[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD31100.1

[Show Plain Result]


## Summary of Sequence Search
    1::248
   10::268     7e-18  27%  280 aa  Y466_HAEIN RecName: Full=Uncharacterized protein HI0466;
   27::241     3e-15  35%  330 aa  YGFZ_YERPY RecName: Full=tRNA-modifying protein ygfZ;
   27::241     3e-15  35%  330 aa  YGFZ_YERPP RecName: Full=tRNA-modifying protein ygfZ;
   27::241     3e-15  35%  330 aa  YGFZ_YERPN RecName: Full=tRNA-modifying protein ygfZ;
   27::241     3e-15  35%  330 aa  YGFZ_YERPG RecName: Full=tRNA-modifying protein ygfZ;
   27::241     3e-15  35%  330 aa  YGFZ_YERPE RecName: Full=tRNA-modifying protein ygfZ;
   27::241     3e-15  35%  330 aa  YGFZ_YERPB RecName: Full=tRNA-modifying protein ygfZ;
   27::241     3e-15  35%  330 aa  YGFZ_YERPA RecName: Full=tRNA-modifying protein ygfZ;
   27::241     5e-15  35%  330 aa  YGFZ_YERPS RecName: Full=tRNA-modifying protein ygfZ;
   27::241     5e-15  35%  330 aa  YGFZ_YERP3 RecName: Full=tRNA-modifying protein ygfZ;
   30::240     2e-14  35%  329 aa  YGFZ_PHOLL RecName: Full=tRNA-modifying protein ygfZ;
   26::240     3e-12  33%  326 aa  YGFZ_ECO5E RecName: Full=tRNA-modifying protein ygfZ;
   26::240     3e-12  33%  326 aa  YGFZ_ECO57 RecName: Full=tRNA-modifying protein ygfZ;
   26::240     4e-12  34%  326 aa  YGFZ_SALAR RecName: Full=tRNA-modifying protein ygfZ;
   26::240     7e-12  33%  329 aa  YGFZ_ENTS8 RecName: Full=tRNA-modifying protein ygfZ;
   26::240     9e-12  32%  326 aa  YGFZ_SHISS RecName: Full=tRNA-modifying protein ygfZ;
   26::240     1e-11  32%  326 aa  YGFZ_SHIB3 RecName: Full=tRNA-modifying protein ygfZ;
   26::240     1e-11  32%  326 aa  YGFZ_ECOSE RecName: Full=tRNA-modifying protein ygfZ;
   26::240     1e-11  32%  326 aa  YGFZ_ECO7I RecName: Full=tRNA-modifying protein ygfZ;
   27::241     2e-11  32%  330 aa  YGFZ_YERE8 RecName: Full=tRNA-modifying protein ygfZ;
   32::240     2e-11  32%  326 aa  YGFZ_SALTY RecName: Full=tRNA-modifying protein ygfZ;
   26::240     3e-11  32%  326 aa  YGFZ_SHIFL RecName: Full=tRNA-modifying protein ygfZ;
   26::240     3e-11  32%  326 aa  YGFZ_SHIF8 RecName: Full=tRNA-modifying protein ygfZ;
   32::240     3e-11  33%  326 aa  YGFZ_SALPC RecName: Full=tRNA-modifying protein ygfZ;
   32::240     3e-11  33%  326 aa  YGFZ_SALDC RecName: Full=tRNA-modifying protein ygfZ;
   32::240     3e-11  33%  326 aa  YGFZ_SALCH RecName: Full=tRNA-modifying protein ygfZ;
   26::240     3e-11  32%  326 aa  YGFZ_ECOUT RecName: Full=tRNA-modifying protein ygfZ;
   26::240     3e-11  32%  326 aa  YGFZ_ECOSM RecName: Full=tRNA-modifying protein ygfZ;
   26::240     3e-11  32%  326 aa  YGFZ_ECOLU RecName: Full=tRNA-modifying protein ygfZ;
   26::240     3e-11  32%  326 aa  YGFZ_ECOLI RecName: Full=tRNA-modifying protein ygfZ;
   26::240     3e-11  32%  326 aa  YGFZ_ECOL6 RecName: Full=tRNA-modifying protein ygfZ;
   26::240     3e-11  32%  326 aa  YGFZ_ECOL5 RecName: Full=tRNA-modifying protein ygfZ;
   26::240     3e-11  32%  326 aa  YGFZ_ECOK1 RecName: Full=tRNA-modifying protein ygfZ;
   26::240     3e-11  32%  326 aa  YGFZ_ECOHS RecName: Full=tRNA-modifying protein ygfZ;
