPX_LACS1 RecName: Full=ATP-dependent Clp protease ATP-binding
   53::388     2e-25  37%  426 aa  CLPX_MYCVP RecName: Full=ATP-dependent Clp protease ATP-binding
   53::388     2e-25  37%  426 aa  CLPX_MYCGI RecName: Full=ATP-dependent Clp protease ATP-binding
   64::169     2e-25  44%  423 aa  CLPX_ERYLH RecName: Full=ATP-dependent Clp protease ATP-binding
   95::402     2e-25  40%  424 aa  CLPX_SYMTH RecName: Full=ATP-dependent Clp protease ATP-binding
   64::169     2e-25  46%  418 aa  CLPX_NOVAD RecName: Full=ATP-dependent Clp protease ATP-binding
  154::394     2e-25  42%  406 aa  CLPX_DEIGD RecName: Full=ATP-dependent Clp protease ATP-binding
  104::388     3e-25  40%  420 aa  CLPX_LEPBL RecName: Full=ATP-dependent Clp protease ATP-binding
  104::388     3e-25  40%  420 aa  CLPX_LEPBJ RecName: Full=ATP-dependent Clp protease ATP-binding
   65::170     3e-25  45%  424 aa  CLPX_BARBK RecName: Full=ATP-dependent Clp protease ATP-binding
   53::388     3e-25  37%  426 aa  CLPX_MYCTU RecName: Full=ATP-dependent Clp protease ATP-binding
   53::388     3e-25  37%  426 aa  CLPX_MYCTA RecName: Full=ATP-dependent Clp protease ATP-binding
   53::388     3e-25  36%  426 aa  CLPX_MYCS2 RecName: Full=ATP-dependent Clp protease ATP-binding
   53::388     3e-25  37%  426 aa  CLPX_MYCBT RecName: Full=ATP-dependent Clp protease ATP-binding
   53::388     3e-25  37%  426 aa  CLPX_MYCBP RecName: Full=ATP-dependent Clp protease ATP-binding
   53::388     3e-25  37%  426 aa  CLPX_MYCBO RecName: Full=ATP-dependent Clp protease ATP-binding
   94::388     3e-25  37%  426 aa  CLPX_MYCA9 RecName: Full=ATP-dependent Clp protease ATP-binding
   91::395     3e-25  37%  432 aa  CLPX_MICLC RecName: Full=ATP-dependent Clp protease ATP-binding
  149::378     3e-25  45%  399 aa  CLPX_HYDS0 RecName: Full=ATP-dependent Clp protease ATP-binding
  160::404     3e-25  44%  415 aa  CLPX_BACFR RecName: Full=ATP-dependent Clp protease ATP-binding
  160::404     3e-25  44%  415 aa  CLPX_BACFN RecName: Full=ATP-dependent Clp protease ATP-binding
   93::419     5e-25  36%  426 aa  CLPX_HELHP RecName: Full=ATP-dependent Clp protease ATP-binding
  157::407     5e-25  44%  412 aa  CLPX_AQUAE RecName: Full=ATP-dependent Clp protease ATP-binding
   95::389     6e-25  37%  422 aa  CLPX_CORK4 RecName: Full=ATP-dependent Clp protease ATP-binding
   81::388     8e-25  37%  423 aa  CLPX_SPHAL RecName: Full=ATP-dependent Clp protease ATP-binding
   94::388     8e-25  37%  426 aa  CLPX_NOCFA RecName: Full=ATP-dependent Clp protease ATP-binding
   94::388     8e-25  37%  426 aa  CLPX_MYCPA RecName: Full=ATP-dependent Clp protease ATP-binding
   94::388     8e-25  37%  426 aa  CLPX_MYCA1 RecName: Full=ATP-dependent Clp protease ATP-binding
  194::423     8e-25  46%  472 aa  CLPX_BIFLO RecName: Full=ATP-dependent Clp protease ATP-binding
  160::405     8e-25  44%  424 aa  CLPX_BART1 RecName: Full=ATP-dependent Clp protease ATP-binding
   94::388     1e-24  37%  426 aa  CLPX_MYCLE RecName: Full=ATP-dependent Clp protease ATP-binding
   94::388     1e-24  37%  426 aa  CLPX_MYCLB RecName: Full=ATP-dependent Clp protease ATP-binding
   94::388     1e-24  37%  426 aa  CLPX_MYCUA RecName: Full=ATP-dependent Clp protease ATP-binding
  160::389     1e-24  46%  423 aa  CLPX_MARMM RecName: Full=ATP-dependent Clp protease ATP-binding
  104::388     1e-24  38%  420 aa  CLPX_LEPIN RecName: Full=ATP-dependent Clp protease ATP-binding
  104::388     1e-24  38%  420 aa  CLPX_LEPIC RecName: Full=ATP-dependent Clp protease ATP-binding
   99::385     1e-24  38%  416 aa  CLPX_LACRD RecName: Full=ATP-dependent Clp protease ATP-binding
  102::404     1e-24  38%  418 aa  CLPX_LACBA RecName: Full=ATP-dependent Clp protease ATP-binding
  110::389     1e-24  39%  430 aa  CLPX_FRASN RecName: Full=ATP-dependent Clp protease ATP-binding
   94::388     1e-24  37%  428 aa  CLPX_FRASC RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     1e-24  45%  426 aa  CLPX_CHRSD RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     1e-24  44%  429 aa  CLPX_BORRA RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     1e-24  44%  429 aa  CLPX_BORDL RecName: Full=ATP-dependent Clp protease ATP-binding
   94::407     1e-24  37%  424 aa  CLPX_BEUC1 RecName: Full=ATP-dependent Clp protease ATP-binding
   99::399     1e-24  39%  436 aa  CLPX_ACIAD RecName: Full=ATP-dependent Clp protease ATP-binding
   94::399     2e-24  38%  409 aa  CLPX_STRU0 RecName: Full=ATP-dependent Clp protease ATP-binding
  100::399     2e-24  36%  409 aa  CLPX_STRGC RecName: Full=ATP-dependent Clp protease ATP-binding
  160::389     2e-24  46%  424 aa  CLPX_OCHA4 RecName: Full=ATP-dependent Clp protease ATP-binding
   94::388     2e-24  37%  426 aa  CLPX_MYCMM RecName: Full=ATP-dependent Clp protease ATP-binding
  124::432     2e-24  40%  439 aa  CLPX_CHLP8 RecName: Full=ATP-dependent Clp protease ATP-binding
   94::407     2e-24  37%  426 aa  CLPX_RHOSR RecName: Full=ATP-dependent Clp protease ATP-binding
   94::407     2e-24  37%  426 aa  CLPX_RHOOB RecName: Full=ATP-dependent Clp protease ATP-binding
  160::405     2e-24  44%  424 aa  CLPX_BARQU RecName: Full=ATP-dependent Clp protease ATP-binding
   94::400     2e-24  38%  427 aa  CLPX_ACIC1 RecName: Full=ATP-dependent Clp protease ATP-binding
   94::416     3e-24  35%  428 aa  CLPX_STRAW RecName: Full=ATP-dependent Clp protease ATP-binding
   94::407     3e-24  37%  426 aa  CLPX_RHOE4 RecName: Full=ATP-dependent Clp protease ATP-binding
   94::391     3e-24  39%  426 aa  CLPX_NOCSJ RecName: Full=ATP-dependent Clp protease ATP-binding
   94::404     3e-24  38%  421 aa  CLPX_BREBN RecName: Full=ATP-dependent Clp protease ATP-binding
   63::167     3e-24  43%  430 aa  CLPX_BORGA RecName: Full=ATP-dependent Clp protease ATP-binding
  105::400     4e-24  37%  408 aa  CLPX_STRTD RecName: Full=ATP-dependent Clp protease ATP-binding
  105::400     4e-24  37%  408 aa  CLPX_STRT2 RecName: Full=ATP-dependent Clp protease ATP-binding
  105::400     4e-24  37%  408 aa  CLPX_STRT1 RecName: Full=ATP-dependent Clp protease ATP-binding
  100::408     4e-24  37%  432 aa  CLPX_STRGG RecName: Full=ATP-dependent Clp protease ATP-binding
   94::388     4e-24  37%  426 aa  CLPX_MYCSS RecName: Full=ATP-dependent Clp protease ATP-binding
   94::388     4e-24  37%  426 aa  CLPX_MYCSK RecName: Full=ATP-dependent Clp protease ATP-binding
   94::388     4e-24  37%  426 aa  CLPX_MYCSJ RecName: Full=ATP-dependent Clp protease ATP-binding
  106::386     4e-24  39%  415 aa  CLPX_LEUCK RecName: Full=ATP-dependent Clp protease ATP-binding
   93::406     4e-24  36%  432 aa  CLPX_CLOAB RecName: Full=ATP-dependent Clp protease ATP-binding
   63::167     4e-24  43%  430 aa  CLPX_BORBU RecName: Full=ATP-dependent Clp protease ATP-binding
  160::405     4e-24  44%  424 aa  CLPX_BARHE RecName: Full=ATP-dependent Clp protease ATP-binding
  106::402     4e-24  37%  437 aa  CLPX_ACIBY RecName: Full=ATP-dependent Clp protease ATP-binding
  106::402     4e-24  37%  437 aa  CLPX_ACIBT RecName: Full=ATP-dependent Clp protease ATP-binding
  106::402     4e-24  37%  437 aa  CLPX_ACIBS RecName: Full=ATP-dependent Clp protease ATP-binding
  106::402     4e-24  37%  437 aa  CLPX_ACIBC RecName: Full=ATP-dependent Clp protease ATP-binding
  106::402     4e-24  37%  437 aa  CLPX_ACIB5 RecName: Full=ATP-dependent Clp protease ATP-binding
  106::402     4e-24  37%  437 aa  CLPX_ACIB3 RecName: Full=ATP-dependent Clp protease ATP-binding
  100::399     5e-24  36%  409 aa  CLPX_STRSV RecName: Full=ATP-dependent Clp protease ATP-binding
  100::404     5e-24  37%  428 aa  CLPX_STRCO RecName: Full=ATP-dependent Clp protease ATP-binding
   55::158     7e-24  44%  399 aa  CLPX_THET8 RecName: Full=ATP-dependent Clp protease ATP-binding
   55::158     7e-24  42%  399 aa  CLPX_THET2 RecName: Full=ATP-dependent Clp protease ATP-binding
  157::419     7e-24  43%  420 aa  CLPX_STAAW RecName: Full=ATP-dependent Clp protease ATP-binding
  157::419     7e-24  43%  420 aa  CLPX_STAAS RecName: Full=ATP-dependent Clp protease ATP-binding
  157::419     7e-24  43%  420 aa  CLPX_STAAB RecName: Full=ATP-dependent Clp protease ATP-binding
  113::392     7e-24  38%  432 aa  CLPX_FRAAA RecName: Full=ATP-dependent Clp protease ATP-binding
  157::419     9e-24  43%  420 aa  CLPX_STAAT RecName: Full=ATP-dependent Clp protease ATP-binding
  157::419     9e-24  43%  420 aa  CLPX_STAAR RecName: Full=ATP-dependent Clp protease ATP-binding
  157::419     9e-24  43%  420 aa  CLPX_STAAN RecName: Full=ATP-dependent Clp protease ATP-binding
  157::419     9e-24  43%  420 aa  CLPX_STAAM RecName: Full=ATP-dependent Clp protease ATP-binding
  157::419     9e-24  43%  420 aa  CLPX_STAAE RecName: Full=ATP-dependent Clp protease ATP-binding
  157::419     9e-24  43%  420 aa  CLPX_STAAC RecName: Full=ATP-dependent Clp protease ATP-binding
  157::419     9e-24  43%  420 aa  CLPX_STAA9 RecName: Full=ATP-dependent Clp protease ATP-binding
  157::419     9e-24  43%  420 aa  CLPX_STAA8 RecName: Full=ATP-dependent Clp protease ATP-binding
  157::419     9e-24  43%  420 aa  CLPX_STAA3 RecName: Full=ATP-dependent Clp protease ATP-binding
  157::419     9e-24  43%  420 aa  CLPX_STAA2 RecName: Full=ATP-dependent Clp protease ATP-binding
  157::419     9e-24  43%  420 aa  CLPX_STAA1 RecName: Full=ATP-dependent Clp protease ATP-binding
   94::405     9e-24  37%  421 aa  CLPX_LACPL RecName: Full=ATP-dependent Clp protease ATP-binding
   78::397     9e-24  35%  424 aa  CLPX_LACH4 RecName: Full=ATP-dependent Clp protease ATP-binding
  160::400     9e-24  43%  419 aa  CLPX_DESPS RecName: Full=ATP-dependent Clp protease ATP-binding
  103::395     9e-24  38%  429 aa  CLPX_CLOBL RecName: Full=ATP-dependent Clp protease ATP-binding
  103::395     9e-24  38%  429 aa  CLPX_CLOBK RecName: Full=ATP-dependent Clp protease ATP-binding
  103::395     9e-24  38%  429 aa  CLPX_CLOBJ RecName: Full=ATP-dependent Clp protease ATP-binding
  103::395     9e-24  38%  429 aa  CLPX_CLOBH RecName: Full=ATP-dependent Clp protease ATP-binding
  103::395     9e-24  38%  429 aa  CLPX_CLOB6 RecName: Full=ATP-dependent Clp protease ATP-binding
  103::395     9e-24  38%  429 aa  CLPX_CLOB1 RecName: Full=ATP-dependent Clp protease ATP-binding
  160::389     9e-24  46%  424 aa  CLPX_BRUSU RecName: Full=ATP-dependent Clp protease ATP-binding
  160::389     9e-24  46%  424 aa  CLPX_BRUSI RecName: Full=ATP-dependent Clp protease ATP-binding
   63::166     1e-23  47%  414 aa  CLPX_NEIMA RecName: Full=ATP-dependent Clp protease ATP-binding
  100::385     1e-23  39%  433 aa  CLPX_CLOPH RecName: Full=ATP-dependent Clp protease ATP-binding
  160::389     1e-23  46%  427 aa  CLPX_BRUO2 RecName: Full=ATP-dependent Clp protease ATP-binding
  160::389     1e-23  46%  424 aa  CLPX_BRUME RecName: Full=ATP-dependent Clp protease ATP-binding
  160::389     1e-23  46%  424 aa  CLPX_BRUMB RecName: Full=ATP-dependent Clp protease ATP-binding
  160::389     1e-23  46%  424 aa  CLPX_BRUC2 RecName: Full=ATP-dependent Clp protease ATP-binding
  160::389     1e-23  46%  424 aa  CLPX_BRUAB RecName: Full=ATP-dependent Clp protease ATP-binding
  160::389     1e-23  46%  424 aa  CLPX_BRUA2 RecName: Full=ATP-dependent Clp protease ATP-binding
  160::389     1e-23  46%  424 aa  CLPX_BRUA1 RecName: Full=ATP-dependent Clp protease ATP-binding
   60::167     1e-23  45%  433 aa  CLPX_ANATD RecName: Full=ATP-dependent Clp protease ATP-binding
   63::168     1e-23  45%  422 aa  CLPX_ZYMMO RecName: Full=ATP-dependent Clp protease ATP-binding
   82::388     1e-23  36%  425 aa  CLPX_THISH RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     1e-23  45%  426 aa  CLPX_SHESR RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     1e-23  45%  426 aa  CLPX_SHESM RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     1e-23  45%  426 aa  CLPX_SHESA RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     1e-23  45%  426 aa  CLPX_SHEON RecName: Full=ATP-dependent Clp protease ATP-binding
   98::403     1e-23  38%  435 aa  CLPX_CLOPS RecName: Full=ATP-dependent Clp protease ATP-binding
   98::403     1e-23  38%  435 aa  CLPX_CLOPE RecName: Full=ATP-dependent Clp protease ATP-binding
   98::403     1e-23  38%  435 aa  CLPX_CLOP1 RecName: Full=ATP-dependent Clp protease ATP-binding
  105::393     1e-23  38%  433 aa  CLPX_CALS8 RecName: Full=ATP-dependent Clp protease ATP-binding
   98::394     2e-23  38%  426 aa  CLPX_VIBCM RecName: Full=ATP-dependent Clp protease ATP-binding
   98::394     2e-23  38%  426 aa  CLPX_VIBCH RecName: Full=ATP-dependent Clp protease ATP-binding
   98::394     2e-23  38%  426 aa  CLPX_VIBC3 RecName: Full=ATP-dependent Clp protease ATP-binding
  100::400     2e-23  35%  410 aa  CLPX_STRPS RecName: Full=ATP-dependent Clp protease ATP-binding
  100::400     2e-23  35%  410 aa  CLPX_STRPJ RecName: Full=ATP-dependent Clp protease ATP-binding
  103::395     2e-23  38%  429 aa  CLPX_CLOBM RecName: Full=ATP-dependent Clp protease ATP-binding
   68::168     2e-23  46%  425 aa  CLPX_ALHEH RecName: Full=ATP-dependent Clp protease ATP-binding
  100::400     2e-23  35%  410 aa  CLPX_STRZP RecName: Full=ATP-dependent Clp protease ATP-binding
  100::400     2e-23  35%  410 aa  CLPX_STRZJ RecName: Full=ATP-dependent Clp protease ATP-binding
  100::400     2e-23  35%  410 aa  CLPX_STRR6 RecName: Full=ATP-dependent Clp protease ATP-binding
  100::400     2e-23  35%  410 aa  CLPX_STRPN RecName: Full=ATP-dependent Clp protease ATP-binding
  100::400     2e-23  35%  410 aa  CLPX_STRP7 RecName: Full=ATP-dependent Clp protease ATP-binding
  100::400     2e-23  35%  410 aa  CLPX_STRP4 RecName: Full=ATP-dependent Clp protease ATP-binding
  100::400     2e-23  35%  410 aa  CLPX_STRP2 RecName: Full=ATP-dependent Clp protease ATP-binding
  103::398     2e-23  37%  409 aa  CLPX_STREM RecName: Full=ATP-dependent Clp protease ATP-binding
   94::382     2e-23  37%  408 aa  CLPX_STRA5 RecName: Full=ATP-dependent Clp protease ATP-binding
   94::382     2e-23  37%  408 aa  CLPX_STRA3 RecName: Full=ATP-dependent Clp protease ATP-binding
   94::382     2e-23  37%  408 aa  CLPX_STRA1 RecName: Full=ATP-dependent Clp protease ATP-binding
  157::417     2e-23  43%  420 aa  CLPX_STAES RecName: Full=ATP-dependent Clp protease ATP-binding
  157::417     2e-23  43%  420 aa  CLPX_STAEQ RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     2e-23  45%  426 aa  CLPX_SHESW RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     2e-23  45%  426 aa  CLPX_SHEPC RecName: Full=ATP-dependent Clp protease ATP-binding
  156::409     2e-23  40%  421 aa  CLPX_EXIS2 RecName: Full=ATP-dependent Clp protease ATP-binding
  101::400     2e-23  37%  429 aa  CLPX_CLOB8 RecName: Full=ATP-dependent Clp protease ATP-binding
  152::401     2e-23  43%  415 aa  CLPX_ANAPZ RecName: Full=ATP-dependent Clp protease ATP-binding
  103::398     3e-23  37%  409 aa  CLPX_STRE4 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     3e-23  45%  426 aa  CLPX_SHEB9 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     3e-23  45%  426 aa  CLPX_SHEB8 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     3e-23  45%  426 aa  CLPX_SHEB5 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     3e-23  45%  426 aa  CLPX_SHEB2 RecName: Full=ATP-dependent Clp protease ATP-binding
   65::170     3e-23  45%  424 aa  CLPX_RHILO RecName: Full=ATP-dependent Clp protease ATP-binding
   94::390     3e-23  37%  427 aa  CLPX_RENSM RecName: Full=ATP-dependent Clp protease ATP-binding
   63::166     3e-23  47%  414 aa  CLPX_NEIMB RecName: Full=ATP-dependent Clp protease ATP-binding
   63::166     3e-23  46%  414 aa  CLPX_NEIM0 RecName: Full=ATP-dependent Clp protease ATP-binding
   75::423     4e-23  43%  440 aa  CLPX_THEEB RecName: Full=ATP-dependent Clp protease ATP-binding
  103::398     4e-23  37%  409 aa  CLPX_STRS7 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     4e-23  45%  425 aa  CLPX_SHEHH RecName: Full=ATP-dependent Clp protease ATP-binding
   98::387     4e-23  38%  418 aa  CLPX_PEDPA RecName: Full=ATP-dependent Clp protease ATP-binding
  107::388     4e-23  37%  422 aa  CLPX_EUBE2 RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-23  47%  424 aa  CLPX_ERWCT RecName: Full=ATP-dependent Clp protease ATP-binding
  104::383     4e-23  38%  423 aa  CLPX_BACSK RecName: Full=ATP-dependent Clp protease ATP-binding
   66::171     4e-23  45%  425 aa  CLPX_AGRVS RecName: Full=ATP-dependent Clp protease ATP-binding
  157::419     6e-23  40%  420 aa  CLPX_STAHJ RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     6e-23  45%  425 aa  CLPX_SHEPA RecName: Full=ATP-dependent Clp protease ATP-binding
  118::422     6e-23  39%  438 aa  CLPX_PELPB RecName: Full=ATP-dependent Clp protease ATP-binding
   94::401     6e-23  37%  420 aa  CLPX_NATTJ RecName: Full=ATP-dependent Clp protease ATP-binding
  158::387     6e-23  44%  421 aa  CLPX_MAGSA RecName: Full=ATP-dependent Clp protease ATP-binding
   94::397     6e-23  38%  421 aa  CLPX_GEOTN RecName: Full=ATP-dependent Clp protease ATP-binding
   98::414     6e-23  37%  423 aa  CLPX_EUBR3 RecName: Full=ATP-dependent Clp protease ATP-binding
  183::412     6e-23  44%  448 aa  CLPX_CYAP8 RecName: Full=ATP-dependent Clp protease ATP-binding
   98::392     7e-23  38%  426 aa  CLPX_VIBVY RecName: Full=ATP-dependent Clp protease ATP-binding
   98::392     7e-23  38%  426 aa  CLPX_VIBVU RecName: Full=ATP-dependent Clp protease ATP-binding
  103::383     7e-23  36%  410 aa  CLPX_STRMU RecName: Full=ATP-dependent Clp protease ATP-binding
   62::167     7e-23  44%  423 aa  CLPX_PROMH RecName: Full=ATP-dependent Clp protease ATP-binding
   63::166     7e-23  46%  414 aa  CLPX_NEIG1 RecName: Full=ATP-dependent Clp protease ATP-binding
  106::387     7e-23  38%  423 aa  CLPX_METS4 RecName: Full=ATP-dependent Clp protease ATP-binding
   95::384     7e-23  39%  420 aa  CLPX_HELMI RecName: Full=ATP-dependent Clp protease ATP-binding
   94::397     7e-23  38%  421 aa  CLPX_GEOKA RecName: Full=ATP-dependent Clp protease ATP-binding
   66::172     7e-23  44%  421 aa  CLPX_CHLCV RecName: Full=ATP-dependent Clp protease ATP-binding
   66::172     7e-23  44%  421 aa  CLPX_CHLAB RecName: Full=ATP-dependent Clp protease ATP-binding
  158::388     9e-23  46%  422 aa  CLPX_XANP2 RecName: Full=ATP-dependent Clp protease ATP-binding
   65::172     9e-23  45%  429 aa  CLPX_TERTT RecName: Full=ATP-dependent Clp protease ATP-binding
  161::390     9e-23  44%  425 aa  CLPX_RHISN RecName: Full=ATP-dependent Clp protease ATP-binding
   63::166     9e-23  46%  414 aa  CLPX_NEIMF RecName: Full=ATP-dependent Clp protease ATP-binding
   66::172     9e-23  44%  421 aa  CLPX_CHLFF RecName: Full=ATP-dependent Clp protease ATP-binding
  104::412     9e-23  37%  424 aa  CLPX_BACHD RecName: Full=ATP-dependent Clp protease ATP-binding
  103::410     9e-23  35%  429 aa  CLPX_ARTS2 RecName: Full=ATP-dependent Clp protease ATP-binding
  103::407     9e-23  35%  426 aa  CLPX_ARTCA RecName: Full=ATP-dependent Clp protease ATP-binding
  103::406     9e-23  37%  420 aa  CLPX_ALKMQ RecName: Full=ATP-dependent Clp protease ATP-binding
  163::389     1e-22  46%  426 aa  CLPX_WOLTR RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     1e-22  46%  423 aa  CLPX_PHOLL RecName: Full=ATP-dependent Clp protease ATP-binding
   59::163     1e-22  43%  400 aa  CLPX_NEOSM RecName: Full=ATP-dependent Clp protease ATP-binding
   62::388     1e-22  44%  424 aa  CLPX_LEGPL RecName: Full=ATP-dependent Clp protease ATP-binding
   62::388     1e-22  44%  424 aa  CLPX_LEGPH RecName: Full=ATP-dependent Clp protease ATP-binding
   62::388     1e-22  44%  424 aa  CLPX_LEGPC RecName: Full=ATP-dependent Clp protease ATP-binding
   62::388     1e-22  44%  424 aa  CLPX_LEGPA RecName: Full=ATP-dependent Clp protease ATP-binding
   59::163     1e-22  45%  422 aa  CLPX_COXBU RecName: Full=ATP-dependent Clp protease ATP-binding
   59::163     1e-22  45%  422 aa  CLPX_COXBN RecName: Full=ATP-dependent Clp protease ATP-binding
   59::163     1e-22  45%  422 aa  CLPX_COXB2 RecName: Full=ATP-dependent Clp protease ATP-binding
   59::163     1e-22  45%  422 aa  CLPX_COXB1 RecName: Full=ATP-dependent Clp protease ATP-binding
   62::167     1e-22  46%  424 aa  CLPX_AERS4 RecName: Full=ATP-dependent Clp protease ATP-binding
  157::386     1e-22  44%  418 aa  CLPX_ACICJ RecName: Full=ATP-dependent Clp protease ATP-binding
  161::390     2e-22  44%  425 aa  CLPX_SINMW RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     2e-22  46%  424 aa  CLPX_SHIBS RecName: Full=ATP-dependent Clp protease ATP-binding
   98::389     2e-22  38%  426 aa  CLPX_SHEFN RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     2e-22  46%  423 aa  CLPX_SERP5 RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     2e-22  47%  423 aa  CLPX_SALTI RecName: Full=ATP-dependent Clp protease ATP-binding
   63::168     2e-22  47%  424 aa  CLPX_RHOPT RecName: Full=ATP-dependent Clp protease ATP-binding
   63::168     2e-22  47%  424 aa  CLPX_RHOPA RecName: Full=ATP-dependent Clp protease ATP-binding
   63::168     2e-22  47%  424 aa  CLPX_RHOP2 RecName: Full=ATP-dependent Clp protease ATP-binding
  161::390     2e-22  44%  425 aa  CLPX_RHIME RecName: Full=ATP-dependent Clp protease ATP-binding
  106::387     2e-22  38%  423 aa  CLPX_METNO RecName: Full=ATP-dependent Clp protease ATP-binding
   94::394     2e-22  36%  422 aa  CLPX_EXISA RecName: Full=ATP-dependent Clp protease ATP-binding
  126::432     2e-22  38%  439 aa  CLPX_CHLTE RecName: Full=ATP-dependent Clp protease ATP-binding
   62::167     2e-22  46%  424 aa  CLPX_AERHH RecName: Full=ATP-dependent Clp protease ATP-binding
  109::409     2e-22  37%  429 aa  CLPX_SALAI RecName: Full=ATP-dependent Clp protease ATP-binding
   65::172     2e-22  45%  431 aa  CLPX_SACD2 RecName: Full=ATP-dependent Clp protease ATP-binding
  109::390     2e-22  38%  425 aa  CLPX_RHILW RecName: Full=ATP-dependent Clp protease ATP-binding
  109::390     2e-22  38%  425 aa  CLPX_RHIL3 RecName: Full=ATP-dependent Clp protease ATP-binding
  161::390     2e-22  44%  425 aa  CLPX_RHIEC RecName: Full=ATP-dependent Clp protease ATP-binding
  161::390     2e-22  44%  425 aa  CLPX_RHIE6 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     2e-22  45%  426 aa  CLPX_PSEMY RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     2e-22  46%  424 aa  CLPX_PECCP RecName: Full=ATP-dependent Clp protease ATP-binding
  106::387     2e-22  39%  421 aa  CLPX_METSB RecName: Full=ATP-dependent Clp protease ATP-binding
   62::167     2e-22  45%  421 aa  CLPX_GLUOX RecName: Full=ATP-dependent Clp protease ATP-binding
  157::400     2e-22  42%  419 aa  CLPX_GLUDA RecName: Full=ATP-dependent Clp protease ATP-binding
   59::163     2e-22  45%  422 aa  CLPX_COXBR RecName: Full=ATP-dependent Clp protease ATP-binding
   63::168     2e-22  44%  420 aa  CLPX_CAUSK RecName: Full=ATP-dependent Clp protease ATP-binding
   63::168     2e-22  47%  424 aa  CLPX_BRASO RecName: Full=ATP-dependent Clp protease ATP-binding
   63::168     2e-22  47%  424 aa  CLPX_BRASB RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     2e-22  46%  421 aa  CLPX_BAUCH RecName: Full=ATP-dependent Clp protease ATP-binding
   63::169     3e-22  45%  426 aa  CLPX_TOLAT RecName: Full=ATP-dependent Clp protease ATP-binding
  178::425     3e-22  43%  443 aa  CLPX_SYNP2 RecName: Full=ATP-dependent Clp protease ATP-binding
  158::402     3e-22  42%  411 aa  CLPX_PORGI RecName: Full=ATP-dependent Clp protease ATP-binding
  158::402     3e-22  42%  411 aa  CLPX_PORG3 RecName: Full=ATP-dependent Clp protease ATP-binding
  188::446     3e-22  43%  453 aa  CLPX_POLSQ RecName: Full=ATP-dependent Clp protease ATP-binding
   66::170     3e-22  45%  427 aa  CLPX_MARAV RecName: Full=ATP-dependent Clp protease ATP-binding
  100::393     3e-22  37%  411 aa  CLPX_LACLA RecName: Full=ATP-dependent Clp protease ATP-binding
   94::400     3e-22  36%  421 aa  CLPX_LACGA RecName: Full=ATP-dependent Clp protease ATP-binding
  170::415     3e-22  45%  431 aa  CLPX_CHLT3 RecName: Full=ATP-dependent Clp protease ATP-binding
  106::387     3e-22  38%  421 aa  CLPX_BEII9 RecName: Full=ATP-dependent Clp protease ATP-binding
   68::169     3e-22  45%  426 aa  CLPX_ALCBS RecName: Full=ATP-dependent Clp protease ATP-binding
  155::382     4e-22  44%  425 aa  CLPX_THETN RecName: Full=ATP-dependent Clp protease ATP-binding
  150::384     4e-22  45%  406 aa  CLPX_THEMA RecName: Full=ATP-dependent Clp protease ATP-binding
   46::390     4e-22  34%  429 aa  CLPX_STRM5 RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_SHISS RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_SHIFL RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_SHIF8 RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_SHIDS RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_SHIB3 RecName: Full=ATP-dependent Clp protease ATP-binding
   63::167     4e-22  44%  425 aa  CLPX_SHEAM RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  423 aa  CLPX_SALTY RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  423 aa  CLPX_SALSV RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  423 aa  CLPX_SALPK RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  423 aa  CLPX_SALPC RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  423 aa  CLPX_SALPB RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  423 aa  CLPX_SALPA RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  423 aa  CLPX_SALNS RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  423 aa  CLPX_SALHS RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  423 aa  CLPX_SALG2 RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  423 aa  CLPX_SALEP RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  423 aa  CLPX_SALDC RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  423 aa  CLPX_SALCH RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  423 aa  CLPX_SALAR RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  423 aa  CLPX_SALA4 RecName: Full=ATP-dependent Clp protease ATP-binding
  188::420     4e-22  46%  453 aa  CLPX_POLNS RecName: Full=ATP-dependent Clp protease ATP-binding
   64::391     4e-22  45%  424 aa  CLPX_NITOC RecName: Full=ATP-dependent Clp protease ATP-binding
   61::392     4e-22  46%  426 aa  CLPX_NITEU RecName: Full=ATP-dependent Clp protease ATP-binding
   62::167     4e-22  46%  420 aa  CLPX_MAGSM RecName: Full=ATP-dependent Clp protease ATP-binding
   66::395     4e-22  47%  424 aa  CLPX_KLEP7 RecName: Full=ATP-dependent Clp protease ATP-binding
   66::395     4e-22  47%  424 aa  CLPX_KLEP3 RecName: Full=ATP-dependent Clp protease ATP-binding
  156::411     4e-22  41%  416 aa  CLPX_HALOH RecName: Full=ATP-dependent Clp protease ATP-binding
   66::395     4e-22  47%  424 aa  CLPX_ESCF3 RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  45%  424 aa  CLPX_ENTS8 RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_ENT38 RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_ECOUT RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_ECOSM RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_ECOSE RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_ECOLU RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_ECOLI RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_ECOLC RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_ECOL6 RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_ECOL5 RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_ECOK1 RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_ECOHS RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_ECODH RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_ECOBW RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_ECO8A RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_ECO81 RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_ECO7I RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_ECO5E RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_ECO57 RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_ECO55 RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_ECO45 RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_ECO27 RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_ECO24 RecName: Full=ATP-dependent Clp protease ATP-binding
  167::395     4e-22  43%  430 aa  CLPX_CORDI RecName: Full=ATP-dependent Clp protease ATP-binding
  156::392     4e-22  44%  431 aa  CLPX_CLOCE RecName: Full=ATP-dependent Clp protease ATP-binding
   66::167     4e-22  47%  424 aa  CLPX_CITK8 RecName: Full=ATP-dependent Clp protease ATP-binding
  158::385     4e-22  45%  420 aa  CLPX_CAUCR RecName: Full=ATP-dependent Clp protease ATP-binding
  158::385     4e-22  45%  420 aa  CLPX_CAUCN RecName: Full=ATP-dependent Clp protease ATP-binding
   62::390     5e-22  45%  423 aa  CLPX_YERPY RecName: Full=ATP-dependent Clp protease ATP-binding
   62::390     5e-22  45%  423 aa  CLPX_YERPS RecName: Full=ATP-dependent Clp protease ATP-binding
   62::390     5e-22  45%  423 aa  CLPX_YERPP RecName: Full=ATP-dependent Clp protease ATP-binding
   62::390     5e-22  45%  423 aa  CLPX_YERPN RecName: Full=ATP-dependent Clp protease ATP-binding
   62::390     5e-22  45%  423 aa  CLPX_YERPG RecName: Full=ATP-dependent Clp protease ATP-binding
   62::390     5e-22  45%  423 aa  CLPX_YERPE RecName: Full=ATP-dependent Clp protease ATP-binding
   62::390     5e-22  45%  423 aa  CLPX_YERPB RecName: Full=ATP-dependent Clp protease ATP-binding
   62::390     5e-22  45%  423 aa  CLPX_YERPA RecName: Full=ATP-dependent Clp protease ATP-binding
   62::390     5e-22  45%  423 aa  CLPX_YERP3 RecName: Full=ATP-dependent Clp protease ATP-binding
  103::383     5e-22  37%  409 aa  CLPX_STRPM RecName: Full=ATP-dependent Clp protease ATP-binding
  103::383     5e-22  37%  409 aa  CLPX_STRPF RecName: Full=ATP-dependent Clp protease ATP-binding
  103::383     5e-22  37%  409 aa  CLPX_STRPD RecName: Full=ATP-dependent Clp protease ATP-binding
  103::383     5e-22  37%  409 aa  CLPX_STRP8 RecName: Full=ATP-dependent Clp protease ATP-binding
  103::383     5e-22  37%  409 aa  CLPX_STRP3 RecName: Full=ATP-dependent Clp protease ATP-binding
  103::383     5e-22  37%  409 aa  CLPX_STRP1 RecName: Full=ATP-dependent Clp protease ATP-binding
  109::409     5e-22  37%  429 aa  CLPX_SALTO RecName: Full=ATP-dependent Clp protease ATP-binding
   63::168     5e-22  46%  424 aa  CLPX_RHOPB RecName: Full=ATP-dependent Clp protease ATP-binding
   63::168     5e-22  46%  424 aa  CLPX_RHOP5 RecName: Full=ATP-dependent Clp protease ATP-binding
   63::167     5e-22  42%  421 aa  CLPX_PARDP RecName: Full=ATP-dependent Clp protease ATP-binding
   58::166     5e-22  44%  419 aa  CLPX_MOOTA RecName: Full=ATP-dependent Clp protease ATP-binding
  100::395     5e-22  36%  411 aa  CLPX_LACLS RecName: Full=ATP-dependent Clp protease ATP-binding
   59::162     5e-22  47%  417 aa  CLPX_FRATT RecName: Full=ATP-dependent Clp protease ATP-binding
   62::168     5e-22  46%  422 aa  CLPX_AZOSE RecName: Full=ATP-dependent Clp protease ATP-binding
   76::191     5e-22  44%  445 aa  CLPX_ANASP RecName: Full=ATP-dependent Clp protease ATP-binding
  103::383     6e-22  37%  409 aa  CLPX_STRPZ RecName: Full=ATP-dependent Clp protease ATP-binding
  103::383     6e-22  37%  409 aa  CLPX_STRPC RecName: Full=ATP-dependent Clp protease ATP-binding
  103::383     6e-22  37%  409 aa  CLPX_STRPB RecName: Full=ATP-dependent Clp protease ATP-binding
   64::169     6e-22  44%  424 aa  CLPX_SPHWW RecName: Full=ATP-dependent Clp protease ATP-binding
  157::386     6e-22  45%  421 aa  CLPX_RHOSK RecName: Full=ATP-dependent Clp protease ATP-binding
  157::386     6e-22  45%  421 aa  CLPX_RHOS4 RecName: Full=ATP-dependent Clp protease ATP-binding
  157::386     6e-22  45%  421 aa  CLPX_RHOS1 RecName: Full=ATP-dependent Clp protease ATP-binding
   63::168     6e-22  46%  424 aa  CLPX_NITWN RecName: Full=ATP-dependent Clp protease ATP-binding
   61::169     6e-22  45%  425 aa  CLPX_NITMU RecName: Full=ATP-dependent Clp protease ATP-binding
   63::168     6e-22  46%  424 aa  CLPX_NITHX RecName: Full=ATP-dependent Clp protease ATP-binding
   99::400     6e-22  36%  423 aa  CLPX_LYSSC RecName: Full=ATP-dependent Clp protease ATP-binding
   94::382     6e-22  37%  419 aa  CLPX_LISW6 RecName: Full=ATP-dependent Clp protease ATP-binding
   99::393     6e-22  38%  426 aa  CLPX_LEPBP RecName: Full=ATP-dependent Clp protease ATP-binding
   99::393     6e-22  38%  426 aa  CLPX_LEPBA RecName: Full=ATP-dependent Clp protease ATP-binding
  100::395     6e-22  36%  411 aa  CLPX_LACLM RecName: Full=ATP-dependent Clp protease ATP-binding
   66::170     6e-22  45%  427 aa  CLPX_HAHCH RecName: Full=ATP-dependent Clp protease ATP-binding
  108::390     6e-22  34%  426 aa  CLPX_CLAMS RecName: Full=ATP-dependent Clp protease ATP-binding
   63::168     6e-22  46%  423 aa  CLPX_BRAJA RecName: Full=ATP-dependent Clp protease ATP-binding
   63::168     6e-22  45%  422 aa  CLPX_AZOSB RecName: Full=ATP-dependent Clp protease ATP-binding
  161::404     6e-22  42%  425 aa  CLPX_AGRT5 RecName: Full=ATP-dependent Clp protease ATP-binding
  103::383     8e-22  37%  409 aa  CLPX_STRPG RecName: Full=ATP-dependent Clp protease ATP-binding
  103::383     8e-22  37%  409 aa  CLPX_STRP6 RecName: Full=ATP-dependent Clp protease ATP-binding
   46::390     8e-22  34%  429 aa  CLPX_STRMK RecName: Full=ATP-dependent Clp protease ATP-binding
  157::386     8e-22  45%  421 aa  CLPX_RHOS5 RecName: Full=ATP-dependent Clp protease ATP-binding
   63::168     8e-22  46%  424 aa  CLPX_RHOPS RecName: Full=ATP-dependent Clp protease ATP-binding
   65::389     8e-22  44%  425 aa  CLPX_RALME RecName: Full=ATP-dependent Clp protease ATP-binding
   61::397     8e-22  44%  427 aa  CLPX_NITEC RecName: Full=ATP-dependent Clp protease ATP-binding
   94::400     8e-22  35%  421 aa  CLPX_LACJO RecName: Full=ATP-dependent Clp protease ATP-binding
   63::393     8e-22  42%  422 aa  CLPX_HERAR RecName: Full=ATP-dependent Clp protease ATP-binding
  159::393     8e-22  42%  418 aa  CLPX_HAEDU RecName: Full=ATP-dependent Clp protease ATP-binding
   66::172     8e-22  43%  421 aa  CLPX_CHLPN RecName: Full=ATP-dependent Clp protease ATP-binding
   64::390     8e-22  44%  423 aa  CLPX_BURXL RecName: Full=ATP-dependent Clp protease ATP-binding
   64::390     8e-22  44%  423 aa  CLPX_BURPP RecName: Full=ATP-dependent Clp protease ATP-binding
  183::431     1e-21  41%  449 aa  CLPX_TRIEI RecName: Full=ATP-dependent Clp protease ATP-binding
  157::419     1e-21  41%  420 aa  CLPX_STAS1 RecName: Full=ATP-dependent Clp protease ATP-binding
   65::389     1e-21  45%  424 aa  CLPX_RALSO RecName: Full=ATP-dependent Clp protease ATP-binding
   65::389     1e-21  45%  424 aa  CLPX_RALPJ RecName: Full=ATP-dependent Clp protease ATP-binding
   65::389     1e-21  45%  425 aa  CLPX_RALEJ RecName: Full=ATP-dependent Clp protease ATP-binding
   65::389     1e-21  44%  425 aa  CLPX_RALEH RecName: Full=ATP-dependent Clp protease ATP-binding
  121::407     1e-21  38%  439 aa  CLPX_PROA2 RecName: Full=ATP-dependent Clp protease ATP-binding
  125::426     1e-21  38%  441 aa  CLPX_PELLD RecName: Full=ATP-dependent Clp protease ATP-binding
   65::170     1e-21  45%  424 aa  CLPX_MESSB RecName: Full=ATP-dependent Clp protease ATP-binding
   94::382     1e-21  37%  419 aa  CLPX_LISMO RecName: Full=ATP-dependent Clp protease ATP-binding
   94::382     1e-21  37%  419 aa  CLPX_LISMH RecName: Full=ATP-dependent Clp protease ATP-binding
   94::382     1e-21  37%  419 aa  CLPX_LISMF RecName: Full=ATP-dependent Clp protease ATP-binding
   94::382     1e-21  37%  419 aa  CLPX_LISMC RecName: Full=ATP-dependent Clp protease ATP-binding
   94::382     1e-21  37%  419 aa  CLPX_LISIN RecName: Full=ATP-dependent Clp protease ATP-binding
   63::392     1e-21  43%  422 aa  CLPX_JANMA RecName: Full=ATP-dependent Clp protease ATP-binding
   61::166     1e-21  45%  421 aa  CLPX_GEOSW RecName: Full=ATP-dependent Clp protease ATP-binding
   65::389     1e-21  44%  425 aa  CLPX_CUPTR RecName: Full=ATP-dependent Clp protease ATP-binding
   59::408     1e-21  40%  431 aa  CLPX_CLOTE RecName: Full=ATP-dependent Clp protease ATP-binding
  113::390     1e-21  35%  426 aa  CLPX_CLAM3 RecName: Full=ATP-dependent Clp protease ATP-binding
   65::171     1e-21  42%  419 aa  CLPX_CHLTR RecName: Full=ATP-dependent Clp protease ATP-binding
   65::171     1e-21  42%  419 aa  CLPX_CHLTB RecName: Full=ATP-dependent Clp protease ATP-binding
   65::171     1e-21  42%  419 aa  CLPX_CHLT2 RecName: Full=ATP-dependent Clp protease ATP-binding
  123::420     1e-21  40%  436 aa  CLPX_CHLPD RecName: Full=ATP-dependent Clp protease ATP-binding
   62::167     1e-21  45%  423 aa  CLPX_YEREN RecName: Full=ATP-dependent Clp protease ATP-binding
   62::167     1e-21  45%  423 aa  CLPX_YERE8 RecName: Full=ATP-dependent Clp protease ATP-binding
   69::169     1e-21  45%  428 aa  CLPX_XANOR RecName: Full=ATP-dependent Clp protease ATP-binding
   69::169     1e-21  45%  428 aa  CLPX_XANOP RecName: Full=ATP-dependent Clp protease ATP-binding
   69::169     1e-21  45%  428 aa  CLPX_XANOM RecName: Full=ATP-dependent Clp protease ATP-binding
   69::169     1e-21  45%  428 aa  CLPX_XANC5 RecName: Full=ATP-dependent Clp protease ATP-binding
   69::169     1e-21  45%  428 aa  CLPX_XANAC RecName: Full=ATP-dependent Clp protease ATP-binding
  155::400     1e-21  42%  424 aa  CLPX_THEPX RecName: Full=ATP-dependent Clp protease ATP-binding
  155::400     1e-21  42%  424 aa  CLPX_THEP3 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::183     1e-21  44%  425 aa  CLPX_PSYWF RecName: Full=ATP-dependent Clp protease ATP-binding
   63::182     1e-21  46%  424 aa  CLPX_PSYCK RecName: Full=ATP-dependent Clp protease ATP-binding
   63::182     1e-21  44%  424 aa  CLPX_PSYA2 RecName: Full=ATP-dependent Clp protease ATP-binding
  158::385     1e-21  43%  420 aa  CLPX_PHEZH RecName: Full=ATP-dependent Clp protease ATP-binding
   66::168     1e-21  40%  416 aa  CLPX_PELCD RecName: Full=ATP-dependent Clp protease ATP-binding
   63::168     1e-21  46%  424 aa  CLPX_OLICO RecName: Full=ATP-dependent Clp protease ATP-binding
  107::392     1e-21  37%  431 aa  CLPX_KOCRD RecName: Full=ATP-dependent Clp protease ATP-binding
   57::166     1e-21  43%  430 aa  CLPX_CLOK5 RecName: Full=ATP-dependent Clp protease ATP-binding
   59::168     1e-21  43%  432 aa  CLPX_CLOK1 RecName: Full=ATP-dependent Clp protease ATP-binding
   65::171     1e-21  42%  419 aa  CLPX_CHLMU RecName: Full=ATP-dependent Clp protease ATP-binding
   64::390     1e-21  43%  423 aa  CLPX_BURVG RecName: Full=ATP-dependent Clp protease ATP-binding
   64::404     1e-21  43%  423 aa  CLPX_BURTA RecName: Full=ATP-dependent Clp protease ATP-binding
   64::390     1e-21  43%  423 aa  CLPX_BURS3 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::404     1e-21  43%  423 aa  CLPX_BURPS RecName: Full=ATP-dependent Clp protease ATP-binding
   64::390     1e-21  44%  423 aa  CLPX_BURP8 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::404     1e-21  43%  423 aa  CLPX_BURP6 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::404     1e-21  43%  423 aa  CLPX_BURP0 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::404     1e-21  43%  423 aa  CLPX_BURMS RecName: Full=ATP-dependent Clp protease ATP-binding
   64::404     1e-21  43%  423 aa  CLPX_BURMA RecName: Full=ATP-dependent Clp protease ATP-binding
   64::404     1e-21  43%  423 aa  CLPX_BURM9 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::404     1e-21  43%  423 aa  CLPX_BURM7 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::390     1e-21  43%  423 aa  CLPX_BURM1 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::390     1e-21  43%  423 aa  CLPX_BURCM RecName: Full=ATP-dependent Clp protease ATP-binding
   64::390     1e-21  43%  423 aa  CLPX_BURCJ RecName: Full=ATP-dependent Clp protease ATP-binding
   64::390     1e-21  43%  423 aa  CLPX_BURCH RecName: Full=ATP-dependent Clp protease ATP-binding
   64::390     1e-21  43%  423 aa  CLPX_BURCC RecName: Full=ATP-dependent Clp protease ATP-binding
   64::390     1e-21  43%  423 aa  CLPX_BURCA RecName: Full=ATP-dependent Clp protease ATP-binding
   64::390     1e-21  43%  423 aa  CLPX_BURA4 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::166     1e-21  45%  420 aa  CLPX_ANOFW RecName: Full=ATP-dependent Clp protease ATP-binding
   66::395     2e-21  46%  424 aa  CLPX_SODGM RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     2e-21  44%  426 aa  CLPX_SHEDO RecName: Full=ATP-dependent Clp protease ATP-binding
   63::385     2e-21  43%  422 aa  CLPX_RHORT RecName: Full=ATP-dependent Clp protease ATP-binding
   63::389     2e-21  43%  421 aa  CLPX_RHOFD RecName: Full=ATP-dependent Clp protease ATP-binding
   63::389     2e-21  44%  421 aa  CLPX_POLSJ RecName: Full=ATP-dependent Clp protease ATP-binding
  179::426     2e-21  41%  444 aa  CLPX_MICAN RecName: Full=ATP-dependent Clp protease ATP-binding
  112::393     2e-21  35%  424 aa  CLPX_LEIXX RecName: Full=ATP-dependent Clp protease ATP-binding
   63::388     2e-21  44%  423 aa  CLPX_IDILO RecName: Full=ATP-dependent Clp protease ATP-binding