   26::240     3e-11  32%  326 aa  YGFZ_ECODH RecName: Full=tRNA-modifying protein ygfZ;
   26::240     3e-11  32%  326 aa  YGFZ_ECOBW RecName: Full=tRNA-modifying protein ygfZ;
   26::240     3e-11  32%  326 aa  YGFZ_ECO8A RecName: Full=tRNA-modifying protein ygfZ;
   26::240     3e-11  32%  326 aa  YGFZ_ECO81 RecName: Full=tRNA-modifying protein ygfZ;
   26::240     3e-11  32%  326 aa  YGFZ_ECO55 RecName: Full=tRNA-modifying protein ygfZ;
   26::240     3e-11  32%  326 aa  YGFZ_ECO45 RecName: Full=tRNA-modifying protein ygfZ;
   26::240     3e-11  32%  326 aa  YGFZ_ECO27 RecName: Full=tRNA-modifying protein ygfZ;
   26::240     3e-11  32%  326 aa  YGFZ_ECO24 RecName: Full=tRNA-modifying protein ygfZ;
   26::240     3e-11  31%  326 aa  YGFZ_SALTI RecName: Full=tRNA-modifying protein ygfZ;
   26::240     3e-11  31%  326 aa  YGFZ_SALSV RecName: Full=tRNA-modifying protein ygfZ;
   26::240     3e-11  32%  326 aa  YGFZ_ESCF3 RecName: Full=tRNA-modifying protein ygfZ;
   27::233     3e-11  34%  318 aa  YGFZ_ALISL RecName: Full=tRNA-modifying protein ygfZ;
   32::240     5e-11  32%  326 aa  YGFZ_SALPK RecName: Full=tRNA-modifying protein ygfZ;
   32::240     5e-11  32%  326 aa  YGFZ_SALPB RecName: Full=tRNA-modifying protein ygfZ;
   32::240     5e-11  32%  326 aa  YGFZ_SALPA RecName: Full=tRNA-modifying protein ygfZ;
   32::240     5e-11  32%  326 aa  YGFZ_SALNS RecName: Full=tRNA-modifying protein ygfZ;
   32::240     5e-11  32%  326 aa  YGFZ_SALHS RecName: Full=tRNA-modifying protein ygfZ;
   32::240     5e-11  32%  326 aa  YGFZ_SALG2 RecName: Full=tRNA-modifying protein ygfZ;
   32::240     5e-11  32%  326 aa  YGFZ_SALEP RecName: Full=tRNA-modifying protein ygfZ;
   32::240     5e-11  32%  326 aa  YGFZ_SALA4 RecName: Full=tRNA-modifying protein ygfZ;
   26::240     5e-11  32%  326 aa  YGFZ_ECOLC RecName: Full=tRNA-modifying protein ygfZ;
   26::240     1e-10  31%  326 aa  YGFZ_SHIBS RecName: Full=tRNA-modifying protein ygfZ;
   26::240     1e-10  31%  326 aa  YGFZ_SHIDS RecName: Full=tRNA-modifying protein ygfZ;
   27::245     2e-10  29%  336 aa  YGFZ_BLOFL RecName: Full=tRNA-modifying protein ygfZ;
   27::241     2e-10  29%  330 aa  YGFZ_SERP5 RecName: Full=tRNA-modifying protein ygfZ;
   26::240     2e-10  34%  327 aa  YGFZ_KLEP3 RecName: Full=tRNA-modifying protein ygfZ;
   27::233     4e-10  31%  318 aa  YGFZ_VIBF1 RecName: Full=tRNA-modifying protein ygfZ;
   40::246     7e-10  33%  333 aa  YGFZ_PECCP RecName: Full=tRNA-modifying protein ygfZ;
   27::233     1e-09  31%  318 aa  YGFZ_VIBFM RecName: Full=tRNA-modifying protein ygfZ;
   40::246     1e-09  33%  333 aa  YGFZ_ERWCT RecName: Full=tRNA-modifying protein ygfZ;
   29::238     2e-09  33%  319 aa  YGFZ_BUCAP RecName: Full=tRNA-modifying protein ygfZ;
   34::241     6e-09  33%  329 aa  YGFZ_PHOPR RecName: Full=tRNA-modifying protein ygfZ;
   30::242     6e-09  34%  336 aa  YGFZ_HAMD5 RecName: Full=tRNA-modifying protein ygfZ;
   26::240     7e-09  31%  326 aa  YGFZ_ENT38 RecName: Full=tRNA-modifying protein ygfZ;
   27::241     2e-08  33%  328 aa  YGFZ_SODGM RecName: Full=tRNA-modifying protein ygfZ;