   63::168     2e-21  47%  420 aa  CLPX_GRABC RecName: Full=ATP-dependent Clp protease ATP-binding
   62::166     2e-21  42%  419 aa  CLPX_DINSH RecName: Full=ATP-dependent Clp protease ATP-binding
   61::166     2e-21  46%  421 aa  CLPX_DESHY RecName: Full=ATP-dependent Clp protease ATP-binding
   61::166     2e-21  46%  421 aa  CLPX_DESHD RecName: Full=ATP-dependent Clp protease ATP-binding
   62::167     2e-21  43%  416 aa  CLPX_DESAA RecName: Full=ATP-dependent Clp protease ATP-binding
  107::417     2e-21  35%  435 aa  CLPX_CYAA5 RecName: Full=ATP-dependent Clp protease ATP-binding
   67::391     2e-21  45%  424 aa  CLPX_COLP3 RecName: Full=ATP-dependent Clp protease ATP-binding
   65::171     2e-21  43%  419 aa  CLPX_CHLTA RecName: Full=ATP-dependent Clp protease ATP-binding
   71::172     2e-21  43%  429 aa  CLPX_BUCAI RecName: Full=ATP-dependent Clp protease ATP-binding
   71::172     2e-21  43%  429 aa  CLPX_BUCA5 RecName: Full=ATP-dependent Clp protease ATP-binding
   76::192     2e-21  44%  446 aa  CLPX_ANAVT RecName: Full=ATP-dependent Clp protease ATP-binding
   75::191     2e-21  44%  447 aa  CLPX_ACAM1 RecName: Full=ATP-dependent Clp protease ATP-binding
   61::358     2e-21  47%  423 aa  CLPX_THIDA RecName: Full=ATP-dependent Clp protease ATP-binding
   70::174     2e-21  45%  433 aa  CLPX_CELJU RecName: Full=ATP-dependent Clp protease ATP-binding
   66::392     3e-21  45%  428 aa  CLPX_VIBFM RecName: Full=ATP-dependent Clp protease ATP-binding
   66::392     3e-21  45%  428 aa  CLPX_VIBF1 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     3e-21  43%  425 aa  CLPX_SHESH RecName: Full=ATP-dependent Clp protease ATP-binding
   60::166     3e-21  47%  427 aa  CLPX_RICBR RecName: Full=ATP-dependent Clp protease ATP-binding
   60::166     3e-21  47%  427 aa  CLPX_RICB8 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     3e-21  45%  426 aa  CLPX_PSEAE RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     3e-21  45%  426 aa  CLPX_PSEAB RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     3e-21  45%  426 aa  CLPX_PSEA8 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     3e-21  45%  426 aa  CLPX_PSEA7 RecName: Full=ATP-dependent Clp protease ATP-binding
   98::391     3e-21  37%  425 aa  CLPX_PSEA6 RecName: Full=ATP-dependent Clp protease ATP-binding
  106::397     3e-21  38%  423 aa  CLPX_FUSNN RecName: Full=ATP-dependent Clp protease ATP-binding
  158::388     3e-21  44%  422 aa  CLPX_AZOC5 RecName: Full=ATP-dependent Clp protease ATP-binding
   69::168     4e-21  46%  426 aa  CLPX_XYLFT RecName: Full=ATP-dependent Clp protease ATP-binding
   69::169     4e-21  45%  426 aa  CLPX_XYLFM RecName: Full=ATP-dependent Clp protease ATP-binding
   69::169     4e-21  45%  426 aa  CLPX_XYLFA RecName: Full=ATP-dependent Clp protease ATP-binding
   69::168     4e-21  46%  426 aa  CLPX_XYLF2 RecName: Full=ATP-dependent Clp protease ATP-binding
   69::169     4e-21  45%  428 aa  CLPX_XANCP RecName: Full=ATP-dependent Clp protease ATP-binding
   69::169     4e-21  45%  428 aa  CLPX_XANCB RecName: Full=ATP-dependent Clp protease ATP-binding
   69::169     4e-21  45%  428 aa  CLPX_XANC8 RecName: Full=ATP-dependent Clp protease ATP-binding
   94::385     4e-21  37%  415 aa  CLPX_TREDE RecName: Full=ATP-dependent Clp protease ATP-binding
   62::166     4e-21  43%  423 aa  CLPX_SHEPW RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     4e-21  44%  426 aa  CLPX_SHELP RecName: Full=ATP-dependent Clp protease ATP-binding
   67::169     4e-21  47%  426 aa  CLPX_PHOPR RecName: Full=ATP-dependent Clp protease ATP-binding
   78::192     4e-21  45%  446 aa  CLPX_NOSP7 RecName: Full=ATP-dependent Clp protease ATP-binding
   63::167     4e-21  41%  421 aa  CLPX_JANSC RecName: Full=ATP-dependent Clp protease ATP-binding
   67::171     4e-21  45%  421 aa  CLPX_DIAST RecName: Full=ATP-dependent Clp protease ATP-binding
   64::386     4e-21  43%  418 aa  CLPX_DESAH RecName: Full=ATP-dependent Clp protease ATP-binding
   77::186     4e-21  42%  437 aa  CLPX_CHLPB RecName: Full=ATP-dependent Clp protease ATP-binding
   67::171     4e-21  45%  421 aa  CLPX_ACISJ RecName: Full=ATP-dependent Clp protease ATP-binding
   67::169     5e-21  47%  426 aa  CLPX_VIBPA RecName: Full=ATP-dependent Clp protease ATP-binding
   67::169     5e-21  47%  426 aa  CLPX_VIBHB RecName: Full=ATP-dependent Clp protease ATP-binding
  158::387     5e-21  43%  421 aa  CLPX_RHOCS RecName: Full=ATP-dependent Clp protease ATP-binding
  145::437     5e-21  36%  466 aa  CLPX_RHOBA RecName: Full=ATP-dependent Clp protease ATP-binding
   67::172     5e-21  43%  426 aa  CLPX_MARMS RecName: Full=ATP-dependent Clp protease ATP-binding
   66::168     5e-21  42%  417 aa  CLPX_GEOUR RecName: Full=ATP-dependent Clp protease ATP-binding
  165::394     5e-21  42%  426 aa  CLPX_CORGB RecName: Full=ATP-dependent Clp protease ATP-binding
   71::172     5e-21  42%  429 aa  CLPX_BUCAT RecName: Full=ATP-dependent Clp protease ATP-binding
   97::387     5e-21  37%  434 aa  CLPX_BORPA RecName: Full=ATP-dependent Clp protease ATP-binding
   97::387     5e-21  37%  434 aa  CLPX_BORBR RecName: Full=ATP-dependent Clp protease ATP-binding
   67::171     5e-21  43%  421 aa  CLPX_ACIAC RecName: Full=ATP-dependent Clp protease ATP-binding
   63::389     7e-21  42%  421 aa  CLPX_VARPS RecName: Full=ATP-dependent Clp protease ATP-binding
   77::191     7e-21  44%  445 aa  CLPX_SYNY3 RecName: Full=ATP-dependent Clp protease ATP-binding
  182::430     7e-21  42%  448 aa  CLPX_SYNJA RecName: Full=ATP-dependent Clp protease ATP-binding
   58::166     7e-21  48%  425 aa  CLPX_RICCK RecName: Full=ATP-dependent Clp protease ATP-binding
  117::406     7e-21  38%  438 aa  CLPX_PROVI RecName: Full=ATP-dependent Clp protease ATP-binding
  182::437     7e-21  41%  452 aa  CLPX_PROMM RecName: Full=ATP-dependent Clp protease ATP-binding
  182::437     7e-21  41%  452 aa  CLPX_PROM3 RecName: Full=ATP-dependent Clp protease ATP-binding
   63::389     7e-21  43%  421 aa  CLPX_POLNA RecName: Full=ATP-dependent Clp protease ATP-binding
   68::171     7e-21  44%  432 aa  CLPX_HERA2 RecName: Full=ATP-dependent Clp protease ATP-binding
   69::391     7e-21  44%  426 aa  CLPX_HALHL RecName: Full=ATP-dependent Clp protease ATP-binding
   60::165     7e-21  43%  417 aa  CLPX_DESOH RecName: Full=ATP-dependent Clp protease ATP-binding
  101::415     7e-21  36%  431 aa  CLPX_CORA7 RecName: Full=ATP-dependent Clp protease ATP-binding
   70::393     7e-21  45%  426 aa  CLPX_CHRVO RecName: Full=ATP-dependent Clp protease ATP-binding
   97::387     7e-21  37%  434 aa  CLPX_BORPE RecName: Full=ATP-dependent Clp protease ATP-binding
   64::166     7e-21  44%  421 aa  CLPX_BACLD RecName: Full=ATP-dependent Clp protease ATP-binding
  173::388     9e-21  45%  437 aa  CLPX_GLOVI RecName: Full=ATP-dependent Clp protease ATP-binding
   59::165     9e-21  45%  420 aa  CLPX_DECAR RecName: Full=ATP-dependent Clp protease ATP-binding
  165::394     9e-21  42%  426 aa  CLPX_CORGL RecName: Full=ATP-dependent Clp protease ATP-binding
   63::166     9e-21  45%  426 aa  CLPX_ALKOO RecName: Full=ATP-dependent Clp protease ATP-binding
   60::385     9e-21  42%  411 aa  CLPX_ACTSZ RecName: Full=ATP-dependent Clp protease ATP-binding
   63::169     1e-20  43%  421 aa  CLPX_SILST RecName: Full=ATP-dependent Clp protease ATP-binding
  156::398     1e-20  41%  425 aa  CLPX_RICRS RecName: Full=ATP-dependent Clp protease ATP-binding
  156::398     1e-20  41%  425 aa  CLPX_RICRO RecName: Full=ATP-dependent Clp protease ATP-binding
   60::398     1e-20  43%  425 aa  CLPX_RICPR RecName: Full=ATP-dependent Clp protease ATP-binding
   59::386     1e-20  44%  411 aa  CLPX_PASMU RecName: Full=ATP-dependent Clp protease ATP-binding
   64::172     1e-20  44%  423 aa  CLPX_METPP RecName: Full=ATP-dependent Clp protease ATP-binding
   79::193     1e-20  45%  447 aa  CLPX_CYAP7 RecName: Full=ATP-dependent Clp protease ATP-binding
   58::166     1e-20  42%  431 aa  CLPX_CLOTH RecName: Full=ATP-dependent Clp protease ATP-binding
   67::169     2e-20  46%  426 aa  CLPX_VIBSL RecName: Full=ATP-dependent Clp protease ATP-binding
   60::398     2e-20  43%  425 aa  CLPX_RICTY RecName: Full=ATP-dependent Clp protease ATP-binding
   58::166     2e-20  46%  425 aa  CLPX_RICM5 RecName: Full=ATP-dependent Clp protease ATP-binding
   58::166     2e-20  46%  425 aa  CLPX_RICFE RecName: Full=ATP-dependent Clp protease ATP-binding
   58::166     2e-20  46%  425 aa  CLPX_RICAH RecName: Full=ATP-dependent Clp protease ATP-binding
   64::169     2e-20  44%  427 aa  CLPX_PSEFS RecName: Full=ATP-dependent Clp protease ATP-binding
  182::433     2e-20  41%  453 aa  CLPX_PROM4 RecName: Full=ATP-dependent Clp protease ATP-binding
   60::385     2e-20  43%  418 aa  CLPX_PELPD RecName: Full=ATP-dependent Clp protease ATP-binding
  153::394     2e-20  42%  417 aa  CLPX_ORITI RecName: Full=ATP-dependent Clp protease ATP-binding
   63::168     2e-20  43%  423 aa  CLPX_METRJ RecName: Full=ATP-dependent Clp protease ATP-binding
   63::168     2e-20  43%  423 aa  CLPX_METPB RecName: Full=ATP-dependent Clp protease ATP-binding
   63::168     2e-20  43%  423 aa  CLPX_METEP RecName: Full=ATP-dependent Clp protease ATP-binding
   63::168     2e-20  43%  423 aa  CLPX_METC4 RecName: Full=ATP-dependent Clp protease ATP-binding
   66::168     2e-20  42%  417 aa  CLPX_GEOSF RecName: Full=ATP-dependent Clp protease ATP-binding
   63::161     2e-20  43%  422 aa  CLPX_AZOBR RecName: Full=ATP-dependent Clp protease ATP-binding
   65::171     2e-20  42%  424 aa  CLPX_SILPO RecName: Full=ATP-dependent Clp protease ATP-binding
   58::163     2e-20  46%  425 aa  CLPX_RICPU RecName: Full=ATP-dependent Clp protease ATP-binding
   58::163     2e-20  46%  425 aa  CLPX_RICCN RecName: Full=ATP-dependent Clp protease ATP-binding
   58::163     2e-20  46%  425 aa  CLPX_RICAE RecName: Full=ATP-dependent Clp protease ATP-binding
   79::404     2e-20  44%  442 aa  CLPX_PSEPK RecName: Full=ATP-dependent Clp protease ATP-binding
   64::393     2e-20  43%  427 aa  CLPX_PSEPG RecName: Full=ATP-dependent Clp protease ATP-binding
   64::169     2e-20  43%  427 aa  CLPX_PSEPF RecName: Full=ATP-dependent Clp protease ATP-binding
   64::389     2e-20  44%  427 aa  CLPX_PSEP1 RecName: Full=ATP-dependent Clp protease ATP-binding
  185::439     2e-20  42%  455 aa  CLPX_PROMS RecName: Full=ATP-dependent Clp protease ATP-binding
  185::439     2e-20  42%  455 aa  CLPX_PROM0 RecName: Full=ATP-dependent Clp protease ATP-binding
   61::389     2e-20  44%  414 aa  CLPX_HAES2 RecName: Full=ATP-dependent Clp protease ATP-binding
   61::389     2e-20  44%  414 aa  CLPX_HAES1 RecName: Full=ATP-dependent Clp protease ATP-binding
   59::348     2e-20  44%  406 aa  CLPX_EHRRW RecName: Full=ATP-dependent Clp protease ATP-binding
   59::348     2e-20  44%  406 aa  CLPX_EHRRG RecName: Full=ATP-dependent Clp protease ATP-binding
   59::163     2e-20  41%  406 aa  CLPX_EHRCJ RecName: Full=ATP-dependent Clp protease ATP-binding
  158::400     2e-20  41%  417 aa  CLPX1_WOLSU RecName: Full=ATP-dependent Clp protease ATP-binding
   64::389     3e-20  44%  427 aa  CLPX_PSEU2 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::389     3e-20  44%  427 aa  CLPX_PSESM RecName: Full=ATP-dependent Clp protease ATP-binding
   64::389     3e-20  44%  427 aa  CLPX_PSE14 RecName: Full=ATP-dependent Clp protease ATP-binding
  185::439     3e-20  42%  455 aa  CLPX_PROM9 RecName: Full=ATP-dependent Clp protease ATP-binding
   66::403     3e-20  42%  417 aa  CLPX_GEOSL RecName: Full=ATP-dependent Clp protease ATP-binding
  107::393     3e-20  37%  417 aa  CLPX_ENTFA RecName: Full=ATP-dependent Clp protease ATP-binding
   61::395     3e-20  43%  411 aa  CLPX_DICT6 RecName: Full=ATP-dependent Clp protease ATP-binding
   97::387     3e-20  37%  432 aa  CLPX_BORA1 RecName: Full=ATP-dependent Clp protease ATP-binding
   68::177     3e-20  43%  426 aa  CLPX_BLOFL RecName: Full=ATP-dependent Clp protease ATP-binding
   60::169     3e-20  41%  431 aa  CLPX_BDEBA RecName: Full=ATP-dependent Clp protease ATP-binding
   64::168     3e-20  42%  426 aa  CLPX_SHEWM RecName: Full=ATP-dependent Clp protease ATP-binding
   63::387     3e-20  41%  421 aa  CLPX_PARL1 RecName: Full=ATP-dependent Clp protease ATP-binding
  160::387     3e-20  43%  427 aa  CLPX_MYXXA RecName: Full=ATP-dependent Clp protease ATP-binding
   64::172     3e-20  44%  424 aa  CLPX_LEPCP RecName: Full=ATP-dependent Clp protease ATP-binding
   64::169     3e-20  42%  420 aa  CLPX_HYPNA RecName: Full=ATP-dependent Clp protease ATP-binding
   59::163     3e-20  42%  406 aa  CLPX_EHRCR RecName: Full=ATP-dependent Clp protease ATP-binding
   64::166     3e-20  43%  421 aa  CLPX_BACP2 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::166     3e-20  43%  419 aa  CLPX_BACHK RecName: Full=ATP-dependent Clp protease ATP-binding
   64::166     3e-20  43%  419 aa  CLPX_BACCZ RecName: Full=ATP-dependent Clp protease ATP-binding
   64::166     3e-20  43%  419 aa  CLPX_BACCQ RecName: Full=ATP-dependent Clp protease ATP-binding
   64::166     3e-20  43%  419 aa  CLPX_BACC7 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::166     3e-20  43%  419 aa  CLPX_BACC3 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::166     3e-20  43%  419 aa  CLPX_BACC1 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::166     3e-20  43%  419 aa  CLPX_BACC0 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::166     3e-20  43%  419 aa  CLPX_BACAN RecName: Full=ATP-dependent Clp protease ATP-binding
   64::166     3e-20  43%  419 aa  CLPX_BACAC RecName: Full=ATP-dependent Clp protease ATP-binding
   64::166     3e-20  43%  419 aa  CLPX_BACAA RecName: Full=ATP-dependent Clp protease ATP-binding
   63::387     4e-20  43%  421 aa  CLPX_ROSDO RecName: Full=ATP-dependent Clp protease ATP-binding
   64::393     4e-20  43%  427 aa  CLPX_PSEPW RecName: Full=ATP-dependent Clp protease ATP-binding
  195::451     4e-20  40%  452 aa  CLPX_HELPJ RecName: Full=ATP-dependent Clp protease ATP-binding
   60::168     4e-20  42%  419 aa  CLPX_GEOLS RecName: Full=ATP-dependent Clp protease ATP-binding
   61::395     4e-20  42%  411 aa  CLPX_DICTD RecName: Full=ATP-dependent Clp protease ATP-binding
  161::397     4e-20  44%  427 aa  CLPX_BUCAP RecName: Full=ATP-dependent Clp protease ATP-binding
   64::166     4e-20  43%  419 aa  CLPX_BACCR RecName: Full=ATP-dependent Clp protease ATP-binding
   64::166     4e-20  43%  419 aa  CLPX_BACCN RecName: Full=ATP-dependent Clp protease ATP-binding
   64::166     4e-20  43%  419 aa  CLPX_BACC4 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::166     4e-20  43%  419 aa  CLPX_BACC2 RecName: Full=ATP-dependent Clp protease ATP-binding
   66::166     4e-20  48%  423 aa  CLPX_ACIF5 RecName: Full=ATP-dependent Clp protease ATP-binding
   66::166     4e-20  48%  423 aa  CLPX_ACIF2 RecName: Full=ATP-dependent Clp protease ATP-binding
  182::437     6e-20  41%  449 aa  CLPX_SYNR3 RecName: Full=ATP-dependent Clp protease ATP-binding
   66::168     6e-20  43%  417 aa  CLPX_GEOSM RecName: Full=ATP-dependent Clp protease ATP-binding
   66::168     6e-20  43%  417 aa  CLPX_GEOBB RecName: Full=ATP-dependent Clp protease ATP-binding
   58::386     6e-20  41%  417 aa  CLPX_DESVV RecName: Full=ATP-dependent Clp protease ATP-binding
   58::386     6e-20  41%  417 aa  CLPX_DESVH RecName: Full=ATP-dependent Clp protease ATP-binding
   58::162     6e-20  40%  405 aa  CLPX_ANAMM RecName: Full=ATP-dependent Clp protease ATP-binding
   58::162     6e-20  40%  405 aa  CLPX_ANAMF RecName: Full=ATP-dependent Clp protease ATP-binding
   63::394     8e-20  44%  425 aa  CLPX_PSYIN RecName: Full=ATP-dependent Clp protease ATP-binding
   62::389     8e-20  43%  412 aa  CLPX_MANSM RecName: Full=ATP-dependent Clp protease ATP-binding
   66::400     8e-20  42%  417 aa  CLPX_GEOMG RecName: Full=ATP-dependent Clp protease ATP-binding
   66::170     8e-20  42%  420 aa  CLPX_DELAS RecName: Full=ATP-dependent Clp protease ATP-binding
   64::166     8e-20  42%  420 aa  CLPX_BACSU RecName: Full=ATP-dependent Clp protease ATP-binding
   64::166     8e-20  42%  420 aa  CLPX_BACA2 RecName: Full=ATP-dependent Clp protease ATP-binding
   61::403     1e-19  42%  409 aa  CLPX_THEYD RecName: Full=ATP-dependent Clp protease ATP-binding
   76::192     1e-19  43%  448 aa  CLPX_SYNJB RecName: Full=ATP-dependent Clp protease ATP-binding
  157::400     1e-19  40%  420 aa  CLPX_STACT RecName: Full=ATP-dependent Clp protease ATP-binding
   61::166     1e-19  43%  425 aa  CLPX_OCEIH RecName: Full=ATP-dependent Clp protease ATP-binding
   63::165     1e-19  42%  429 aa  CLPX_CLOBB RecName: Full=ATP-dependent Clp protease ATP-binding
   63::165     1e-19  42%  429 aa  CLPX_CLOBA RecName: Full=ATP-dependent Clp protease ATP-binding
   64::416     1e-19  43%  428 aa  CLPX_BUCBP RecName: Full=ATP-dependent Clp protease ATP-binding
   68::407     1e-19  44%  428 aa  CLPX2_METCA RecName: Full=ATP-dependent Clp protease ATP-binding
   61::388     1e-19  40%  411 aa  CLPX_HAEIN RecName: Full=ATP-dependent Clp protease ATP-binding
  150::384     1e-19  41%  397 aa  CLPX2_WOLSU RecName: Full=ATP-dependent Clp protease ATP-binding
   61::163     2e-19  44%  417 aa  CLPX_ORITB RecName: Full=ATP-dependent Clp protease ATP-binding
   66::176     2e-19  42%  426 aa  CLPX_COREF RecName: Full=ATP-dependent Clp protease ATP-binding
  185::439     2e-19  41%  455 aa  CLPX_PROM2 RecName: Full=ATP-dependent Clp protease ATP-binding
   61::167     2e-19  38%  417 aa  CLPX_LAWIP RecName: Full=ATP-dependent Clp protease ATP-binding
  182::437     3e-19  41%  449 aa  CLPX_SYNPX RecName: Full=ATP-dependent Clp protease ATP-binding
  185::451     3e-19  40%  455 aa  CLPX_PROMP RecName: Full=ATP-dependent Clp protease ATP-binding
   62::168     3e-19  41%  432 aa  CLPX_BORPD RecName: Full=ATP-dependent Clp protease ATP-binding
   78::192     4e-19  44%  449 aa  CLPX_SYNSC RecName: Full=ATP-dependent Clp protease ATP-binding
   70::172     5e-19  41%  425 aa  CLPX_WOLPM RecName: Full=ATP-dependent Clp protease ATP-binding
  183::438     6e-19  40%  451 aa  CLPX_SYNPW RecName: Full=ATP-dependent Clp protease ATP-binding
  165::389     6e-19  42%  429 aa  CLPX_PROAC RecName: Full=ATP-dependent Clp protease ATP-binding
   69::164     6e-19  45%  413 aa  CLPX_PARUW RecName: Full=ATP-dependent Clp protease ATP-binding
   67::387     6e-19  43%  422 aa  CLPX1_METCA RecName: Full=ATP-dependent Clp protease ATP-binding
   60::167     8e-19  40%  417 aa  CLPX_DESDG RecName: Full=ATP-dependent Clp protease ATP-binding
  183::438     1e-18  41%  451 aa  CLPX_SYNS3 RecName: Full=ATP-dependent Clp protease ATP-binding
   64::174     1e-18  42%  435 aa  CLPX3_METCA RecName: Full=ATP-dependent Clp protease ATP-binding
   83::195     2e-18  40%  449 aa  CLPX_SYNP6 RecName: Full=ATP-dependent Clp protease ATP-binding
   83::195     2e-18  40%  449 aa  CLPX_SYNE7 RecName: Full=ATP-dependent Clp protease ATP-binding
   57::169     2e-18  44%  440 aa  CLPX_AZOVI RecName: Full=ATP-dependent Clp protease ATP-binding
  185::421     7e-18  41%  455 aa  CLPX_PROM5 RecName: Full=ATP-dependent Clp protease ATP-binding
   60::167     1e-17  41%  415 aa  CLPX_TREPS RecName: Full=ATP-dependent Clp protease ATP-binding
   60::167     1e-17  41%  415 aa  CLPX_TREPA RecName: Full=ATP-dependent Clp protease ATP-binding
   63::166     1e-16  40%  416 aa  CLPX_CLOD6 RecName: Full=ATP-dependent Clp protease ATP-binding
   68::167     2e-16  42%  415 aa  CLPX_WIGBR RecName: Full=ATP-dependent Clp protease ATP-binding
   33::190     7e-15  35%  520 aa  MCX1_YEAST RecName: Full=Mitochondrial clpX-like chaperone MCX1;
    1::72      3e-14  57%   72 aa  HSLU_BUCSC RecName: Full=ATP-dependent hsl protease ATP-binding
  288::343     5e-13  46%  633 aa  CLPX_RAT RecName: Full=ATP-dependent Clp protease ATP-binding
  288::343     5e-13  46%  633 aa  CLPX_PONAB RecName: Full=ATP-dependent Clp protease ATP-binding
  289::344     5e-13  46%  634 aa  CLPX_MOUSE RecName: Full=ATP-dependent Clp protease ATP-binding
  288::343     5e-13  46%  633 aa  CLPX_HUMAN RecName: Full=ATP-dependent Clp protease ATP-binding
  106::209     1e-08  39%  371 aa  PRS2_METJA RecName: Full=Putative 26S protease regulatory subunit
  313::396     9e-08  40%  677 aa  CLPB_RAT RecName: Full=Caseinolytic peptidase B protein
  381::467     1e-07  38%  660 aa  SUR2_SCHPO RecName: Full=Protein sur2;
  150::260     1e-07  41%  632 aa  FTSH_HELPY RecName: Full=Cell division protease ftsH homolog;      