   30::243     2e-08  28%  330 aa  YGFZ_BLOPB RecName: Full=tRNA-modifying protein ygfZ;
   60::267     3e-08  32%  403 aa  CAF17_USTMA RecName: Full=Putative transferase CAF17,
   58::259     4e-08  30%  389 aa  CAF17_MAGGR RecName: Full=Putative transferase CAF17,
   28::233     6e-08  29%  323 aa  YGFZ_VIBSL RecName: Full=tRNA-modifying protein ygfZ;
   28::233     6e-08  32%  322 aa  YGFZ_VIBHB RecName: Full=tRNA-modifying protein ygfZ;
   31::230     8e-08  31%  325 aa  CAF17_SCHPO RecName: Full=Putative transferase caf17,
   26::237     1e-07  37%  324 aa  YGFZ_COLP3 RecName: Full=tRNA-modifying protein ygfZ;
   36::233     2e-07  33%  323 aa  YGFZ_VIBCM RecName: Full=tRNA-modifying protein ygfZ;
   36::233     2e-07  33%  323 aa  YGFZ_VIBCH RecName: Full=tRNA-modifying protein ygfZ;
   36::233     2e-07  33%  323 aa  YGFZ_VIBC3 RecName: Full=tRNA-modifying protein ygfZ;
   28::235     3e-07  30%  324 aa  YGFZ_VIBVU RecName: Full=tRNA-modifying protein ygfZ;
   28::235     4e-07  30%  324 aa  YGFZ_VIBVY RecName: Full=tRNA-modifying protein ygfZ;
   31::233     5e-07  30%  322 aa  YGFZ_VIBPA RecName: Full=tRNA-modifying protein ygfZ;
   30::242     9e-07  30%  325 aa  YGFZ_BAUCH RecName: Full=tRNA-modifying protein ygfZ;
   47::144     2e-06  27%  366 aa  GCST_SODGM RecName: Full=Aminomethyltransferase;       
   47::144     2e-06  28%  365 aa  GCST_SERP5 RecName: Full=Aminomethyltransferase;       
   47::144     2e-06  29%  365 aa  GCST_ENTS8 RecName: Full=Aminomethyltransferase;       
  250::341     2e-06  30%  462 aa  CAF17_ASHGO RecName: Full=Putative transferase CAF17,
   57::215     6e-06  27%  368 aa  GCST_THEP3 RecName: Full=Aminomethyltransferase;       
   56::143     8e-06  32%  363 aa  GCST_THEM4 RecName: Full=Aminomethyltransferase;       
   47::144     8e-06  28%  364 aa  GCST_PHOLL RecName: Full=Aminomethyltransferase;       
   49::147     8e-06  32%  479 aa  CAF17_YARLI RecName: Full=Putative transferase CAF17,
   23::236     1e-05  30%  318 aa  YGFZ_BUCBP RecName: Full=tRNA-modifying protein ygfZ;
   47::144     1e-05  28%  365 aa  GCST_YERPY RecName: Full=Aminomethyltransferase;       
   47::144     1e-05  28%  365 aa  GCST_YERPS RecName: Full=Aminomethyltransferase;       
   47::144     1e-05  28%  365 aa  GCST_YERPP RecName: Full=Aminomethyltransferase;       
   47::144     1e-05  28%  365 aa  GCST_YERPN RecName: Full=Aminomethyltransferase;       
   47::144     1e-05  28%  365 aa  GCST_YERPG RecName: Full=Aminomethyltransferase;       
   47::144     1e-05  28%  365 aa  GCST_YERPE RecName: Full=Aminomethyltransferase;       
   47::144     1e-05  28%  365 aa  GCST_YERPB RecName: Full=Aminomethyltransferase;       
   47::144     1e-05  28%  365 aa  GCST_YERPA RecName: Full=Aminomethyltransferase;       
   47::144     1e-05  28%  365 aa  GCST_YERP3 RecName: Full=Aminomethyltransferase;       
   47::144     1e-05  28%  365 aa  GCST_ERWT9 RecName: Full=Aminomethyltransferase;       
   47::144     2e-05  28%  365 aa  GCST_YERE8 RecName: Full=Aminomethyltransferase;       
   32::240     3e-05  30%  319 aa  YGFZ_BUCAI RecName: Full=tRNA-modifying protein ygfZ;