  150::260     1e-07  41%  632 aa  FTSH_HELPJ RecName: Full=Cell division protease ftsH homolog;      
  184::241     1e-07  47%  635 aa  FTSH1_HAEIN RecName: Full=Cell division protease ftsH homolog 1;   
  154::242     2e-07  40%  644 aa  FTSH_SHIFL RecName: Full=Cell division protease ftsH;       
  154::242     2e-07  40%  644 aa  FTSH_SALTY RecName: Full=Cell division protease ftsH;       
  154::242     2e-07  40%  644 aa  FTSH_SALTI RecName: Full=Cell division protease ftsH;       
  154::242     2e-07  40%  644 aa  FTSH_ECOLI RecName: Full=Cell division protease ftsH;       
  154::242     2e-07  40%  644 aa  FTSH_ECO57 RecName: Full=Cell division protease ftsH;       
  199::256     2e-07  45%  679 aa  FTSH_BACPF RecName: Full=Cell division protease ftsH homolog;      
  506::597     3e-07  45%  817 aa  CLPC_STAES RecName: Full=ATP-dependent Clp protease ATP-binding
  506::597     3e-07  45%  817 aa  CLPC_STAEQ RecName: Full=ATP-dependent Clp protease ATP-binding
  313::396     3e-07  39%  677 aa  CLPB_MOUSE RecName: Full=Caseinolytic peptidase B protein
  343::426     3e-07  39%  707 aa  CLPB_HUMAN RecName: Full=Caseinolytic peptidase B protein
  313::396     3e-07  39%  677 aa  CLPB_BOVIN RecName: Full=Caseinolytic peptidase B protein
  219::274     4e-07  43%  644 aa  FTSH_ODOSI RecName: Full=Cell division protease ftsH homolog;      
  204::259     4e-07  43%  614 aa  FTSH_CYACA RecName: Full=Cell division protease ftsH homolog;      
  188::245     4e-07  47%  634 aa  FTSH_AQUAE RecName: Full=Cell division protease ftsH homolog;      
  185::242     6e-07  45%  613 aa  FTSH_BUCAP RecName: Full=Cell division protease ftsH;       
  135::218     6e-07  36%  438 aa  CLPB1_CHLTE RecName: Full=Probable chaperone protein clpB 1;
  194::251     7e-07  43%  637 aa  FTSH_BACSU RecName: Full=Cell division protease ftsH homolog;      
  253::309     7e-07  42%  686 aa  FTSH6_ORYSJ RecName: Full=Cell division protease ftsH homolog 6,
  194::249     7e-07  43%  616 aa  FTSH4_SYNY3 RecName: Full=Cell division protease ftsH homolog 4;   
  565::639     7e-07  40%  857 aa  CLPB_SALTY RecName: Full=Chaperone protein clpB;
  565::639     7e-07  40%  857 aa  CLPB_SALTI RecName: Full=Chaperone protein clpB;
  565::639     7e-07  40%  857 aa  CLPB_PHOPR RecName: Full=Chaperone protein clpB;
  185::243     1e-06  42%  610 aa  FTSH_BUCBP RecName: Full=Cell division protease ftsH;       
  506::597     1e-06  44%  818 aa  CLPC_STAAW RecName: Full=ATP-dependent Clp protease ATP-binding
  424::528     1e-06  35%  717 aa  CLPB_MYCGA RecName: Full=Chaperone protein clpB;
  565::639     1e-06  40%  856 aa  CLPB_HAEIN RecName: Full=Chaperone protein clpB;
  286::341     1e-06  46%  714 aa  FTSH_TOBAC RecName: Full=Cell division protease ftsH homolog,
  286::341     1e-06  46%  706 aa  FTSH_MEDSA RecName: Full=Cell division protease ftsH homolog,
  187::242     1e-06  41%  603 aa  FTSH_CYAME RecName: Full=Cell division protease ftsH homolog;      
  185::242     1e-06  43%  611 aa  FTSH_BUCAI RecName: Full=Cell division protease ftsH;       
  283::338     1e-06  46%  704 aa  FTSH5_ARATH RecName: Full=Cell division protease ftsH homolog 5,
  260::315     1e-06  43%  695 aa  FTSH2_ARATH RecName: Full=Cell division protease ftsH homolog 2,
  265::320     1e-06  46%  686 aa  FTSH1_ORYSJ RecName: Full=Cell division protease ftsH homolog 1,
  295::350     1e-06  46%  716 aa  FTSH1_ARATH RecName: Full=Cell division protease ftsH homolog 1,
  206::261     1e-06  41%  628 aa  FSTH_PORYE RecName: Full=Cell division protease ftsH homolog;      
  438::496     1e-06  44%  748 aa  CLPE_LACLA RecName: Full=ATP-dependent Clp protease ATP-binding
  565::639     1e-06  38%  857 aa  CLPB_SHIFL RecName: Full=Chaperone protein clpB;
  565::639     1e-06  38%  857 aa  CLPB_ECOLI RecName: Full=Chaperone protein clpB;AltName: Full=Heat
  565::639     1e-06  38%  857 aa  CLPB_ECOL6 RecName: Full=Chaperone protein clpB;
  565::639     1e-06  38%  857 aa  CLPB_ECO57 RecName: Full=Chaperone protein clpB;
  282::368     2e-06  37%  715 aa  YMEL1_RAT RecName: Full=ATP-dependent metalloprotease YME1L1;      
  282::368     2e-06  37%  715 aa  YMEL1_MOUSE RecName: Full=ATP-dependent metalloprotease YME1L1;    
  206::261     2e-06  41%  628 aa  FTSH_PORPU RecName: Full=Cell division protease ftsH homolog;      
  206::261     2e-06  41%  631 aa  FTSH_GUITH RecName: Full=Cell division protease ftsH homolog;      
  362::419     2e-06  43%  806 aa  FTSH9_ARATH RecName: Full=Cell division protease ftsH homolog 9,
  253::308     2e-06  41%  685 aa  FTSH8_ARATH RecName: Full=Cell division protease ftsH homolog 8,
  247::302     2e-06  41%  676 aa  FTSH2_ORYSJ RecName: Full=Cell division protease ftsH homolog 2,
  205::260     2e-06  41%  627 aa  FTSH1_SYNY3 RecName: Full=Cell division protease ftsH homolog 1;   
  234::289     2e-06  43%  676 aa  YME1_CAEEL RecName: Full=Protein YME1 homolog;         EC=3.4.24.-;
  158::244     2e-06  36%  412 aa  PSMR_METPE RecName: Full=Proteasome-activating
  204::259     2e-06  43%  428 aa  PRS7_DICDI RecName: Full=26S protease regulatory subunit 7;AltName:
  196::251     2e-06  45%  760 aa  FTSH_MYCTU RecName: Full=Cell division protease ftsH homolog;      
  196::251     2e-06  45%  760 aa  FTSH_MYCTA RecName: Full=Cell division protease ftsH homolog;      
  196::251     2e-06  45%  760 aa  FTSH_MYCBO RecName: Full=Cell division protease ftsH homolog;      
  358::415     2e-06  43%  802 aa  FTSH7_ARATH RecName: Full=Cell division protease ftsH homolog 7,
  207::264     2e-06  41%  628 aa  FTSH3_SYNY3 RecName: Full=Cell division protease ftsH homolog 3;   
  444::501     2e-06  43%  752 aa  CLPE_STRPN RecName: Full=ATP-dependent Clp protease ATP-binding
  506::597     2e-06  44%  818 aa  CLPC_STAAS RecName: Full=ATP-dependent Clp protease ATP-binding
  506::597     2e-06  44%  818 aa  CLPC_STAAR RecName: Full=ATP-dependent Clp protease ATP-binding
  506::597     2e-06  44%  818 aa  CLPC_STAAN RecName: Full=ATP-dependent Clp protease ATP-binding
  506::597     2e-06  44%  818 aa  CLPC_STAAM RecName: Full=ATP-dependent Clp protease ATP-binding
  506::597     2e-06  44%  818 aa  CLPC_STAAC RecName: Full=ATP-dependent Clp protease ATP-binding
  506::597     2e-06  44%  818 aa  CLPC_STAAB RecName: Full=ATP-dependent Clp protease ATP-binding
  506::597     2e-06  44%  818 aa  CLPC_STAA8 RecName: Full=ATP-dependent Clp protease ATP-binding
  506::597     2e-06  44%  818 aa  CLPC_STAA3 RecName: Full=ATP-dependent Clp protease ATP-binding
  563::644     2e-06  35%  853 aa  CLPB_WOLPM RecName: Full=Chaperone protein clpB;
  566::639     2e-06  37%  857 aa  CLPB_SHEON RecName: Full=Chaperone protein clpB;
  501::600     2e-06  41%  809 aa  CLPB_OCEIH RecName: Full=Chaperone protein clpB;
  565::666     2e-06  32%  874 aa  CLPB_BRUSU RecName: Full=Chaperone protein clpB;
  565::666     2e-06  32%  874 aa  CLPB_BRUME RecName: Full=Chaperone protein clpB;
  560::647     2e-06  33%  872 aa  CLPB_BLOFL RecName: Full=Chaperone protein clpB;
  552::635     2e-06  37%  874 aa  CLPA_BRANA RecName: Full=ATP-dependent Clp protease ATP-binding
  144::223     3e-06  36%  392 aa  PSMR_SULTO RecName: Full=Proteasome-activating
  174::229     3e-06  41%  609 aa  FTSH_TREPA RecName: Full=Cell division protease ftsH homolog;      
  209::266     3e-06  41%  638 aa  FTSH_HELFE RecName: Full=Cell division protease ftsH homolog;      
  244::299     3e-06  41%  665 aa  FTSH2_SYNY3 RecName: Full=Cell division protease ftsH homolog 2;   
  438::496     3e-06  42%  748 aa  CLPE_LACLM RecName: Full=ATP-dependent Clp protease ATP-binding
  506::597     3e-06  44%  820 aa  CLPC_STAS1 RecName: Full=ATP-dependent Clp protease ATP-binding
  506::597     3e-06  44%  824 aa  CLPC_STAHJ RecName: Full=ATP-dependent Clp protease ATP-binding
  565::639     3e-06  39%  861 aa  CLPB_XANAC RecName: Full=Chaperone protein clpB;
  566::639     3e-06  39%  857 aa  CLPB_STRAL RecName: Full=Chaperone protein clpB;
  565::650     3e-06  40%  868 aa  CLPB_PARUW RecName: Full=Chaperone protein clpB;
  571::671     3e-06  38%  860 aa  CLPB_DICNO RecName: Full=Chaperone protein clpB;
  571::645     3e-06  35%  865 aa  CLPB_CLOAB RecName: Full=Chaperone protein clpB;
  168::223     4e-06  43%  393 aa  PSMR_SULSO RecName: Full=Proteasome-activating
  168::223     4e-06  43%  393 aa  PSMR_SULIY RecName: Full=Proteasome-activating
  168::223     4e-06  43%  393 aa  PSMR_SULIN RecName: Full=Proteasome-activating
  168::223     4e-06  43%  393 aa  PSMR_SULIM RecName: Full=Proteasome-activating
  168::223     4e-06  43%  393 aa  PSMR_SULIL RecName: Full=Proteasome-activating
  168::223     4e-06  43%  393 aa  PSMR_SULIK RecName: Full=Proteasome-activating
  168::223     4e-06  43%  393 aa  PSMR_SULIA RecName: Full=Proteasome-activating
  243::298     4e-06  45%  467 aa  PRS7_YEAST RecName: Full=26S protease regulatory subunit 7
  348::436     4e-06  37%  822 aa  FTSH7_ORYSJ RecName: Full=Cell division protease ftsH homolog 7,
  318::404     4e-06  34%  591 aa  FIGL1_CAEBR RecName: Full=Fidgetin-like protein 1;       
  565::639     4e-06  39%  861 aa  CLPB_XANCP RecName: Full=Chaperone protein clpB;
  565::639     4e-06  33%  868 aa  CLPB_RHILO RecName: Full=Chaperone protein clpB;
  565::639     4e-06  35%  857 aa  CLPB_PHOLL RecName: Full=Chaperone protein clpB;
  567::641     4e-06  39%  859 aa  CLPB_COXBU RecName: Full=Chaperone protein clpB;
  213::268     5e-06  39%  436 aa  PSMR_METKA RecName: Full=Proteasome-activating
  188::241     5e-06  43%  637 aa  FTSH_RICTY RecName: Full=Cell division protease ftsH homolog;      
  188::241     5e-06  43%  637 aa  FTSH_RICPR RecName: Full=Cell division protease ftsH homolog;      
  188::241     5e-06  43%  635 aa  FTSH_RICFE RecName: Full=Cell division protease ftsH homolog;      
  188::241     5e-06  43%  637 aa  FTSH_RICCN RecName: Full=Cell division protease ftsH homolog;      
  188::241     5e-06  43%  638 aa  FTSH_RICBR RecName: Full=Cell division protease ftsH homolog;      
  196::251     5e-06  43%  787 aa  FTSH_MYCLE RecName: Full=Cell division protease ftsH homolog;      
  565::639     5e-06  38%  857 aa  CLPB_YERPE RecName: Full=Chaperone protein clpB;
  566::667     5e-06  33%  879 aa  CLPB_RHOPA RecName: Full=Chaperone protein clpB;
  571::645     5e-06  38%  865 aa  CLPB_PROMM RecName: Full=Chaperone protein clpB;
  571::663     5e-06  41%  874 aa  CLPB1_SYNE7 RecName: Full=Chaperone protein clpB 1;
  604::687     5e-06  38%  923 aa  CLPAB_SOLLC RecName: Full=ATP-dependent Clp protease ATP-binding
  209::264     6e-06  43%  433 aa  PRS7_XENLA RecName: Full=26S protease regulatory subunit 7;AltName:
  213::268     6e-06  43%  438 aa  PRS7_SCHPO RecName: Full=26S protease regulatory subunit 7 homolog;
  209::264     6e-06  43%  433 aa  PRS7_PONAB RecName: Full=26S protease regulatory subunit 7;AltName:
  209::264     6e-06  43%  433 aa  PRS7_MOUSE RecName: Full=26S protease regulatory subunit 7;AltName:
  209::264     6e-06  43%  433 aa  PRS7_MACFA RecName: Full=26S protease regulatory subunit 7;AltName:
  209::264     6e-06  43%  433 aa  PRS7_HUMAN RecName: Full=26S protease regulatory subunit 7;AltName:
  209::264     6e-06  43%  433 aa  PRS7_BOVIN RecName: Full=26S protease regulatory subunit 7;AltName:
  263::318     6e-06  45%  662 aa  FTSH_CAPAN RecName: Full=Cell division protease ftsH homolog,
  604::687     6e-06  37%  922 aa  CLPC_PEA RecName: Full=ATP-dependent Clp protease ATP-binding
  574::662     6e-06  33%  881 aa  CLPB_RHOBA RecName: Full=Chaperone protein clpB;
  570::644     6e-06  38%  862 aa  CLPB1_SYNPX RecName: Full=Chaperone protein clpB 1;
  478::584     6e-06  31%  793 aa  CLPA_RHOBL RecName: Full=ClpA homolog protein;
  607::690     6e-06  37%  926 aa  CLPAA_SOLLC RecName: Full=ATP-dependent Clp protease ATP-binding
  185::240     8e-06  39%  410 aa  PSMR_METTH RecName: Full=Proteasome-activating
  211::266     8e-06  43%  435 aa  PRS7_CAEEL RecName: Full=26S protease regulatory subunit 7;AltName:
  502::573     8e-06  42%  803 aa  HSP78_SCHPO RecName: Full=Heat shock protein 78,
  565::639     8e-06  36%  861 aa  CLPB_XYLFT RecName: Full=Chaperone protein clpB;
  564::642     8e-06  39%  857 aa  CLPB_CAMJE RecName: Full=Chaperone protein clpB;
  565::639     1e-05  36%  861 aa  CLPB_XYLFA RecName: Full=Chaperone protein clpB;
  300::357     1e-05  40%  709 aa  YME1_SCHPO RecName: Full=Protein YME1 homolog;         EC=3.4.24.-;
  329::386     1e-05  41%  773 aa  RCA1_SCHPO RecName: Full=Mitochondrial respiratory chain complexes
  188::269     1e-05  33%  436 aa  PSMR_METB6 RecName: Full=Proteasome-activating
  209::264     1e-05  43%  433 aa  PRS7_RAT RecName: Full=26S protease regulatory subunit 7;AltName:
  226::283     1e-05  41%  695 aa  FTSH_LACLA RecName: Full=Cell division protease ftsH homolog;      
  412::471     1e-05  45%  701 aa  CLPL_STAAW RecName: Full=ATP-dependent Clp protease ATP-binding
  412::471     1e-05  45%  701 aa  CLPL_STAAS RecName: Full=ATP-dependent Clp protease ATP-binding
  412::471     1e-05  45%  701 aa  CLPL_STAAN RecName: Full=ATP-dependent Clp protease ATP-binding
  412::471     1e-05  45%  701 aa  CLPL_STAAM RecName: Full=ATP-dependent Clp protease ATP-binding
  412::471     1e-05  45%  701 aa  CLPL_STAAC RecName: Full=ATP-dependent Clp protease ATP-binding
  412::471     1e-05  45%  701 aa  CLPL_STAA8 RecName: Full=ATP-dependent Clp protease ATP-binding
  412::471     1e-05  45%  701 aa  CLPL_STAA3 RecName: Full=ATP-dependent Clp protease ATP-binding
  202::257     2e-05  41%  426 aa  PRS7_SPIOL RecName: Full=26S protease regulatory subunit 7;AltName:
  201::256     2e-05  41%  425 aa  PRS7_PRUPE RecName: Full=26S protease regulatory subunit 7;AltName:
  202::257     2e-05  41%  426 aa  PRS7_ORYSJ RecName: Full=26S protease regulatory subunit 7;AltName:
  202::257     2e-05  41%  426 aa  PRS7_ARATH RecName: Full=26S protease regulatory subunit 7;AltName:
  153::232     2e-05  36%  401 aa  PRS6A_ENCCU RecName: Full=26S protease regulatory subunit 6A;
  296::354     2e-05  41%  856 aa  NVL_HUMAN RecName: Full=Nuclear valosin-containing protein-like;   
  318::404     2e-05  33%  594 aa  FIGL1_CAEEL RecName: Full=Fidgetin-like protein 1;       
  566::639     2e-05  38%  857 aa  CLPB_VIBCH RecName: Full=Chaperone protein clpB;
  568::639     2e-05  38%  854 aa  CLPB_PSEPK RecName: Full=Chaperone protein clpB;
  689::766     2e-05  39% 1006 aa  CLPB_AQUAE RecName: Full=Chaperone protein clpB;
  567::641     2e-05  32%  874 aa  CLPB_AGRT5 RecName: Full=Chaperone protein clpB;
  485::574     2e-05  37%  758 aa  SPAST_DROYA RecName: Full=Spastin;         EC=3.6.4.3;
  504::593     2e-05  37%  777 aa  SPAST_DROWI RecName: Full=Spastin;         EC=3.6.4.3;
  496::585     2e-05  37%  769 aa  SPAST_DROVI RecName: Full=Spastin;         EC=3.6.4.3;
  485::574     2e-05  37%  758 aa  SPAST_DROSI RecName: Full=Spastin;         EC=3.6.4.3;
  485::574     2e-05  37%  758 aa  SPAST_DROSE RecName: Full=Spastin;         EC=3.6.4.3;
  485::574     2e-05  37%  758 aa  SPAST_DROME RecName: Full=Spastin;         EC=3.6.4.3;AltName:
  509::598     2e-05  37%  782 aa  SPAST_DROGR RecName: Full=Spastin;         EC=3.6.4.3;
  485::574     2e-05  37%  758 aa  SPAST_DROER RecName: Full=Spastin;         EC=3.6.4.3;
  594::649     2e-05  43%  794 aa  SEC18_CANAL RecName: Full=Vesicular-fusion protein SEC18;
  566::639     2e-05  34%  857 aa  CLPB_VIBVY RecName: Full=Chaperone protein clpB;
  566::639     2e-05  34%  857 aa  CLPB_VIBVU RecName: Full=Chaperone protein clpB;
  570::661     2e-05  37%  859 aa  CLPB_TREDE RecName: Full=Chaperone protein clpB;
  563::655     2e-05  37%  859 aa  CLPB_CAUCR RecName: Full=Chaperone protein clpB;
  567::667     2e-05  33%  879 aa  CLPB_BRAJA RecName: Full=Chaperone protein clpB;
  572::645     2e-05  37%  865 aa  CLPB_BORPE RecName: Full=Chaperone protein clpB;
  572::645     2e-05  37%  865 aa  CLPB_BORPA RecName: Full=Chaperone protein clpB;
  572::645     2e-05  37%  865 aa  CLPB_BORBR RecName: Full=Chaperone protein clpB;
  492::578     3e-05  37%  765 aa  SPAST_DROMO RecName: Full=Spastin;         EC=3.6.4.3;
  497::586     3e-05  37%  770 aa  SPAST_DROAN RecName: Full=Spastin;         EC=3.6.4.3;
  169::248     3e-05  36%  417 aa  PSMR_UNCMA RecName: Full=Proteasome-activating
  175::230     3e-05  36%  398 aa  PSMR_ARCFU RecName: Full=Proteasome-activating
  186::241     3e-05  38%  411 aa  PSMR1_HALSA RecName: Full=Proteasome-activating nucleotidase
  190::241     3e-05  38%  414 aa  PRS8_NAEFO RecName: Full=26S protease regulatory subunit 8
  215::265     3e-05  41%  434 aa  PRS6A_YEAST RecName: Full=26S protease regulatory subunit
  412::471     3e-05  45%  701 aa  CLPL_STAAR RecName: Full=ATP-dependent Clp protease ATP-binding
  412::471     3e-05  45%  702 aa  CLPL_STAAB RecName: Full=ATP-dependent Clp protease ATP-binding
  571::642     3e-05  32%  857 aa  CLPB_WOLSU RecName: Full=Chaperone protein clpB;
  570::643     3e-05  34%  859 aa  CLPB_NEIMB RecName: Full=Chaperone protein clpB;
  570::643     3e-05  34%  859 aa  CLPB_NEIMA RecName: Full=Chaperone protein clpB;
  515::601     4e-05  37%  788 aa  SPAST_DROPS RecName: Full=Spastin;         EC=3.6.4.3;
  515::601     4e-05  37%  788 aa  SPAST_DROPE RecName: Full=Spastin;         EC=3.6.4.3;
  180::237     4e-05  33%  407 aa  PSMR_METVS RecName: Full=Proteasome-activating
  187::242     4e-05  36%  412 aa  PSMR_METMJ RecName: Full=Proteasome-activating
  179::230     4e-05  40%  403 aa  PRS8_SCHPO RecName: Full=26S protease regulatory subunit 8
  157::239     4e-05  32%  403 aa  PRS6B_DICDI RecName: Full=26S protease regulatory subunit 6B
  219::269     4e-05  41%  438 aa  PRS6A_SCHPO RecName: Full=26S protease regulatory subunit 6A;
  171::222     4e-05  38%  393 aa  PRS10_DICDI RecName: Full=26S protease regulatory subunit
  295::353     4e-05  39%  855 aa  NVL_MOUSE RecName: Full=Nuclear valosin-containing protein-like;   
  563::621     4e-05  43%  911 aa  HS101_ARATH RecName: Full=Heat shock protein 101;
  257::312     4e-05  41%  688 aa  FTSH6_ARATH RecName: Full=Cell division protease ftsH homolog 6,
  540::623     4e-05  35%  854 aa  CLPC_CYACA RecName: Full=ATP-dependent Clp protease ATP-binding
  566::639     4e-05  35%  856 aa  CLPB_HAEDU RecName: Full=Chaperone protein clpB;
  576::645     4e-05  37%  872 aa  CLPB2_SYNY3 RecName: Full=Chaperone protein clpB 2;
  569::643     4e-05  38%  870 aa  CLPB1_STRAW RecName: Full=Chaperone protein clpB 1;
  321::379     4e-05  39%  761 aa  AFG3_YEAST RecName: Full=Mitochondrial respiratory chain complexes
  340::397     4e-05  41%  802 aa  AFG32_MOUSE RecName: Full=AFG3-like protein 2;         EC=3.4.24.-;
  341::398     4e-05  41%  797 aa  AFG32_HUMAN RecName: Full=AFG3-like protein 2;       
  342::399     4e-05  41%  805 aa  AFG32_BOVIN RecName: Full=AFG3-like protein 2;         EC=3.4.24.-;
  314::369     5e-05  45%  747 aa  YME1_YEAST RecName: Full=Protein YME1;         EC=3.4.24.-;AltName:
  309::381     5e-05  36%  795 aa  SPG7_HUMAN RecName: Full=Paraplegin;         EC=3.4.24.-;AltName:
  239::294     5e-05  41%  837 aa  RIX7_YEAST RecName: Full=Ribosome biogenesis ATPase RIX7;
  183::238     5e-05  36%  407 aa  PSMR2_HALSA RecName: Full=Proteasome-activating nucleotidase
  179::230     5e-05  38%  403 aa  PRS8_DICDI RecName: Full=26S protease regulatory subunit 8;AltName:
  165::222     5e-05  36%  389 aa  PRS10_SPETR RecName: Full=26S protease regulatory subunit
  165::222     5e-05  36%  389 aa  PRS10_MOUSE RecName: Full=26S protease regulatory subunit
  165::222     5e-05  36%  389 aa  PRS10_HUMAN RecName: Full=26S protease regulatory subunit
  165::222     5e-05  36%  389 aa  PRS10_BOVIN RecName: Full=26S protease regulatory subunit
  492::590     5e-05  35%  819 aa  CLPC_GUITH RecName: Full=ATP-dependent Clp protease ATP-binding
  407::487     5e-05  35%  705 aa  CLPB_TROWT RecName: Full=Chaperone protein clpB;
  401::481     5e-05  35%  699 aa  CLPB_TROW8 RecName: Full=Chaperone protein clpB;
  573::646     5e-05  34%  873 aa  CLPB_PLEBO RecName: Full=Chaperone protein clpB;
  569::660     5e-05  36%  867 aa  CLPB_LACLM RecName: Full=Chaperone protein clpB;
  569::660     5e-05  36%  867 aa  CLPB_LACLA RecName: Full=Chaperone protein clpB;
  448::553     5e-05  33%  758 aa  CLPA_ECOLI RecName: Full=ATP-dependent Clp protease ATP-binding
  448::553     5e-05  33%  758 aa  CLPA_ECOL6 RecName: Full=ATP-dependent Clp protease ATP-binding
  448::553     5e-05  33%  758 aa  CLPA_ECO57 RecName: Full=ATP-dependent Clp protease ATP-binding
  267::324     5e-05  40%  820 aa  CD48C_ARATH RecName: Full=Cell division control protein 48 homolog
  129::170     5e-05  43%  380 aa  ATD1A_DANRE RecName: Full=ATPase family AAA domain-containing
  342::381     7e-05  42%  744 aa  SPG7_RAT RecName: Full=Paraplegin;         EC=3.4.24.-;
  342::381     7e-05  42%  781 aa  SPG7_MOUSE RecName: Full=Paraplegin;         EC=3.4.24.-;
  505::591     7e-05  40%  778 aa  SPAST_ANOGA RecName: Full=Spastin;         EC=3.6.4.3;
  129::214     7e-05  35%  372 aa  PRS2_METTM RecName: Full=Putative 26S protease regulatory subunit
  220::277     7e-05  40%  652 aa  FTSH_STRR6 RecName: Full=Cell division protease ftsH homolog;      
  220::277     7e-05  40%  652 aa  FTSH_STRPN RecName: Full=Cell division protease ftsH homolog;      
  516::585     7e-05  40%  848 aa  CLPC_MYCTU RecName: Full=Probable ATP-dependent Clp protease
  516::585     7e-05  40%  848 aa  CLPC_MYCLE RecName: Full=Probable ATP-dependent Clp protease
  516::585     7e-05  40%  848 aa  CLPC_MYCBO RecName: Full=Probable ATP-dependent Clp protease
  564::665     7e-05  33%  858 aa  CLPB_RICFE RecName: Full=Chaperone protein clpB;
  564::665     7e-05  34%  858 aa  CLPB_RICBR RecName: Full=Chaperone protein clpB;
  570::644     7e-05  38%  863 aa  CLPB_NITEU RecName: Full=Chaperone protein clpB;
  567::659     7e-05  37%  848 aa  CLPB_MYCLE RecName: Full=Chaperone protein clpB;
  570::643     7e-05  37%  859 aa  CLPB_CHRVO RecName: Full=Chaperone protein clpB;
  573::662     7e-05  37%  871 aa  CLPB1_THEEB RecName: Full=Chaperone protein clpB 1;
  518::414     7e-05  33%  815 aa  CDC48_SCHPO RecName: Full=Cell division cycle protein 48;
    3::42      7e-05  40%  179 aa  AROK_LEPBL RecName: Full=Shikimate kinase;         Short=SK;     
    3::42      7e-05  40%  179 aa  AROK_LEPBJ RecName: Full=Shikimate kinase;         Short=SK;     
  333::390     7e-05  40%  789 aa  AFG31_MOUSE RecName: Full=AFG3-like protein 1;         EC=3.4.24.-;
  125::163     9e-05  46%  355 aa  YJNA_SCHPO RecName: Full=Uncharacterized AAA domain-containing
  204::259     9e-05  36%  430 aa  PSMR_METJA RecName: Full=Proteasome-activating
  199::254     9e-05  38%  418 aa  PRS6B_RAT RecName: Full=26S protease regulatory subunit 6B;AltName:
  199::254     9e-05  38%  418 aa  PRS6B_MOUSE RecName: Full=26S protease regulatory subunit
  199::254     9e-05  38%  418 aa  PRS6B_MACFA RecName: Full=26S protease regulatory subunit
  199::254     9e-05  38%  418 aa  PRS6B_HUMAN RecName: Full=26S protease regulatory subunit
  199::254     9e-05  38%  418 aa  PRS6B_BOVIN RecName: Full=26S protease regulatory subunit
  204::259     9e-05  36%  423 aa  PRS6A_SOLLC RecName: Full=26S protease regulatory subunit 6A
  210::265     9e-05  36%  429 aa  PRS6A_ORYSJ RecName: Full=26S protease regulatory subunit 6A
  205::260     9e-05  36%  424 aa  PRS6A_BRACM RecName: Full=26S protease regulatory subunit 6A
  185::240     9e-05  38%  404 aa  PR6AB_XENLA RecName: Full=26S protease regulatory subunit
  184::292     9e-05  33%  486 aa  KTNA1_SALSA RecName: Full=Katanin p60 ATPase-containing subunit A1;
  500::575     9e-05  33%  811 aa  HSP78_YEAST RecName: Full=Heat shock protein 78,
  575::666     9e-05  40%  908 aa  HS104_YEAST RecName: Full=Heat shock protein 104;AltName:
  570::661     9e-05  35%  878 aa  CLPB_TREPA RecName: Full=Chaperone protein clpB;
  569::642     9e-05  32%  862 aa  CLPB_RALSO RecName: Full=Chaperone protein clpB;
  577::646     9e-05  37%  864 aa  CLPB_PROMA RecName: Full=Chaperone protein clpB;
  567::638     9e-05  36%  855 aa  CLPB_PASMU RecName: Full=Chaperone protein clpB;
  569::660     9e-05  33%  852 aa  CLPB_COREF RecName: Full=Chaperone protein clpB;
  216::271     1e-04  38%  733 aa  Y1297_ARCFU RecName: Full=Cell division cycle protein 48 homolog
  174::229     1e-04  38%  399 aa  PSMR_PYRHO RecName: Full=Proteasome-activating
  174::229     1e-04  38%  399 aa  PSMR_PYRAB RecName: Full=Proteasome-activating
  180::237     1e-04  33%  407 aa  PSMR_METMP RecName: Full=Proteasome-activating
  193::250     1e-04  36%  420 aa  PSMR_METMA RecName: Full=Proteasome-activating
  180::237     1e-04  33%  407 aa  PSMR_METM7 RecName: Full=Proteasome-activating
  180::237     1e-04  33%  407 aa  PSMR_METM6 RecName: Full=Proteasome-activating
  180::237     1e-04  33%  407 aa  PSMR_METM5 RecName: Full=Proteasome-activating
  193::250     1e-04  36%  421 aa  PSMR_METAC RecName: Full=Proteasome-activating
  182::233     1e-04  37%  405 aa  PRS8_YEAST RecName: Full=26S protease regulatory subunit 8
  178::229     1e-04  37%  461 aa  PRS8_XENLA RecName: Full=26S protease regulatory subunit 8;AltName:
  183::234     1e-04  37%  406 aa  PRS8_RAT RecName: Full=26S protease regulatory subunit 8;AltName:
  183::234     1e-04  37%  406 aa  PRS8_PIG RecName: Full=26S protease regulatory subunit 8;AltName:
  183::234     1e-04  37%  406 aa  PRS8_MOUSE RecName: Full=26S protease regulatory subunit 8;AltName:
  183::234     1e-04  37%  406 aa  PRS8_HUMAN RecName: Full=26S protease regulatory subunit 8;AltName:
  183::234     1e-04  37%  406 aa  PRS8_BOVIN RecName: Full=26S protease regulatory subunit 8;AltName:
  149::249     1e-04  27%  413 aa  PRS6B_SOLTU RecName: Full=26S protease regulatory subunit 6B
  195::250     1e-04  38%  414 aa  PRS6B_CAEEL RecName: Full=Probable 26S protease regulatory subunit
  189::244     1e-04  36%  408 aa  PRS6B_ARATH RecName: Full=26S protease regulatory subunit 6B
  220::270     1e-04  39%  439 aa  PRS6A_RAT RecName: Full=26S protease regulatory subunit 6A;AltName:
  223::273     1e-04  39%  442 aa  PRS6A_MOUSE RecName: Full=26S protease regulatory subunit
  220::270     1e-04  39%  439 aa  PRS6A_HUMAN RecName: Full=26S protease regulatory subunit
  129::214     1e-04  34%  372 aa  PRS2_METTH RecName: Full=Putative 26S protease regulatory subunit
  184::232     1e-04  39%  406 aa  PRS10_CAEEL RecName: Full=Probable 26S protease regulatory subunit
  204::254     1e-04  39%  405 aa  PR6AA_XENLA RecName: Full=26S protease regulatory subunit
    4::46      1e-04  42%  315 aa  MIAA_THEYD RecName: Full=tRNA Delta(2)-isopentenylpyrophosphate
  368::423     1e-04  38%  822 aa  FTSH8_ORYSJ RecName: Full=Cell division protease ftsH homolog 8,
  353::408     1e-04  38%  802 aa  FTSH3_ORYSJ RecName: Full=Cell division protease ftsH homolog 3,
  422::492     1e-04  35%  677 aa  FIGL1_RAT RecName: Full=Fidgetin-like protein 1;       
  428::498     1e-04  35%  683 aa  FIGL1_MOUSE RecName: Full=Fidgetin-like protein 1;       
  561::665     1e-04  32%  858 aa  CLPB_RICTY RecName: Full=Chaperone protein clpB;
  565::645     1e-04  37%  865 aa  CLPB_GEOSL RecName: Full=Chaperone protein clpB;
  569::642     1e-04  37%  868 aa  CLPB_ENTFA RecName: Full=Chaperone protein clpB;
  569::660     1e-04  37%  852 aa  CLPB_CORGL RecName: Full=Chaperone protein clpB;
  102::167     1e-04  35%  361 aa  ATAD1_RAT RecName: Full=ATPase family AAA domain-containing protein
  102::167     1e-04  35%  361 aa  ATAD1_MOUSE RecName: Full=ATPase family AAA domain-containing
  102::167     1e-04  35%  361 aa  ATAD1_HUMAN RecName: Full=ATPase family AAA domain-containing
   25::67      2e-04  47%  263 aa  Y1445_STAAC RecName: Full=Uncharacterized protein SACOL1445;
   25::67      2e-04  47%  263 aa  Y1421_STAAR RecName: Full=Uncharacterized protein SAR1421;
   25::67      2e-04  47%  263 aa  Y1413_STAA8 RecName: Full=Uncharacterized protein SAOUHSC_01413;
   25::67      2e-04  47%  263 aa  Y1409_STAAM RecName: Full=Uncharacterized protein SAV1409;
   25::67      2e-04  47%  263 aa  Y1352_STAAS RecName: Full=Uncharacterized protein SAS1352;
   25::67      2e-04  47%  263 aa  Y1302_STAA3 RecName: Full=Uncharacterized protein SAUSA300_1302;
   25::67      2e-04  47%  263 aa  Y1299_STAAW RecName: Full=Uncharacterized protein MW1299;
   25::67      2e-04  47%  263 aa  Y1265_STAAB RecName: Full=Uncharacterized protein SAB1265c;
   25::67      2e-04  47%  263 aa  Y1241_STAAN RecName: Full=Uncharacterized protein SA1241;
  381::436     2e-04  39%  825 aa  RCA1_YEAST RecName: Full=Mitochondrial respiratory chain complexes
  196::251     2e-04  38%  415 aa  PRS6B_MANSE RecName: Full=26S protease regulatory subunit
  200::255     2e-04  34%  423 aa  PRS6B_ASPNG RecName: Full=26S protease regulatory subunit 6B
  189::297     2e-04  36%  491 aa  KTNA1_RAT RecName: Full=Katanin p60 ATPase-containing subunit A1;  
  189::297     2e-04  36%  491 aa  KTNA1_MOUSE RecName: Full=Katanin p60 ATPase-containing subunit A1;
  189::297     2e-04  36%  491 aa  KTNA1_MACFA RecName: Full=Katanin p60 ATPase-containing subunit A1;
  189::297     2e-04  36%  491 aa  KTNA1_HUMAN RecName: Full=Katanin p60 ATPase-containing subunit A1;
  190::298     2e-04  36%  492 aa  KTNA1_CHICK RecName: Full=Katanin p60 ATPase-containing subunit A1;
  360::415     2e-04  38%  813 aa  FTSHA_ARATH RecName: Full=Cell division protease ftsH homolog 10,
  466::525     2e-04  41%  763 aa  CLPL_LACLA RecName: Full=ATP-dependent Clp protease ATP-binding
  566::639     2e-04  34%  857 aa  CLPB_VIBPA RecName: Full=Chaperone protein clpB;
  567::642     2e-04  30%  729 aa  CLPB_PROFR RecName: Full=Chaperone protein clpB;Flags: Fragment;
  171::226     2e-04  36%  396 aa  PSMR_PYRFU RecName: Full=Proteasome-activating
  230::281     2e-04  37%  453 aa  PRS8_ENCCU RecName: Full=26S protease regulatory subunit 8 homolog;
  200::250     2e-04  37%  419 aa  PRS6A_ARATH RecName: Full=26S protease regulatory subunit 6A
  219::274     2e-04  34%  440 aa  PRS4_RAT RecName: Full=26S protease regulatory subunit 4;AltName:
  219::274     2e-04  34%  440 aa  PRS4_MOUSE RecName: Full=26S protease regulatory subunit 4;AltName:
  219::274     2e-04  34%  440 aa  PRS4_HUMAN RecName: Full=26S protease regulatory subunit 4;AltName:
  218::273     2e-04  34%  439 aa  PRS4_DROME RecName: Full=26S protease regulatory subunit 4;AltName:
  219::274     2e-04  34%  440 aa  PRS4_CHICK RecName: Full=26S protease regulatory subunit 4;AltName:
  117::158     2e-04  38%  342 aa  MSP1_CAEEL RecName: Full=Protein MSP1 homolog;
  355::397     2e-04  40%  809 aa  FTSH3_ARATH RecName: Full=Cell division protease ftsH homolog 3,
  434::489     2e-04  39%  674 aa  FIGL1_HUMAN RecName: Full=Fidgetin-like protein 1;       
  331::417     3e-04  33%  603 aa  SPAST_XENTR RecName: Full=Spastin;         EC=3.6.4.3;
  328::414     3e-04  33%  600 aa  SPAST_XENLA RecName: Full=Spastin;         EC=3.6.4.3;
  344::430     3e-04  33%  616 aa  SPAST_HUMAN RecName: Full=Spastin;         EC=3.6.4.3;
   36::118     3e-04  33%  354 aa  RUVB_BIFLO RecName: Full=Holliday junction ATP-dependent DNA
   36::118     3e-04  33%  354 aa  RUVB_BIFLI RecName: Full=Holliday junction ATP-dependent DNA
   36::118     3e-04  33%  348 aa  RUVB_BIFLD RecName: Full=Holliday junction ATP-dependent DNA
  206::261     3e-04  34%  428 aa  PRS6B_YEAST RecName: Full=26S protease regulatory subunit 6B
  168::223     3e-04  34%  387 aa  PRS6B_ENCCU RecName: Full=26S protease regulatory subunit 6B
  166::217     3e-04  38%  388 aa  PRS10_SCHPO RecName: Full=Probable 26S protease subunit rpt4;
  190::298     3e-04  34%  492 aa  KTNA1_XENTR RecName: Full=Katanin p60 ATPase-containing subunit A1;
  186::294     3e-04  34%  486 aa  KTNA1_XENLA RecName: Full=Katanin p60 ATPase-containing subunit;   
  530::583     3e-04  39%  845 aa  CLPC_CHLPN RecName: Full=Probable ATP-dependent Clp protease
  561::665     3e-04  33%  858 aa  CLPB_RICPR RecName: Full=Chaperone protein clpB;
  564::665     3e-04  33%  857 aa  CLPB_RICCN RecName: Full=Chaperone protein clpB;
  567::641     3e-04  37%  848 aa  CLPB_MYCTU RecName: Full=Chaperone protein clpB;
  567::641     3e-04  37%  848 aa  CLPB_MYCBO RecName: Full=Chaperone protein clpB;
  577::646     3e-04  38%  866 aa  CLPB_CLOPE RecName: Full=Chaperone protein clpB;
  570::649     3e-04  38%  864 aa  CLPB_CHLCV RecName: Full=Chaperone protein clpB;
  574::647     3e-04  33%  879 aa  CLPB2_STRAW RecName: Full=Chaperone protein clpB 2;
  576::645     3e-04  36%  872 aa  CLPB2_ANASP RecName: Full=Chaperone protein clpB 2;
  130::171     3e-04  43%  362 aa  ATD1B_DANRE RecName: Full=ATPase family AAA domain-containing
   74::93      3e-04  75%  351 aa  ADPR_RHOER RecName: Full=ATP-dependent protease ATP-binding
  765::822     3e-04  31% 1260 aa  YCX1_OSTTA RecName: Full=Uncharacterized protein
  208::263     3e-04  36%  779 aa  YB7A_SCHPO RecName: Full=Uncharacterized AAA domain-containing
  486::545     3e-04  36%  903 aa  Y1156_METJA RecName: Full=Cell division cycle protein 48 homolog
  309::395     3e-04  33%  581 aa  SPAST_RAT RecName: Full=Spastin;         EC=3.6.4.3;
  341::427     3e-04  33%  613 aa  SPAST_PIG RecName: Full=Spastin;         EC=3.6.4.3;Flags:
  342::428     3e-04  33%  614 aa  SPAST_MOUSE RecName: Full=Spastin;         EC=3.6.4.3;
  297::383     3e-04  33%  570 aa  SPAST_DANRE RecName: Full=Spastin;         EC=3.6.4.3;
  341::427     3e-04  33%  613 aa  SPAST_CHICK RecName: Full=Spastin;         EC=3.6.4.3;
  180::267     3e-04  37%  454 aa  SPAST_BRUMA RecName: Full=Probable spastin homolog Bm1_53365;      
  342::428     3e-04  33%  614 aa  SPAST_BOVIN RecName: Full=Spastin;         EC=3.6.4.3;
  173::228     3e-04  36%  398 aa  PSMR_THEON RecName: Full=Proteasome-activating
  250::306     3e-04  35%  867 aa  NVL_DICDI RecName: Full=Putative ribosome biogenesis ATPase
  184::292     3e-04  35%  485 aa  KTNA1_DANRE RecName: Full=Katanin p60 ATPase-containing subunit A1;
  495::549     3e-04  40%  812 aa  HSP78_CANAL RecName: Full=Heat shock protein 78,
  527::564     3e-04  42% 1008 aa  FTSHC_ARATH RecName: Full=Cell division protease ftsH homolog 12,
  573::648     3e-04  36%  860 aa  CLPB_PROMP RecName: Full=Chaperone protein clpB;
  568::625     3e-04  40%  866 aa  CLPB_LISMF RecName: Full=Chaperone protein clpB;
  566::655     3e-04  40%  862 aa  CLPB_BACTN RecName: Full=Chaperone protein clpB;
  522::576     3e-04  38%  835 aa  CDC48_YEAST RecName: Full=Cell division control protein 48;
  340::439     4e-04  33%  542 aa  SPAST_CAEBR RecName: Full=Probable spastin homolog spas-1;       
  246::301     4e-04  41%  780 aa  SAV_SULAC RecName: Full=Protein SAV;
  179::217     4e-04  38%  402 aa  PRS8_MANSE RecName: Full=26S protease regulatory subunit 8;AltName:
  182::220     4e-04  38%  405 aa  PRS8_DROME RecName: Full=26S protease regulatory subunit 8;
  168::223     4e-04  34%  389 aa  PRS6B_SCHPO RecName: Full=26S protease regulatory subunit 6B
   35::74      4e-04  45%  342 aa  MIAA_CHLCV RecName: Full=tRNA Delta(2)-isopentenylpyrophosphate
    5::52      4e-04  38%  307 aa  MIAA2_AZOPC RecName: Full=tRNA Delta(2)-isopentenylpyrophosphate
  214::322     4e-04  32%  516 aa  KTNA1_STRPU RecName: Full=Katanin p60 ATPase-containing subunit;   
  989::1047    4e-04  37% 1720 aa  FTSH_CHLVU RecName: Full=Cell division protease ftsH homolog;
  416::471     4e-04  39%  656 aa  FIGL1_XENTR RecName: Full=Fidgetin-like protein 1;       
  415::470     4e-04  39%  655 aa  FIGL1_XENLA RecName: Full=Fidgetin-like protein 1;       
  568::641     4e-04  32%  855 aa  CLPB_BDEBA RecName: Full=Chaperone protein clpB;
  279::400     6e-04  33%  809 aa  TERA1_CAEEL RecName: Full=Transitional endoplasmic reticulum ATPase
  241::327     6e-04  36%  512 aa  SPAST_CAEEL RecName: Full=Probable spastin homolog spas-1;       
  172::227     6e-04  34%  397 aa  PSMR_THEGJ RecName: Full=Proteasome-activating
  172::227     6e-04  34%  397 aa  PSMR_PYRKO RecName: Full=Proteasome-activating
  126::167     6e-04  38%  362 aa  MSP1_YEAST RecName: Full=Protein MSP1;AltName: Full=TAT-binding
   35::74      6e-04  45%  342 aa  MIAA_CHLAB RecName: Full=tRNA Delta(2)-isopentenylpyrophosphate
  188::296     6e-04  31%  490 aa  KATL1_SORAR RecName: Full=Katanin p60 ATPase-containing subunit
  186::294     6e-04  31%  488 aa  KATL1_RAT RecName: Full=Katanin p60 ATPase-containing subunit
  188::296     6e-04  31%  490 aa  KATL1_RABIT RecName: Full=Katanin p60 ATPase-containing subunit
  188::296     6e-04  31%  490 aa  KATL1_PAPAN RecName: Full=Katanin p60 ATPase-containing subunit
  186::294     6e-04  31%  488 aa  KATL1_MOUSE RecName: Full=Katanin p60 ATPase-containing subunit
  188::296     6e-04  31%  490 aa  KATL1_HUMAN RecName: Full=Katanin p60 ATPase-containing subunit
  597::687     6e-04  36%  927 aa  HSP98_NEUCR RecName: Full=Heat shock protein hsp98;AltName:
  516::604     6e-04  33%  885 aa  CLPC_ODOSI RecName: Full=ATP-dependent Clp protease ATP-binding
  576::645     6e-04  35%  865 aa  CLPB_CLOTE RecName: Full=Chaperone protein clpB;
  570::649     6e-04  36%  866 aa  CLPB_CHLPN RecName: Full=Chaperone protein clpB;
  938::1023    6e-04  29% 1229 aa  CDAT_PLAF7 RecName: Full=Putative cell division cycle ATPase;
   12::44      6e-04  42%  188 aa  AROK_RHORT RecName: Full=Shikimate kinase;         Short=SK;     
   64::123     8e-04  35%  362 aa  RUVB_BIFAA RecName: Full=Holliday junction ATP-dependent DNA
    1::51      8e-04  39%  308 aa  MIAA_SHEB8 RecName: Full=tRNA Delta(2)-isopentenylpyrophosphate
    1::51      8e-04  39%  308 aa  MIAA_SHEB2 RecName: Full=tRNA Delta(2)-isopentenylpyrophosphate
    5::47      8e-04  40%  308 aa  MIAA_LACGA RecName: Full=tRNA Delta(2)-isopentenylpyrophosphate
  630::791     8e-04  29% 1067 aa  LONM_SCHPO RecName: Full=Putative Lon protease homolog,
  260::346     8e-04  36%  542 aa  KATL2_XENTR RecName: Full=Katanin p60 ATPase-containing subunit
  260::346     8e-04  36%  505 aa  KATL2_XENLA RecName: Full=Katanin p60 ATPase-containing subunit
  242::296     8e-04  38%  490 aa  KATL1_OTOGA RecName: Full=Katanin p60 ATPase-containing subunit
  240::294     8e-04  38%  488 aa  KATL1_DANRE RecName: Full=Katanin p60 ATPase-containing subunit
  362::452     8e-04  34%  806 aa  FTSHB_ARATH RecName: Full=Cell division protease ftsH homolog 11,
  568::637     8e-04  34%  860 aa  CLPB_STRMU RecName: Full=Chaperone protein clpB;
  601::658     8e-04  45%  849 aa  CLPB_CORDI RecName: Full=Chaperone protein clpB;
    1::51      0.001  37%  308 aa  MIAA_SHEON RecName: Full=tRNA Delta(2)-isopentenylpyrophosphate
    7::46      0.001  45%  314 aa  MIAA_CHLTR RecName: Full=tRNA Delta(2)-isopentenylpyrophosphate
   32::71      0.001  45%  339 aa  MIAA_CHLTB RecName: Full=tRNA Delta(2)-isopentenylpyrophosphate
   32::71      0.001  45%  339 aa  MIAA_CHLTA RecName: Full=tRNA Delta(2)-isopentenylpyrophosphate
   32::71      0.001  45%  339 aa  MIAA_CHLT2 RecName: Full=tRNA Delta(2)-isopentenylpyrophosphate
    7::46      0.001  45%  314 aa  MIAA_CHLMU RecName: Full=tRNA Delta(2)-isopentenylpyrophosphate
   28::72      0.001  42%  493 aa  LONH2_THEAC RecName: Full=Putative protease La homolog type 2;   
  260::318     0.001  34%  709 aa  FTSH_MYCPN RecName: Full=Cell division protease ftsH homolog;      
  263::321     0.001  34%  702 aa  FTSH_MYCGE RecName: Full=Cell division protease ftsH homolog;      
  361::418     0.001  38%  784 aa  FTSH9_ORYSJ RecName: Full=Cell division protease ftsH homolog 9,
  577::664     0.001  35%  872 aa  CLPB_GLOVI RecName: Full=Chaperone protein clpB;
  575::622     0.001  44%  880 aa  CLPB1_ANASP RecName: Full=Chaperone protein clpB 1;
  512::570     0.001  41%  780 aa  CDC48_ENCCU RecName: Full=Cell division control protein 48;
    6::44      0.001  44%  180 aa  AROK_XANCP RecName: Full=Shikimate kinase;         Short=SK;     
    6::44      0.001  44%  180 aa  AROK_XANC8 RecName: Full=Shikimate kinase;         Short=SK;     
   71::176     3e-19  44%  417 aa  CLPX_CAMJE RecName: Full=ATP-dependent Clp protease ATP-binding(query 5->108)
   76::199     1e-17  40%  446 aa  CLPX_HELPY RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   57::161     2e-18  42%  403 aa  CLPX_DEIRA RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   57::165     2e-21  43%  431 aa  CLPX_CLONN RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   62::166     2e-22  45%  421 aa  CLPX_METFK RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->106)
   64::168     5e-21  46%  416 aa  CLPX_LEUMM RecName: Full=ATP-dependent Clp protease ATP-binding(query 6->108)
   61::169     2e-20  42%  414 aa  CLPX_BACTN RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::171     2e-22  44%  430 aa  CLPX_KINRD RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   71::175     1e-18  41%  423 aa  CLPX_TROWT RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   71::175     1e-18  41%  423 aa  CLPX_TROW8 RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   58::171     4e-21  44%  426 aa  CLPX_MYCVP RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::171     5e-21  44%  426 aa  CLPX_MYCGI RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   65::167     3e-20  43%  424 aa  CLPX_SYMTH RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   60::164     2e-19  43%  406 aa  CLPX_DEIGD RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   64::171     1e-21  45%  420 aa  CLPX_LEPBL RecName: Full=ATP-dependent Clp protease ATP-binding(query 2->108)
   64::171     1e-21  45%  420 aa  CLPX_LEPBJ RecName: Full=ATP-dependent Clp protease ATP-binding(query 2->108)
   58::171     2e-21  44%  426 aa  CLPX_MYCTU RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::171     2e-21  44%  426 aa  CLPX_MYCTA RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::171     8e-22  44%  426 aa  CLPX_MYCS2 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::171     2e-21  44%  426 aa  CLPX_MYCBT RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::171     2e-21  44%  426 aa  CLPX_MYCBP RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::171     2e-21  44%  426 aa  CLPX_MYCBO RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::171     1e-21  44%  426 aa  CLPX_MYCA9 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   59::180     1e-19  45%  432 aa  CLPX_MICLC RecName: Full=ATP-dependent Clp protease ATP-binding(query 2->108)
   57::157     6e-15  38%  399 aa  CLPX_HYDS0 RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->106)
   62::170     5e-21  43%  415 aa  CLPX_BACFR RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   62::170     5e-21  43%  415 aa  CLPX_BACFN RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   65::178     1e-18  43%  426 aa  CLPX_HELHP RecName: Full=ATP-dependent Clp protease ATP-binding(query 6->108)
   56::165     2e-18  42%  412 aa  CLPX_AQUAE RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->106)
   65::172     4e-21  46%  422 aa  CLPX_CORK4 RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   64::169     9e-21  42%  423 aa  CLPX_SPHAL RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   58::171     1e-21  44%  426 aa  CLPX_NOCFA RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::171     3e-21  44%  426 aa  CLPX_MYCPA RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::171     3e-21  44%  426 aa  CLPX_MYCA1 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   65::204     2e-17  46%  472 aa  CLPX_BIFLO RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   65::170     2e-21  42%  424 aa  CLPX_BART1 RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   58::171     9e-21  44%  426 aa  CLPX_MYCLE RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::171     9e-21  44%  426 aa  CLPX_MYCLB RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::171     5e-21  44%  426 aa  CLPX_MYCUA RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   65::170     2e-20  42%  423 aa  CLPX_MARMM RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   64::171     1e-21  44%  420 aa  CLPX_LEPIN RecName: Full=ATP-dependent Clp protease ATP-binding(query 2->108)
   64::171     1e-21  44%  420 aa  CLPX_LEPIC RecName: Full=ATP-dependent Clp protease ATP-binding(query 2->108)
   60::168     8e-22  46%  416 aa  CLPX_LACRD RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   60::169     9e-21  47%  418 aa  CLPX_LACBA RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   64::172     1e-18  41%  430 aa  CLPX_FRASN RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   60::171     2e-19  40%  428 aa  CLPX_FRASC RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   58::171     6e-22  44%  424 aa  CLPX_BEUC1 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   63::169     3e-20  44%  436 aa  CLPX_ACIAD RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   58::168     5e-22  44%  409 aa  CLPX_STRU0 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::168     4e-21  42%  409 aa  CLPX_STRGC RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   65::170     6e-22  43%  424 aa  CLPX_OCHA4 RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   58::171     1e-21  44%  426 aa  CLPX_MYCMM RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   80::188     1e-19  42%  439 aa  CLPX_CHLP8 RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   58::171     5e-21  44%  426 aa  CLPX_RHOSR RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::171     5e-21  44%  426 aa  CLPX_RHOOB RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   65::170     2e-21  42%  424 aa  CLPX_BARQU RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   60::170     5e-22  44%  427 aa  CLPX_ACIC1 RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   60::172     6e-20  42%  428 aa  CLPX_STRAW RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   58::171     2e-21  44%  426 aa  CLPX_RHOE4 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   60::174     1e-20  45%  426 aa  CLPX_NOCSJ RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   58::166     2e-19  41%  421 aa  CLPX_BREBN RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   63::167     2e-19  44%  408 aa  CLPX_STRTD RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   63::167     2e-19  44%  408 aa  CLPX_STRT2 RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   63::167     2e-19  44%  408 aa  CLPX_STRT1 RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   60::172     6e-20  42%  432 aa  CLPX_STRGG RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   58::171     6e-22  44%  426 aa  CLPX_MYCSS RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::171     6e-22  44%  426 aa  CLPX_MYCSK RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::171     6e-22  44%  426 aa  CLPX_MYCSJ RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   64::168     5e-21  47%  415 aa  CLPX_LEUCK RecName: Full=ATP-dependent Clp protease ATP-binding(query 6->108)
   63::166     9e-21  44%  432 aa  CLPX_CLOAB RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   65::170     2e-21  42%  424 aa  CLPX_BARHE RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   63::168     3e-20  44%  437 aa  CLPX_ACIBY RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   63::168     3e-20  44%  437 aa  CLPX_ACIBT RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   63::168     3e-20  44%  437 aa  CLPX_ACIBS RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   63::168     3e-20  44%  437 aa  CLPX_ACIBC RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   63::168     3e-20  44%  437 aa  CLPX_ACIB5 RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   63::168     3e-20  44%  437 aa  CLPX_ACIB3 RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   58::168     3e-20  41%  409 aa  CLPX_STRSV RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   60::172     6e-20  42%  428 aa  CLPX_STRCO RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   58::167     5e-18  41%  420 aa  CLPX_STAAW RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::167     5e-18  41%  420 aa  CLPX_STAAS RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::167     2e-17  40%  420 aa  CLPX_STAAB RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   60::175     1e-18  40%  432 aa  CLPX_FRAAA RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   58::167     5e-18  41%  420 aa  CLPX_STAAT RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::167     2e-17  40%  420 aa  CLPX_STAAR RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::167     5e-18  41%  420 aa  CLPX_STAAN RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::167     5e-18  41%  420 aa  CLPX_STAAM RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::167     5e-18  41%  420 aa  CLPX_STAAE RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::167     5e-18  41%  420 aa  CLPX_STAAC RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::167     5e-18  41%  420 aa  CLPX_STAA9 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::167     5e-18  41%  420 aa  CLPX_STAA8 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::167     5e-18  41%  420 aa  CLPX_STAA3 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::167     5e-18  41%  420 aa  CLPX_STAA2 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::167     5e-18  41%  420 aa  CLPX_STAA1 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::171     1e-23  47%  421 aa  CLPX_LACPL RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   60::166     1e-21  43%  424 aa  CLPX_LACH4 RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   64::170     1e-19  42%  419 aa  CLPX_DESPS RecName: Full=ATP-dependent Clp protease ATP-binding(query 5->108)
   57::165     7e-21  43%  429 aa  CLPX_CLOBL RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   57::165     7e-21  43%  429 aa  CLPX_CLOBK RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   57::165     7e-21  43%  429 aa  CLPX_CLOBJ RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   57::165     7e-21  43%  429 aa  CLPX_CLOBH RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   57::165     7e-21  43%  429 aa  CLPX_CLOB6 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   57::165     7e-21  43%  429 aa  CLPX_CLOB1 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   65::170     2e-22  44%  424 aa  CLPX_BRUSU RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   65::170     2e-22  44%  424 aa  CLPX_BRUSI RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   64::168     1e-22  42%  433 aa  CLPX_CLOPH RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   65::170     2e-22  44%  427 aa  CLPX_BRUO2 RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   65::170     2e-22  44%  424 aa  CLPX_BRUME RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   65::170     2e-22  44%  424 aa  CLPX_BRUMB RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   65::170     2e-22  44%  424 aa  CLPX_BRUC2 RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   65::170     2e-22  44%  424 aa  CLPX_BRUAB RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   65::170     2e-22  44%  424 aa  CLPX_BRUA2 RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   65::170     5e-22  43%  424 aa  CLPX_BRUA1 RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   68::168     2e-20  46%  425 aa  CLPX_THISH RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->106)
   66::168     3e-20  43%  435 aa  CLPX_CLOPS RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   66::168     3e-20  43%  435 aa  CLPX_CLOPE RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   66::168     3e-20  43%  435 aa  CLPX_CLOP1 RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   60::167     2e-21  42%  433 aa  CLPX_CALS8 RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   67::169     3e-21  47%  426 aa  CLPX_VIBCM RecName: Full=ATP-dependent Clp protease ATP-binding(query 6->106)
   67::169     3e-21  47%  426 aa  CLPX_VIBCH RecName: Full=ATP-dependent Clp protease ATP-binding(query 6->106)
   67::169     3e-21  47%  426 aa  CLPX_VIBC3 RecName: Full=ATP-dependent Clp protease ATP-binding(query 6->106)
   58::169     2e-20  42%  410 aa  CLPX_STRPS RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::169     2e-20  42%  410 aa  CLPX_STRPJ RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   57::165     7e-21  43%  429 aa  CLPX_CLOBM RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::169     2e-20  42%  410 aa  CLPX_STRZP RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::169     2e-20  42%  410 aa  CLPX_STRZJ RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::169     2e-20  42%  410 aa  CLPX_STRR6 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::169     2e-20  42%  410 aa  CLPX_STRPN RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::169     2e-20  42%  410 aa  CLPX_STRP7 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::169     2e-20  42%  410 aa  CLPX_STRP4 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::169     2e-20  42%  410 aa  CLPX_STRP2 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::168     2e-20  42%  409 aa  CLPX_STREM RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   64::167     3e-20  44%  408 aa  CLPX_STRA5 RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   64::167     3e-20  44%  408 aa  CLPX_STRA3 RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   64::167     3e-20  44%  408 aa  CLPX_STRA1 RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   59::167     4e-18  41%  420 aa  CLPX_STAES RecName: Full=ATP-dependent Clp protease ATP-binding(query 2->108)
   59::167     4e-18  41%  420 aa  CLPX_STAEQ RecName: Full=ATP-dependent Clp protease ATP-binding(query 2->108)
   64::166     8e-19  41%  421 aa  CLPX_EXIS2 RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   63::165     4e-20  43%  429 aa  CLPX_CLOB8 RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   58::162     3e-20  40%  415 aa  CLPX_ANAPZ RecName: Full=ATP-dependent Clp protease ATP-binding(query 5->108)
   58::168     1e-20  42%  409 aa  CLPX_STRE4 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   60::175     1e-19  42%  427 aa  CLPX_RENSM RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   58::168     1e-20  42%  409 aa  CLPX_STRS7 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   59::171     1e-20  44%  418 aa  CLPX_PEDPA RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   67::171     6e-23  44%  422 aa  CLPX_EUBE2 RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   71::166     1e-18  42%  423 aa  CLPX_BACSK RecName: Full=ATP-dependent Clp protease ATP-binding(query 14->108)
   59::167     2e-18  41%  420 aa  CLPX_STAHJ RecName: Full=ATP-dependent Clp protease ATP-binding(query 2->108)
   78::187     3e-21  42%  438 aa  CLPX_PELPB RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   59::167     4e-22  44%  420 aa  CLPX_NATTJ RecName: Full=ATP-dependent Clp protease ATP-binding(query 2->108)
   63::168     9e-23  46%  421 aa  CLPX_MAGSA RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   64::166     9e-21  44%  421 aa  CLPX_GEOTN RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   65::169     1e-20  41%  423 aa  CLPX_EUBR3 RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   81::193     9e-21  43%  448 aa  CLPX_CYAP8 RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   67::169     2e-20  46%  426 aa  CLPX_VIBVY RecName: Full=ATP-dependent Clp protease ATP-binding(query 6->106)
   67::169     2e-20  46%  426 aa  CLPX_VIBVU RecName: Full=ATP-dependent Clp protease ATP-binding(query 6->106)
   58::168     1e-20  42%  410 aa  CLPX_STRMU RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   63::168     2e-20  44%  423 aa  CLPX_METS4 RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   65::167     2e-21  44%  420 aa  CLPX_HELMI RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   64::166     9e-21  44%  421 aa  CLPX_GEOKA RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
  162::352     1e-15  47%  421 aa  CLPX_CHLCV RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->381)
  162::352     3e-15  46%  421 aa  CLPX_CHLAB RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->381)
   63::168     3e-21  46%  422 aa  CLPX_XANP2 RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   66::171     5e-21  41%  425 aa  CLPX_RHISN RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
  162::389     1e-15  39%  421 aa  CLPX_CHLFF RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->423)
   64::166     5e-19  42%  424 aa  CLPX_BACHD RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   60::177     2e-19  42%  429 aa  CLPX_ARTS2 RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   60::177     2e-19  42%  426 aa  CLPX_ARTCA RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   57::165     2e-21  44%  420 aa  CLPX_ALKMQ RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   71::173     4e-19  41%  426 aa  CLPX_WOLTR RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   62::167     4e-21  44%  418 aa  CLPX_ACICJ RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   66::171     5e-21  41%  425 aa  CLPX_SINMW RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   64::168     8e-19  42%  426 aa  CLPX_SHEFN RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->106)
  158::387     1e-21  42%  424 aa  CLPX_RHOPT RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->425)
  158::387     1e-21  42%  424 aa  CLPX_RHOPA RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->425)
  158::387     1e-21  43%  424 aa  CLPX_RHOP2 RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->425)
   66::171     5e-21  41%  425 aa  CLPX_RHIME RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   63::168     2e-20  44%  423 aa  CLPX_METNO RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   61::166     3e-19  41%  422 aa  CLPX_EXISA RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   80::188     4e-19  41%  439 aa  CLPX_CHLTE RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
  110::170     1e-13  49%  429 aa  CLPX_SALAI RecName: Full=ATP-dependent Clp protease ATP-binding(query 48->108)
   66::171     1e-21  42%  425 aa  CLPX_RHILW RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   66::171     1e-21  42%  425 aa  CLPX_RHIL3 RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   66::171     1e-21  42%  425 aa  CLPX_RHIEC RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   66::171     1e-21  42%  425 aa  CLPX_RHIE6 RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   63::168     9e-21  44%  421 aa  CLPX_METSB RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   62::167     2e-21  47%  419 aa  CLPX_GLUDA RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
  158::385     2e-22  45%  420 aa  CLPX_CAUSK RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->423)
  158::387     1e-21  43%  424 aa  CLPX_BRASO RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->425)
  158::387     5e-22  44%  424 aa  CLPX_BRASB RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->425)
   77::188     4e-22  48%  443 aa  CLPX_SYNP2 RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   66::168     7e-21  44%  411 aa  CLPX_PORGI RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   66::168     7e-21  44%  411 aa  CLPX_PORG3 RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   67::196     1e-18  47%  453 aa  CLPX_POLSQ RecName: Full=ATP-dependent Clp protease ATP-binding(query 6->106)
   59::166     2e-19  43%  411 aa  CLPX_LACLA RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   64::167     2e-19  44%  421 aa  CLPX_LACGA RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   71::180     5e-22  45%  431 aa  CLPX_CHLT3 RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   63::168     2e-20  43%  421 aa  CLPX_BEII9 RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   57::165     7e-16  38%  425 aa  CLPX_THETN RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   54::160     6e-22  45%  406 aa  CLPX_THEMA RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   69::169     5e-21  44%  429 aa  CLPX_STRM5 RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->106)
   67::196     8e-19  47%  453 aa  CLPX_POLNS RecName: Full=ATP-dependent Clp protease ATP-binding(query 6->106)
  157::386     6e-22  45%  420 aa  CLPX_MAGSM RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->423)
   58::166     2e-21  42%  416 aa  CLPX_HALOH RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   67::177     9e-21  45%  430 aa  CLPX_CORDI RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   58::166     9e-21  41%  431 aa  CLPX_CLOCE RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   63::168     1e-21  43%  420 aa  CLPX_CAUCR RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   63::168     1e-21  43%  420 aa  CLPX_CAUCN RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   58::168     1e-20  41%  409 aa  CLPX_STRPM RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::168     1e-20  41%  409 aa  CLPX_STRPF RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::168     1e-20  41%  409 aa  CLPX_STRPD RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::168     1e-20  41%  409 aa  CLPX_STRP8 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::168     1e-20  41%  409 aa  CLPX_STRP3 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::168     1e-20  41%  409 aa  CLPX_STRP1 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
  110::170     1e-13  49%  429 aa  CLPX_SALTO RecName: Full=ATP-dependent Clp protease ATP-binding(query 48->108)
  106::387     2e-21  37%  424 aa  CLPX_RHOPB RecName: Full=ATP-dependent Clp protease ATP-binding(query 188->425)
  106::387     2e-21  37%  424 aa  CLPX_RHOP5 RecName: Full=ATP-dependent Clp protease ATP-binding(query 188->425)
  157::384     1e-21  45%  421 aa  CLPX_PARDP RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->423)
   94::401     5e-22  38%  419 aa  CLPX_MOOTA RecName: Full=ATP-dependent Clp protease ATP-binding(query 173->440)
   59::166     1e-19  43%  411 aa  CLPX_LACLS RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
  181::409     3e-20  43%  445 aa  CLPX_ANASP RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->423)
   58::168     1e-20  41%  409 aa  CLPX_STRPZ RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::168     1e-20  41%  409 aa  CLPX_STRPC RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::168     1e-20  41%  409 aa  CLPX_STRPB RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   63::167     1e-21  42%  421 aa  CLPX_RHOSK RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   63::167     1e-21  42%  421 aa  CLPX_RHOS4 RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   63::167     1e-21  42%  421 aa  CLPX_RHOS1 RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
  106::387     2e-21  37%  424 aa  CLPX_NITWN RecName: Full=ATP-dependent Clp protease ATP-binding(query 188->425)
  106::387     1e-21  38%  424 aa  CLPX_NITHX RecName: Full=ATP-dependent Clp protease ATP-binding(query 188->425)
   61::166     2e-21  44%  423 aa  CLPX_LYSSC RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   60::167     4e-21  43%  419 aa  CLPX_LISW6 RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   66::172     2e-20  47%  426 aa  CLPX_LEPBP RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   66::172     2e-20  47%  426 aa  CLPX_LEPBA RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   59::166     1e-19  43%  411 aa  CLPX_LACLM RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   66::175     2e-19  44%  426 aa  CLPX_CLAMS RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
  158::387     6e-22  44%  423 aa  CLPX_BRAJA RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->425)
   66::171     3e-21  42%  425 aa  CLPX_AGRT5 RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   58::168     1e-20  41%  409 aa  CLPX_STRPG RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::168     1e-20  41%  409 aa  CLPX_STRP6 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   69::169     9e-21  44%  429 aa  CLPX_STRMK RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->106)
   63::167     1e-21  42%  421 aa  CLPX_RHOS5 RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
  158::387     1e-21  43%  424 aa  CLPX_RHOPS RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->425)
   64::167     2e-19  44%  421 aa  CLPX_LACJO RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   63::169     5e-18  42%  418 aa  CLPX_HAEDU RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->105)
  162::412     6e-20  40%  421 aa  CLPX_CHLPN RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->445)
   78::193     8e-17  38%  449 aa  CLPX_TRIEI RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   58::167     2e-18  40%  420 aa  CLPX_STAS1 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   78::188     1e-21  43%  439 aa  CLPX_PROA2 RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   79::190     3e-20  41%  441 aa  CLPX_PELLD RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   60::167     5e-21  45%  419 aa  CLPX_LISMO RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   60::167     5e-21  45%  419 aa  CLPX_LISMH RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   60::167     5e-21  45%  419 aa  CLPX_LISMF RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   60::167     5e-21  45%  419 aa  CLPX_LISMC RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   60::167     5e-21  45%  419 aa  CLPX_LISIN RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   94::397     9e-16  36%  421 aa  CLPX_GEOSW RecName: Full=ATP-dependent Clp protease ATP-binding(query 173->437)
   62::175     2e-19  42%  426 aa  CLPX_CLAM3 RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
  161::387     2e-19  41%  419 aa  CLPX_CHLTR RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->423)
  161::387     2e-19  41%  419 aa  CLPX_CHLTB RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->423)
  161::387     2e-19  41%  419 aa  CLPX_CHLT2 RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->423)
   75::182     2e-20  43%  436 aa  CLPX_CHLPD RecName: Full=ATP-dependent Clp protease ATP-binding(query 2->105)
   59::165     7e-16  38%  424 aa  CLPX_THEPX RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   59::165     7e-16  38%  424 aa  CLPX_THEP3 RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
  173::418     6e-20  40%  425 aa  CLPX_PSYWF RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->439)
  172::417     7e-18  38%  424 aa  CLPX_PSYCK RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->439)
   97::417     7e-18  34%  424 aa  CLPX_PSYA2 RecName: Full=ATP-dependent Clp protease ATP-binding(query 160->439)
   63::168     3e-21  45%  420 aa  CLPX_PHEZH RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
  158::387     2e-21  43%  424 aa  CLPX_OLICO RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->425)
   59::178     5e-21  44%  431 aa  CLPX_KOCRD RecName: Full=ATP-dependent Clp protease ATP-binding(query 2->108)
   93::407     3e-21  35%  430 aa  CLPX_CLOK5 RecName: Full=ATP-dependent Clp protease ATP-binding(query 173->446)
   95::409     3e-21  35%  432 aa  CLPX_CLOK1 RecName: Full=ATP-dependent Clp protease ATP-binding(query 173->446)
  161::404     2e-19  39%  419 aa  CLPX_CHLMU RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->439)
   93::396     7e-16  35%  420 aa  CLPX_ANOFW RecName: Full=ATP-dependent Clp protease ATP-binding(query 171->437)
   75::189     7e-21  45%  444 aa  CLPX_MICAN RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   66::174     8e-20  44%  424 aa  CLPX_LEIXX RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
  158::385     2e-21  42%  420 aa  CLPX_GRABC RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->423)
  156::385     7e-21  44%  419 aa  CLPX_DINSH RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->425)
  156::413     8e-20  38%  421 aa  CLPX_DESHY RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->452)
  156::413     8e-20  38%  421 aa  CLPX_DESHD RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->452)
   70::181     6e-20  41%  435 aa  CLPX_CYAA5 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
  161::387     2e-19  41%  419 aa  CLPX_CHLTA RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->423)
  182::410     3e-20  43%  446 aa  CLPX_ANAVT RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->423)
  181::429     9e-21  40%  447 aa  CLPX_ACAM1 RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->440)
  156::397     5e-17  39%  427 aa  CLPX_RICBR RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->437)
  156::397     5e-17  39%  427 aa  CLPX_RICB8 RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->437)
   64::168     9e-21  45%  425 aa  CLPX_PSEA6 RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->106)
   72::177     6e-19  40%  423 aa  CLPX_FUSNN RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->106)
   63::168     5e-21  45%  422 aa  CLPX_AZOC5 RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   61::166     8e-19  41%  415 aa  CLPX_TREDE RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   98::393     2e-19  36%  426 aa  CLPX_PHOPR RecName: Full=ATP-dependent Clp protease ATP-binding(query 173->426)
  182::410     9e-21  43%  446 aa  CLPX_NOSP7 RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->423)
  157::384     9e-21  44%  421 aa  CLPX_JANSC RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->423)
  176::405     1e-19  44%  437 aa  CLPX_CHLPB RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->425)
   98::394     3e-15  34%  426 aa  CLPX_VIBPA RecName: Full=ATP-dependent Clp protease ATP-binding(query 173->427)
   98::394     1e-13  33%  426 aa  CLPX_VIBHB RecName: Full=ATP-dependent Clp protease ATP-binding(query 173->427)
   63::168     6e-20  42%  421 aa  CLPX_RHOCS RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
  110::219     4e-20  41%  466 aa  CLPX_RHOBA RecName: Full=ATP-dependent Clp protease ATP-binding(query 2->108)
   62::175     3e-20  43%  426 aa  CLPX_CORGB RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   62::168     1e-19  41%  434 aa  CLPX_BORPA RecName: Full=ATP-dependent Clp protease ATP-binding(query 2->106)
   62::168     1e-19  41%  434 aa  CLPX_BORBR RecName: Full=ATP-dependent Clp protease ATP-binding(query 2->106)
  104::389     2e-17  37%  421 aa  CLPX_ACIAC RecName: Full=ATP-dependent Clp protease ATP-binding(query 182->423)
  181::409     1e-20  42%  445 aa  CLPX_SYNY3 RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->423)
   76::192     1e-19  42%  448 aa  CLPX_SYNJA RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
  156::398     8e-17  39%  425 aa  CLPX_RICCK RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->438)
   78::187     3e-20  40%  438 aa  CLPX_PROVI RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
   78::192     6e-19  42%  452 aa  CLPX_PROMM RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   78::192     4e-19  42%  452 aa  CLPX_PROM3 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
  161::390     3e-19  42%  432 aa  CLPX_HERA2 RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->423)
   68::181     1e-19  43%  431 aa  CLPX_CORA7 RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
   62::168     1e-19  41%  434 aa  CLPX_BORPE RecName: Full=ATP-dependent Clp protease ATP-binding(query 2->106)
   93::389     6e-17  36%  421 aa  CLPX_BACLD RecName: Full=ATP-dependent Clp protease ATP-binding(query 171->428)
   73::183     8e-17  39%  437 aa  CLPX_GLOVI RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   62::175     3e-20  43%  426 aa  CLPX_CORGL RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
  156::400     2e-16  38%  426 aa  CLPX_ALKOO RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->439)
  159::399     7e-13  38%  421 aa  CLPX_SILST RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->440)
   58::163     2e-20  46%  425 aa  CLPX_RICRS RecName: Full=ATP-dependent Clp protease ATP-binding(query 2->105)
   58::163     2e-20  46%  425 aa  CLPX_RICRO RecName: Full=ATP-dependent Clp protease ATP-binding(query 2->105)
  183::398     6e-19  43%  447 aa  CLPX_CYAP7 RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->410)
   97::400     3e-18  36%  431 aa  CLPX_CLOTH RecName: Full=ATP-dependent Clp protease ATP-binding(query 177->439)
   98::390     1e-19  36%  426 aa  CLPX_VIBSL RecName: Full=ATP-dependent Clp protease ATP-binding(query 173->423)
  156::398     8e-17  38%  425 aa  CLPX_RICM5 RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->438)
  156::398     4e-15  37%  425 aa  CLPX_RICFE RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->438)
  156::398     3e-17  39%  425 aa  CLPX_RICAH RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->438)
   78::192     8e-19  43%  453 aa  CLPX_PROM4 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   61::163     2e-19  44%  417 aa  CLPX_ORITI RecName: Full=ATP-dependent Clp protease ATP-binding(query 5->108)
  106::387     3e-20  36%  423 aa  CLPX_METRJ RecName: Full=ATP-dependent Clp protease ATP-binding(query 188->425)
  106::387     2e-18  35%  423 aa  CLPX_METPB RecName: Full=ATP-dependent Clp protease ATP-binding(query 188->425)
  106::387     1e-18  35%  423 aa  CLPX_METEP RecName: Full=ATP-dependent Clp protease ATP-binding(query 188->425)
  106::387     1e-18  35%  423 aa  CLPX_METC4 RecName: Full=ATP-dependent Clp protease ATP-binding(query 188->425)
  161::401     4e-15  40%  424 aa  CLPX_SILPO RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->440)
  156::398     2e-20  41%  425 aa  CLPX_RICPU RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->438)
  156::398     3e-20  41%  425 aa  CLPX_RICCN RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->438)
  156::398     3e-20  41%  425 aa  CLPX_RICAE RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->438)
   77::193     1e-17  41%  455 aa  CLPX_PROMS RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->106)
   77::193     2e-17  41%  455 aa  CLPX_PROM0 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->106)
  153::352     1e-19  47%  406 aa  CLPX_EHRCJ RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->392)
   60::168     7e-18  41%  417 aa  CLPX1_WOLSU RecName: Full=ATP-dependent Clp protease ATP-binding(query 4->108)
   77::193     2e-17  41%  455 aa  CLPX_PROM9 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->106)
   58::169     4e-19  42%  417 aa  CLPX_ENTFA RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   62::168     2e-19  41%  432 aa  CLPX_BORA1 RecName: Full=ATP-dependent Clp protease ATP-binding(query 2->106)
   64::170     1e-19  42%  427 aa  CLPX_MYXXA RecName: Full=ATP-dependent Clp protease ATP-binding(query 3->108)
  153::352     1e-18  46%  406 aa  CLPX_EHRCR RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->392)
   93::382     9e-18  35%  421 aa  CLPX_BACP2 RecName: Full=ATP-dependent Clp protease ATP-binding(query 171->423)
   93::382     3e-17  36%  419 aa  CLPX_BACHK RecName: Full=ATP-dependent Clp protease ATP-binding(query 171->423)
   93::382     3e-17  36%  419 aa  CLPX_BACCZ RecName: Full=ATP-dependent Clp protease ATP-binding(query 171->423)
   93::382     3e-17  36%  419 aa  CLPX_BACCQ RecName: Full=ATP-dependent Clp protease ATP-binding(query 171->423)
   93::382     3e-17  36%  419 aa  CLPX_BACC7 RecName: Full=ATP-dependent Clp protease ATP-binding(query 171->423)
   93::382     3e-17  36%  419 aa  CLPX_BACC3 RecName: Full=ATP-dependent Clp protease ATP-binding(query 171->423)
   93::382     3e-17  36%  419 aa  CLPX_BACC1 RecName: Full=ATP-dependent Clp protease ATP-binding(query 171->423)
   93::382     3e-17  36%  419 aa  CLPX_BACC0 RecName: Full=ATP-dependent Clp protease ATP-binding(query 171->423)
   93::382     3e-17  36%  419 aa  CLPX_BACAN RecName: Full=ATP-dependent Clp protease ATP-binding(query 171->423)
   93::382     3e-17  36%  419 aa  CLPX_BACAC RecName: Full=ATP-dependent Clp protease ATP-binding(query 171->423)
   93::382     3e-17  36%  419 aa  CLPX_BACAA RecName: Full=ATP-dependent Clp protease ATP-binding(query 171->423)
   82::205     7e-18  40%  452 aa  CLPX_HELPJ RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   62::169     5e-16  37%  427 aa  CLPX_BUCAP RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->106)
   93::382     5e-17  36%  419 aa  CLPX_BACCR RecName: Full=ATP-dependent Clp protease ATP-binding(query 171->423)
   93::382     5e-17  36%  419 aa  CLPX_BACCN RecName: Full=ATP-dependent Clp protease ATP-binding(query 171->423)
   93::382     5e-17  36%  419 aa  CLPX_BACC4 RecName: Full=ATP-dependent Clp protease ATP-binding(query 171->423)
   93::382     5e-17  36%  419 aa  CLPX_BACC2 RecName: Full=ATP-dependent Clp protease ATP-binding(query 171->423)
   96::388     4e-13  34%  423 aa  CLPX_ACIF5 RecName: Full=ATP-dependent Clp protease ATP-binding(query 173->425)
   96::388     4e-13  34%  423 aa  CLPX_ACIF2 RecName: Full=ATP-dependent Clp protease ATP-binding(query 173->425)
   78::192     1e-19  42%  449 aa  CLPX_SYNR3 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
  152::376     3e-19  43%  405 aa  CLPX_ANAMM RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->421)
  152::376     3e-19  43%  405 aa  CLPX_ANAMF RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->421)
  103::388     8e-17  36%  420 aa  CLPX_DELAS RecName: Full=ATP-dependent Clp protease ATP-binding(query 182->423)
   93::382     9e-16  34%  420 aa  CLPX_BACSU RecName: Full=ATP-dependent Clp protease ATP-binding(query 171->423)
   93::382     3e-17  35%  420 aa  CLPX_BACA2 RecName: Full=ATP-dependent Clp protease ATP-binding(query 171->423)
  182::430     2e-19  41%  448 aa  CLPX_SYNJB RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->440)
   59::167     5e-18  41%  420 aa  CLPX_STACT RecName: Full=ATP-dependent Clp protease ATP-binding(query 2->108)
   80::403     6e-19  35%  425 aa  CLPX_OCEIH RecName: Full=ATP-dependent Clp protease ATP-binding(query 161->443)
  101::356     3e-19  38%  429 aa  CLPX_CLOBB RecName: Full=ATP-dependent Clp protease ATP-binding(query 186->392)
  101::356     3e-19  38%  429 aa  CLPX_CLOBA RecName: Full=ATP-dependent Clp protease ATP-binding(query 186->392)
   59::160     3e-19  41%  397 aa  CLPX2_WOLSU RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
  153::394     6e-14  38%  417 aa  CLPX_ORITB RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->437)
  166::394     1e-14  37%  426 aa  CLPX_COREF RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->424)
   77::193     2e-17  41%  455 aa  CLPX_PROM2 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->106)
   78::192     6e-19  44%  449 aa  CLPX_SYNPX RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   77::193     5e-18  42%  455 aa  CLPX_PROMP RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->106)
   97::387     1e-17  35%  432 aa  CLPX_BORPD RecName: Full=ATP-dependent Clp protease ATP-binding(query 173->423)
  182::437     3e-15  38%  449 aa  CLPX_SYNSC RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->445)
  162::386     8e-19  43%  425 aa  CLPX_WOLPM RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->420)
   79::193     8e-19  44%  451 aa  CLPX_SYNPW RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
   65::175     3e-18  40%  429 aa  CLPX_PROAC RecName: Full=ATP-dependent Clp protease ATP-binding(query 7->108)
  154::409     2e-16  35%  413 aa  CLPX_PARUW RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->449)
   79::193     2e-18  41%  451 aa  CLPX_SYNS3 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->108)
  164::395     2e-17  43%  435 aa  CLPX3_METCA RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->423)
  185::431     5e-16  37%  449 aa  CLPX_SYNP6 RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->440)
  185::431     5e-16  37%  449 aa  CLPX_SYNE7 RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->440)
   77::193     1e-17  42%  455 aa  CLPX_PROM5 RecName: Full=ATP-dependent Clp protease ATP-binding(query 1->106)
  156::400     3e-15  36%  416 aa  CLPX_CLOD6 RecName: Full=ATP-dependent Clp protease ATP-binding(query 249->439)
  135::325     5e-05  32%  392 aa  PSMR_SULTO RecName: Full=Proteasome-activating(query 156->375)
  140::329     8e-04  30%  393 aa  PSMR_SULSO RecName: Full=Proteasome-activating(query 161->355)
    1::455

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARR
HSLU_FRATW      MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARR
HSLU_FRATT      MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARR
HSLU_FRATO      MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARR
HSLU_FRATM      MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARR
HSLU_FRATH      MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARR
HSLU_FRATF      MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARR
HSLU_FRAT1      MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARR
HSLU_FRATN      MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARR
HSLU_FRAP2      MTQVMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDDEMRQEVTPKNILMIGPTGVGKTEIARR
HSLU_MARAV      ----MTPREIVHELNKHIVGQEEAKRAVAIALRNRWRRMQLDSSLRDEITPKNILMIGPTGVGKTEIARR
HSLU_HAHCH      ----MTPREIVQELDKHIIGQDSAKRAVAIALRNRWRRMQIDEGLREEVTPKNILMIGPTGVGKTEIARR
HSLU_HAES1      ----MTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARR
HSLU_HAES2      ----MTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARR
HSLU_CELJU      ----MTPREIVHELDKHIVGQQDAKRAVAIALRNRWRRMQLPADMRSEVTPKNILMIGPTGVGKTEIARR
HSLU_SACD2      ----MTPREIVHELDQHIVGQQDAKKAVAIALRNRWRRMQLDAKLRTEITPKNILMIGPTGVGKTEIARR
HSLU_ECO5E      ----MTPREIVSELDKHIIGQNNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_SHIB3      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_PECCP      ----MTPREIVSELDSYIIGQHKAKRAVSIALRNRWRRMQLDEALRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ERWCT      ----MTPREIVSELDSYIIGQHKAKRAVSIALRNRWRRMQLDEALRHEVTPKNILMIGPTGVGKTEIARR
HSLU_TERTT      ----MTPREIVSELDKFIVGQQAAKKAVAIALRNRWRRMQVDKSLRNEITPKNILMIGPTGVGKTEIARR
HSLU_PSEA6      ----MTPREIVHELDRHIIGQKNAKRAVSVALRNRWRRMQLSGDLRQEVTPKNILMIGPTGVGKTEIARR
HSLU_SHISS      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_SHIFL      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_SHIF8      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_SHIBS      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_HAEPS      ----MTPREIVSELDAHIIGQNEAKRAVAIALRNRWRRMQLPEELRQEVTPKNILMIGPTGVGKTEIARR
HSLU_ECOLI      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ECOLC      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ECOHS      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ECODH      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ECOBW      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ECO57      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_IDILO      ----MTPREIVDELNRHIIGQDKAKRAVAVALRNRWRRMQLDDELRQEVTPKNILMIGPTGVGKTEIARR
HSLU_ESCF3      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_CITK8      ----MTPREIVSELNKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_PSEU5      ----MTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRQEVTPKNILMIGPTGVGKTEIARR
HSLU_PASMU      ----MTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ALTMD      ----MTPREIVHELDRHIIGQQDAKRAVSIALRNRWRRMQLEPELRQEVTPKNILMIGPTGVGKTEIARR
HSLU_SHIDS      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_RALEH      MSHTMTPSEIVSELDKHIIGQNKAKKAVAVALRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_ECOUT      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ECOSM      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ECOLU      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ECOL6      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ECOL5      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ECOK1      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ECO81      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ECO7I      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ECO45      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ECO27      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_VIBVY      ----MTPREIVHELNRHIIGQDNAKRSVAIALRNRWRRMQLEESLRVEVTPKNILMIGPTGVGKTEIARR
HSLU_VIBVU      ----MTPREIVHELNRHIIGQDNAKRSVAIALRNRWRRMQLEESLRVEVTPKNILMIGPTGVGKTEIARR
HSLU_SALTY      ----MTPREIVSELNKHIIGQDNAKRSVAIALRNRWRRMQLDEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_SALTI      ----MTPREIVSELNKHIIGQDNAKRSVAIALRNRWRRMQLDEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_SALSV      ----MTPREIVSELNKHIIGQDNAKRSVAIALRNRWRRMQLDEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_SALPK      ----MTPREIVSELNKHIIGQDNAKRSVAIALRNRWRRMQLDEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_SALPC      ----MTPREIVSELNKHIIGQDNAKRSVAIALRNRWRRMQLDEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_SALPB      ----MTPREIVSELNKHIIGQDNAKRSVAIALRNRWRRMQLDEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_SALPA      ----MTPREIVSELNKHIIGQDNAKRSVAIALRNRWRRMQLDEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_SALNS      ----MTPREIVSELNKHIIGQDNAKRSVAIALRNRWRRMQLDEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_SALHS      ----MTPREIVSELNKHIIGQDNAKRSVAIALRNRWRRMQLDEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_SALG2      ----MTPREIVSELNKHIIGQDNAKRSVAIALRNRWRRMQLDEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_SALEP      ----MTPREIVSELNKHIIGQDNAKRSVAIALRNRWRRMQLDEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_SALDC      ----MTPREIVSELNKHIIGQDNAKRSVAIALRNRWRRMQLDEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_SALCH      ----MTPREIVSELNKHIIGQDNAKRSVAIALRNRWRRMQLDEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_SALA4      ----MTPREIVSELNKHIIGQDNAKRSVAIALRNRWRRMQLDEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_SALAR      ----MTPREIVSELNKHIIGQDNAKRSVAIALRNRWRRMQLDEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_RALPJ      MSETMTPSEIVSELDKHIIGQHKAKKAVAVALRNRWRRQQVGDPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_ENTS8      ----MTPREIVSELDKHIIGQDAAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ECOSE      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ECO8A      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ECO55      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ECO24      ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_PASHA      ----MTPREIVSELDAHIIGQKDAKRAVAIALRNRWRRMQLPEDLRQEVTPKNILMIGPTGVGKTEIARR
HSLU_MARMS      ----MTPRETVNALDNHIIGQQKAKRAVAIALRNRWRRMQLPEEMRAEVTPKNILMIGPTGVGKTEIARR
HSLU_ACTPJ      ----MTPREIVSELDAHIIGQNEAKRAVAIALRNRWRRMQLPEDLRQEVTPKNILMIGPTGVGKTEIARR
HSLU_ACTP7      ----MTPREIVSELDAHIIGQNEAKRAVAIALRNRWRRMQLPEDLRQEVTPKNILMIGPTGVGKTEIARR
HSLU_ACTP2      ----MTPREIVSELDAHIIGQNEAKRAVAIALRNRWRRMQLPEDLRQEVTPKNILMIGPTGVGKTEIARR
HSLU_SODGM      ----MTPREIVSELDGYIVGQHNAKRAVAIALRNRWRRMQLDEALRHEVTPKNILMIGPTGVGKTEIARR
HSLU_MANSM      ----MTPREIVSELDAHIIGQNEAKRAVAIALRNRWRRMQLPEDLRQEITPKNILMIGPTGVGKTEIARR
HSLU_HAEIN      ----MTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARR
HSLU_NITEU      ----MTPQEIVHELDKHIIGQDTAKRAVAIALRNRWRRQQVDEPLRHEITPKNILMIGPTGVGKTEIARR
HSLU_KLEP3      ----MTPREIVSELDKHIIGQDAAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ENT38      ----MTPREIVSELNKHIIGQDNAKRSVAIALRNRWRRMQLDEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_KLEP7      ----MTPREIVSELDKHIIGQDAAKRSVSIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ALCBS      ----LTPKDIVSELNRHIVGQDAAKRAVALALRTRWRRMQLPEEMRAEVAPKNILMIGPTGVGKTEIARR
HSLU_PHOLL      ----MTPREIVSELDKHIIGQDKAKRAVAIALRNRWRRMQLDETLRYEVTPKNILMIGPTGVGKTEIARR
HSLU_EDWI9      ----MTPREIVSELDSYIIGQHSAKRAVAIALRNRWRRMQLGEALRHEVTPKNILMIGPTGVGKTEIARR
HSLU_TOLAT      ----MTPREIVHELDRHIIGQAEAKRAVAIALRNRWRRMQLSNELRQEVAPKNILMIGPTGVGKTEIARR
HSLU_YERE8      ----MTPREIVSELDSYIIGQDKAKRAVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_SERP5      ----MTPREIVSELDSYIIGQNKAKRAVAIALRNRWRRMQLNEMLRHEVTPKNILMIGPTGVGKTEIARR
HSLU_LEGPL      ---VMTPREIVQELDKHIIGQDDAKRAVAIALRNRWRRMKIDPVLRNEIMPKNILMIGPTGVGKTEIARR
HSLU_LEGPH      ---VMTPREIVQELDKHIIGQDDAKRAVAIALRNRWRRMKIDPVLRNEIMPKNILMIGPTGVGKTEIARR
HSLU_LEGPA      ---VMTPREIVQELDKHIIGQDDAKRAVAIALRNRWRRMKIDPVLRNEIMPKNILMIGPTGVGKTEIARR
HSLU_VIBSL      ----MTPREIVHELNRHIIGQDNAKRSVAIALRNRWRRMQLEESLRVEVSPKNILMIGPTGVGKTEIARR
HSLU_HAEDU      ----ITPREIVSELDAHIIGQTEAKRAVAIALRNRWRRMQLSEDLRQEVTPKNILMIGPTGVGKTEIARR
HSLU_COLP3      ----MTPREIVHELDSHIVGQSDAKRAVAIALRNRWRRMQLDKDLRNEVTPKNILMIGPTGVGKTEIARR
HSLU_PSEHT      ----MTPREIVHELDQHIIGQAKAKKAVAIALRNRWRRMQLSDDLRNEVTPKNILMIGPTGVGKTEIARR
HSLU_METCA      ----MTPREIVHELDKHIVGQAEAKRAVAIALRNRWRRAQVGAPLRDEITPKNILMIGPTGVGKTEIARR
HSLU_AZOVD      ----MTPREIVHELNRHIVGQEDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARR
HSLU_PSEA7      ----MTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARR
HSLU_COXBU      ----MTPREIVAELDKFIIGQNDAKRAVAIALRNRWRRMQLGEELRREIFPKNILMIGPTGVGKTEIARR
HSLU_COXBR      ----MTPREIVAELDKFIIGQNDAKRAVAIALRNRWRRMQLGEELRREIFPKNILMIGPTGVGKTEIARR
HSLU_PSEMY      ----MTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPADLRQEVTPKNILMIGPTGVGKTEIARR
HSLU_PHOPR      ----MTPREIVHELDRHIIGQDKAKRAVAIALRNRWRRMQLPEELRVEVTPKNILMIGPTGVGKTEIARR
HSLU_PROMH      ----MTPREIASELDRFIIGQDKAKRAVAIALRNRWRRMQLDEALRHEVTPKNILMIGPTGVGKTEIARR
HSLU_PSEAE      ----MTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARR
HSLU_PSEAB      ----MTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARR
HSLU_PSEA8      ----MTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARR
HSLU_COXBN      ----MTPREIVAELDKFIIGQNDAKRAVAIALRNRWRRMQLGEELRREIFPKNILMIGPTGVGKTEIARR
HSLU_SHEPW      ----MTPREIVHELDSHIIGQQKAKRSVAIALRNRWRRMQLAADLRQEVTPKNILMIGPTGVGKTEIARR
HSLU_BURP8      ----MTPAEIVSELDKHIIGQNRAKKAVAVALRNRWRRQQVDEPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_AERHH      ----MTPREIVHELDRHIIGQADAKRAVAVALRNRWRRMQLDEEMRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ACTSZ      ----MTPREIVSELDAYIIGQSEAKRAVAIALRNRWRRMQLPEELRQEVTPKNILMIGPTGVGKTEIARR
HSLU_THISH      ----MTPREIVQELDKHIVGQKDAKRAVAIALRNRWRRQQLPEALRQEVTPKNILMIGPTGVGKTEIARR
HSLU_SHEWM      ----MTPREIVHELDSHIIGQHNAKRSVAIALRNRWRRMQLDADFRQEVTPKNILMIGPTGVGKTEIARR
HSLU_SHEHH      ----MTPREIVHELDSHIIGQQKAKRSVAIALRNRWRRMQLAADLRQEVTPKNILMIGPTGVGKTEIARR
HSLU_VIBPA      ----MTPREIVHELNRHIIGQDKAKRSVAIALRNRWRRMQLEESLRVEVTPKNILMIGPTGVGKTEIARR
HSLU_SHEPA      ----MTPREIVHELDSHIIGQQKAKRSVAIALRNRWRRMQLAADLRQEVTPKNILMIGPTGVGKTEIARR
HSLU_VIBHB      ----MTPREIVHELNRHIIGQDKAKRSVAIALRNRWRRMQLEESLRVEVTPKNILMIGPTGVGKTEIARR
HSLU_ALHEH      ----MTPREIVQELDKYIIGQDAAKRSVAIALRNRWRRMQVDEALQPEITPKNILMIGPTGVGKTEIARR
HSLU_SHESR      ----MTPREIVHELDAHIIGQKKAKRSVAVALRNRWRRMQLDADFRQEVTPKNILMIGPTGVGKTEIARR
HSLU_SHESH      ----MTPREIVHELDTHIIGQHDAKRSVAIALRNRWRRMQLDVDFRQEVTPKNILMIGPTGVGKTEIARR
HSLU_YERPY      ----MTPREIVSELDSHIIGQDKAKRAVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_YERPS      ----MTPREIVSELDSHIIGQDKAKRAVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_YERPP      ----MTPREIVSELDSHIIGQDKAKRAVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_YERPN      ----MTPREIVSELDSHIIGQDKAKRAVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_YERPG      ----MTPREIVSELDSHIIGQDKAKRAVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_YERPE      ----MTPREIVSELDSHIIGQDKAKRAVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_YERPB      ----MTPREIVSELDSHIIGQDKAKRAVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_YERPA      ----MTPREIVSELDSHIIGQDKAKRAVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_YERP3      ----MTPREIVSELDSHIIGQDKAKRAVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_XANAC      -TATMTPREIVQELDRHIVGQHDAKRAVAIALRNRWRRMQLPEELRNEVMPKNILMIGPTGVGKTEIARR
HSLU_ERWT9      ----MTPREIVSELNRFIIGQDGAKRAVAIALRNRWRRMQLDEELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_AERS4      ----MTPREIVHELDRHIIGQADAKRAVAVALRNRWRRMQLGEEMRHEVTPKNILMIGPTGVGKTEIARR
HSLU_SHEB8      ----MTPREIVHELDAHIIGQQKAKRSVAVALRNRWRRMQLDADFRQEVTPKNILMIGPTGVGKTEIARR
HSLU_DECAR      ----MTPQEIVSELDKHIVGQKNAKKAVAIALRNRWRRSQVAEPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_VIBF1      ----MTPREIVHELDSHIIGQDKAKRSVAIALRNRWRRMQLAPELRTEVTPKNILMIGPTGVGKTEIARR
HSLU_VIBC3      ----MTPREIVSELNRHIIGQDKAKRAVAIALRNRWRRMQLEESLRVEVTPKNILMIGPTGVGKTEIARR
HSLU_PSYIN      ----MTPKEIKHELDRHIIGQDNAKRAVAIALRNRWRRMQLDKEMRQEVTPKNILMIGPTGVGKTEIARR
HSLU_NITMU      ----LTPREIVHELDKHIIGQDAAKRSVAIALRNRWRRQQVQDPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_SHESW      ----MTPREIVHELDAHIIGQKKAKRSVAVALRNRWRRMQLDADFRQEVTPKNILMIGPTGVGKTEIARR
HSLU_VIBFM      ----MTPREIVHELDSHIIGQDKAKRSVAIALRNRWRRMQLAPELRTEVTPKNILMIGPTGVGKTEIARR
HSLU_SHEPC      ----MTPREIVHELDAHIIGQKKAKRSVAVALRNRWRRMQLDVDFRQEVTPKNILMIGPTGVGKTEIARR
HSLU_SHEB9      ----MTPREIVHELDAHIIGQQKAKRSVAVALRNRWRRMQLDVDFRQEVTPKNILMIGPTGVGKTEIARR
HSLU_SHEB5      ----MTPREIVHELDAHIIGQQKAKRSVAVALRNRWRRMQLDVDFRQEVTPKNILMIGPTGVGKTEIARR
HSLU_SHEB2      ----MTPREIVHELDAHIIGQQKAKRSVAVALRNRWRRMQLDVDFRQEVTPKNILMIGPTGVGKTEIARR
HSLU_XANOR      -TSTMTPREIVQELDRHIVGQHDAKRAVAIALRNRWRRMQLPEELRNEVMPKNILMIGPTGVGKTEIARR
HSLU_XANOM      -TSTMTPREIVQELDRHIVGQHDAKRAVAIALRNRWRRMQLPEELRNEVMPKNILMIGPTGVGKTEIARR
HSLU_XANC5      -TATMTPREIVQELDRHIVGQHDAKRAVAIALRNRWRRMQLPEELRNEVMPKNILMIGPTGVGKTEIARR
HSLU_ACIAC      ----MTPQEIVSELDRHIVGQSGAKRAVAIALRNRWRRQQVDPALRQEITPKNILMIGPTGVGKTEIARR
HSLU_VIBCH      ----MTPREIVSELNRHIIGQDKAKRAVAIALRNRWRRMQLEESLRVEVTPKNILMIGPTGVGKTEIARR
HSLU_XANCP      -TATMTPREIVQELDRHIVGQHDAKRAVAIALRNRWRRMQLPEELRNEVMPKNILMIGPTGVGKTEIARR
HSLU_XANCB      -TATMTPREIVQELDRHIVGQHDAKRAVAIALRNRWRRMQLPEELRNEVMPKNILMIGPTGVGKTEIARR
HSLU_XANC8      -TATMTPREIVQELDRHIVGQHDAKRAVAIALRNRWRRMQLPEELRNEVMPKNILMIGPTGVGKTEIARR
HSLU_HAEIE      ----MTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARR
HSLU_HAEI8      ----MTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARR
HSLU_VIBCM      ----MTPREIVSELNRHIIGQDKAKRAVAIALRNRWRRMQLEESLRVEVTPKNILMIGPTGVGKTEIARR
HSLU_RALEJ      MSHTMTPSEIVSELDKHIIGQNKAKKAVAVALRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_PSESM      ----MTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPEELRVEVTPKNILMIGPTGVGKTEIARR
HSLU_PSEPW      ----MTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARR
HSLU_SHELP      ----MTPREIVHELDSHIIGQQNAKRSVAIALRNRWRRMQLDAALRQEVTPKNILMIGPTGVGKTEIARR
HSLU_SHESM      ----MTPREIVHELDAHIIGQKKAKRSVAVALRNRWRRMQLDADFRQEVTPKNILMIGPTGVGKTEIARR
HSLU_SHESA      ----MTPREIVHELDAHIIGQKKAKRSVAVALRNRWRRMQLDADFRQEVTPKNILMIGPTGVGKTEIARR
HSLU_SHEON      ----MTPREIVHELDAHIIGQKKAKRSVAVALRNRWRRMQLDADFRQEVTPKNILMIGPTGVGKTEIARR
HSLU_SHEAM      ----MTPREIVHELDAHIIGQQKAKRSVAVALRNRWRRMQLDAALRHEVTPKNILMIGPTGVGKTEIARR
HSLU_HAMD5      ----MTPSEIVKKLDDYIIGQDDAKRAVAIALRNRWRRMQLDTELRQEITPKNILMIGPTGVGKTEIARR
HSLU_CUPTR      MSHTMTPSEIVSELDKHIIGQNKAKKAVAVALRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_XYLFA      ----MTPREIVQELDRHIVGQQAAKRSVAIALRNRWRRMQLPEELRNEVMPKNILMIGPTGVGKTEIARR
HSLU_XYLF2      ----MTPREIVQELDRHIVGQQAAKRSVAIALRNRWRRMQLPEELRNEVMPKNILMIGPTGVGKTEIARR
HSLU_NITEC      ----MTPQEIVHELDKHIIGQEAAKRSVAIALRNRWRRQQVGEPLRHEITPKNILMIGPTGVGKTEIARR
HSLU_XYLFM      ----MTPREIVQELDRHIVGQQVAKRSVAIALRNRWRRMQLPEELRNEVMPKNILMIGPTGVGKTEIARR
HSLU_BURTA      ----MTPAEIVSELDKHIIGQDKAKKAVAVALRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_BURPP      ----MTPAEIVSELDKHIIGQGRAKKAVAVALRNRWRRQQVEDPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_AZOSB      MTQ-MTPPEIVSELDKHIVGQARAKKAVAIALRNRWRRARIDEPLRSEITPKNILMIGPTGVGKTEIARR
HSLU_CHRVO      MTQ-MTPQEIVHELDQHIIGQHKAKRAVAIALRNRWRRQQVAEPLRSEITPKNILMIGPTGVGKTEIARR
HSLU_VEREI      ----MTPQEIVSELDKHIVGQSSAKRAVAIALRNRWRRQQVQGSLRQEITPKNILMIGPTGVGKTEIARR
HSLU_BURXL      ----MTPAEIVSELDKHIIGQGRAKKAVAVALRNRWRRQQVEEPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_ALISL      ----MTPREIVHELDSHIIGQDKAKRSVAIALRNRWRRMQLQPELRAEVTPKNILMIGPTGVGKTEIARR
HSLU_SHEDO      ----MTPREIVHELDAHIIGQNKAKRAVAVALRNRWRRMQLAPDLRQEVTPKNILMIGPTGVGKTEIARR
HSLU_BURVG      ----MTPAEIVSELDKHIIGQSKAKKAVAVALRNRWRRQQVTEPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_BORA1      ----MTPGEIVSELDKYIIGQNRAKRAVAVALRNRWRRQQVADPLRHEIHPKNILMIGPTGVGKTEIARR
HSLU_BUCBP      ----MTPREIVKELDRFIIGQKKAKRAVAIALRNRWRRMKLNKELRYEITPKNILMIGPTGVGKTEIARR
HSLU_BUCAP      ----MTPPQIVSELNKFIIGQEQAKKAVAIALRNRWRRMQLNNELRHEITPKNILMIGPTGVGKTEIARR
HSLU_SHEFN      ----MTPREIVHELDAHIIGQQNAKRSVAVALRNRWRRMQLEPELRHEVTPKNILMIGPTGVGKTEIARR
HSLU_ACISJ      ----MTPQEIVSELDRHIVGQNGAKRAVAIALRNRWRRQQVDASLRHEITPKNILMIGPTGVGKTEIARR
HSLU_DIAST      ----MTPQEIVSELDRHIVGQNGAKRAVAIALRNRWRRQQVDASLRHEITPKNILMIGPTGVGKTEIARR
HSLU_BUCAT      ----MTPPQIVSELDKFIIGQEKAKRAVSIALRNRWRRMQLNSELRYEVTPKNILMIGPTGVGKTEIARR
HSLU_BUCAI      ----MTPPQIVSELDKFIIGQEKAKRAVSIALRNRWRRMQLNSELRYEVTPKNILMIGPTGVGKTEIARR
HSLU_BUCA5      ----MTPPQIVSELDKFIIGQEKAKRAVSIALRNRWRRMQLNSELRYEVTPKNILMIGPTGVGKTEIARR
HSLU_CHRSD      MTQ-MTPREIVHALDQYIIGQQEAKRSVAIALRNRWRRMQLDDSLRGEVVPKNILMIGPTGVGKTEIARR
HSLU_BAUCH      ----MTPSEIVNELDDYIIGQHNAKRAVAIALRNRWRRMQLDETLRHEVTPKNILMIGPTGVGKTEIARR
HSLU_BURS3      ----MTPAEIVSELDKHIIGQXXXXXXXXXXLRNRWRRQQVADPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_AZOSE      MTQ-MTPPEIVSELDKHIVGQGKAKKAVAIALRNRWRRAQVEEPLRSEITPKNILMIGPTGVGKTEIARR
HSLU_PSE14      ----MTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLHEELRVEVTPKNILMIGPTGVGKTEIARR
HSLU_BURPS      ----MTPAEIVSELDKHIIGQXXXXXXXXXXLRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_BURP6      ----MTPAEIVSELDKHIIGQXXXXXXXXXXLRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_BURP1      ----MTPAEIVSELDKHIIGQXXXXXXXXXXLRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_BURP0      ----MTPAEIVSELDKHIIGQXXXXXXXXXXLRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_BURMS      ----MTPAEIVSELDKHIIGQXXXXXXXXXXLRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_BURMA      ----MTPAEIVSELDKHIIGQXXXXXXXXXXLRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_BURM9      ----MTPAEIVSELDKHIIGQXXXXXXXXXXLRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_BURM7      ----MTPAEIVSELDKHIIGQXXXXXXXXXXLRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_BURCH      ----MTPAEIVSELDKHIIGQXXXXXXXXXXLRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_BURCC      ----MTPAEIVSELDKHIIGQXXXXXXXXXXLRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_BURCA      ----MTPAEIVSELDKHIIGQXXXXXXXXXXLRNRWRRQQVAEPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_BORPD      ----MTPGEIVSELDKYIIGQNRAKRAVAVALRNRWRRQQVEEPLRHEIHPKNILMIGPTGVGKTEIARR
HSLU_BORBR      ----MTPGEIVSELDKFIIGQNRAKRAVAVALRNRWRRQQVAEPLRHEIHPKNILMIGPTGVGKTEIARR
HSLU_BORPE      ----MTPGEIVSELDKFIIGQNRAKRAVAVALRNRWRRQQVAEPLRHEIHPKNILMIGPTGVGKTEIARR
HSLU_BORPA      ----MTPDEIVAELDKFIIGQNRAKRAVAVALRNRWRRQQVAEPLRHEIHPKNILMIGPTGVGKTEIARR
HSLU_BURCJ      ----MTPAEIVSELDKHIIGQXXXXXXXXXXLRNRWRRQQVADPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_RALSO      MPETMTPSEIVSELDKHIIGQQXXXXXXXXXLRNRWRRQQVADPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_WIGBR      ----MTPKNIVKELDSHIIGQHDAKKAVAIALRNRWRRMKLDDSLRHEVTPKNILMIGPTGVGKTEIARR
HSLU_PSEPF      ----MTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPEELRVEVTPKNILMIGPTGVGKTEIARR
HSLU_PSEPG      ----MTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARR
HSLU_BURCM      ----MTPAEIVSELDKHIIGQXXXXXXXXXXLRNRWRRQQVGEPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_BURA4      ----MTPAEIVSELDKHIIGQXXXXXXXXXXLRNRWRRQQVGEPLRQEITPKNILMIGPTGVGKTEIARR
HSLU_PSEPK      ----MTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARR
HSLU_PSEP1      ----MTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARR
HSLU_PSEU2      ----MTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPEELRVEVTPKNILMIGPTGVGKTEIARR
HSLU_PSEE4      ----MTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVTPKNILMIGPTGVGKTEIARR
HSLU_BUCCC      ----MTPRKIVKELNKYIIGQNNAKRAVAIALRNRWRRMQLNSELRNEITPKNILMIGPTGVGKTEIARR
HSLU_ACIF5      ----MTPREIVQELDKYIIGQSEAKRAVAIALRNRWRRGQVPPPLHQEITPKNILMIGPTGVGKTEIARR
HSLU_ACIF2      ----MTPREIVQELDKYIIGQSEAKRAVAIALRNRWRRGQVPPPLHQEITPKNILMIGPTGVGKTEIARR
HSLU_PSEFS      ----MTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPEELRVEVTPKNILMIGPTGVGKTEIARR
HSLU_PSEF5      ----MTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRVEVTPKNILMIGPTGVGKTEIARR
HSLU_GEOSW      MSEALTPRQIVEKLDQFIVGQKEAKKAVAIALRNRYRRSLLDEKLRDEVVPKNILMIGPTGVGKTEIARR
HSLU_DESAH      ----LKPMEIVRELDRYIIGQKNAKKSVAIALRNRWRRRQVPDDLRDEIAPKNIILIGPTGVGKTEIARR
HSLU_RHOS5      ----LTPREIVSELDRFIIGQKDAKRAVAVALRNRWRRKQLSDDIRDEVYPKNILMIGPTGVGKTEISRR
HSLU_GEOTN      MAETLTPRQIVERLDQFIIGQKEAKKAVAIALRNRYRRSLLDEKLRDEVMPKNILMIGPTGVGKTEIARR
HSLU_DICNV      ----MTPREIVEELDRHIIGQKHAKRAVANALRSRWRRKQVAEPLRSEITPKNILMIGPTGVGKTEIARR
HSLU_ROSDO      ----LTPREIVSELDRFIIGQNDAKRAVAVALRNRWRRKQLADDLRDEVYPKNILMIGPTGVGKTEISRR
HSLU_RHOS1      ----LTPREIVSELDRFIIGQKEAKRAVAVALRNRWRRKQLADDLRDEVYPKNILMIGPTGVGKTEISRR
HSLU_RHOSK      ----LTPREIVSELDRFIIGQKEAKRAVAVALRNRWRRKQLADDLRDEVYPKNILMIGPTGVGKTEISRR
HSLU_RHOS4      ----LTPREIVSELDRFIIGQKEAKRAVAVALRNRWRRKQLADDLRDEVYPKNILMIGPTGVGKTEISRR
HSLU_MAGSM      -----TPREIVSELDRYIIGQNMAKRAVAIALRNRWRRQRLSAEMREEVYPKNILMIGPTGVGKTEIARR
HSLU_GEOKA      MAETLTPRQIVEKLDQFIVGQKEAKKAVAIALRNRYRRSLLDEKLRDEVMPKNILMIGPTGVGKTEIARR
HSLU_BACP2      -----TPREIVEKLDQYIIGQLDAKKAVAVALRNRYRRSLLHDKLKDEVVPKNILMIGPTGVGKTEIARR
HSLU_RHIME      -----SPREIVSELDRYIIGQKDAKRAVAIALRNRWRRQQLDDELRDEVMPKNILMIGPTGVGKTEISRR
HSLU_RHORT      -----TPREIVSELDRHIVGQKDAKRAVAIALRNRWRRQQLSEALRDEVLPKNILMIGPTGVGKTEIARR
HSLU_RHILO      -----SPREIVSELDRFIIGQKDAKRAVAIALRNRWRRQQLEGQMREEVMPKNILMIGPTGVGKTEISRR
HSLU_BEII9      -----SPREIVSELDRYIVGQNDAKRAVAIALRNRWRRLKLEGAMREEVLPKNILMIGPTGCGKTEIARR
HSLU_THEYD      ----LTPKKIVEELDKFIIGQESAKKAVAIALRNRFRRQLLPKELRDEILPKNILMIGPTGVGKTEIARR
HSLU_HYPNA      ----LTPREIVAELDRHIVGQNAAKRAVAIALRNRWRRKQAPENLRGEITPKNILMIGPTGVGKTEVSRR
HSLU_SINMW      -----SPREIVSELDRYIIGQKDAKRAVAIALRNRWRRQQLSDELRDEVMPKNILMIGPTGVGKTEISRR
HSLU_SILPO      ----LTPREIVSELDRFIIGQKDAKRAVAVALRNRWRRKQLADDLRDEVYPKNILMIGPTGVGKTEISRR
HSLU_MYXXD      -----TPREVVSELDRYIVGQNAAKRAVAIALRNRWRRQQVDDDLRDEIHPKNIIMIGPTGVGKTEIARR
HSLU_MESSB      -----SPREIVSELDRYIIGQKEAKRAVAIALRNRWRRQQLEPGLREEVMPKNILMIGPTGVGKTEISRR
HSLU_SULSY      ----LTPKQIVEELNKYIVGQYEAKKAVAVALRNRWRRQKLPEDLRDEVIPKNILMIGPTGVGKTEIARR
HSLU_SILST      ----LTPREIVSELDRFIIGQKDAKRAVAVALRNRWRRKQLPDDLRDEVHPKNILMIGPTGVGKTEISRR
HSLU_RHISN      -----SPREIVSELDRYIIGQKDAKRAVAIALRNRWRRQQLSDELRDEVMPKNILMIGPTGVGKTEISRR
HSLU_BACWK      -----TPRQIVEKLDQYIIGQKDAK