   47::144     4e-05  24%  362 aa  GCST_COLP3 RecName: Full=Aminomethyltransferase;       
   65::170     6e-05  34%  374 aa  GCST_THETN RecName: Full=Aminomethyltransferase;       
   47::144     8e-05  24%  360 aa  GCST_METCA RecName: Full=Aminomethyltransferase;       
  195::242     1e-04  38%  331 aa  YGFZ_EDWI9 RecName: Full=tRNA-modifying protein ygfZ;
   59::181     1e-04  29%  370 aa  GCST_CLOBK RecName: Full=Aminomethyltransferase;       
   47::144     2e-04  27%  364 aa  GCST_PROMH RecName: Full=Aminomethyltransferase;       
   47::144     2e-04  24%  359 aa  GCST_IDILO RecName: Full=Aminomethyltransferase;       
   47::144     2e-04  23%  364 aa  GCST_ENT38 RecName: Full=Aminomethyltransferase;       
   59::181     2e-04  28%  370 aa  GCST_CLOB6 RecName: Full=Aminomethyltransferase;       
   59::181     2e-04  28%  370 aa  GCST_CLOB1 RecName: Full=Aminomethyltransferase;       
  301::364     2e-04  36%  497 aa  CAF17_CANGA RecName: Full=Putative transferase CAF17,
  600::771     3e-04  25%  842 aa  KSL4_ORYSJ RecName: Full=Syn-pimara-7,15-diene synthase;       
  598::769     3e-04  25%  840 aa  KSL4_ORYSI RecName: Full=Syn-pimara-7,15-diene synthase;       
   47::144     3e-04  22%  369 aa  GCST_XANCP RecName: Full=Aminomethyltransferase;       
   47::144     3e-04  22%  369 aa  GCST_XANC8 RecName: Full=Aminomethyltransferase;       
   47::144     3e-04  23%  364 aa  GCST_SALAR RecName: Full=Aminomethyltransferase;       
   59::181     3e-04  26%  370 aa  GCST_CLOBM RecName: Full=Aminomethyltransferase;       
  199::289     4e-04  35%  458 aa  MURC_GEOUR RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   59::196     4e-04  25%  370 aa  GCST_CLOBJ RecName: Full=Aminomethyltransferase;       
  366::449     5e-04  30%  490 aa  PEAM3_ARATH RecName: Full=Putative phosphoethanolamine
  189::297     5e-04  34%  436 aa  MURC_PEDPA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   57::215     5e-04  27%  368 aa  GCST_THEPX RecName: Full=Aminomethyltransferase;       
   47::144     5e-04  21%  364 aa  GCST_SHEAM RecName: Full=Aminomethyltransferase;       
   47::144     5e-04  22%  364 aa  GCST_ECOLU RecName: Full=Aminomethyltransferase;       
   59::113     5e-04  43%  370 aa  GCST_CLOBL RecName: Full=Aminomethyltransferase;       
  335::413     5e-04  32%  497 aa  CAF17_YEAST RecName: Full=Putative transferase CAF17,
   89::244     7e-04  32%  406 aa  GCST_SOLTU RecName: Full=Aminomethyltransferase, mitochondrial;    
   47::144     7e-04  22%  364 aa  GCST_SALTY RecName: Full=Aminomethyltransferase;       
   47::144     7e-04  22%  364 aa  GCST_SALTI RecName: Full=Aminomethyltransferase;       
   47::144     7e-04  22%  364 aa  GCST_SALSV RecName: Full=Aminomethyltransferase;       
   47::144     7e-04  22%  364 aa  GCST_SALPK RecName: Full=Aminomethyltransferase;       
   47::144     7e-04  22%  364 aa  GCST_SALPC RecName: Full=Aminomethyltransferase;       
   47::144     7e-04  22%  364 aa  GCST_SALPB RecName: Full=Aminomethyltransferase;       
   47::144     7e-04  22%  364 aa  GCST_SALPA RecName: Full=Aminomethyltransferase;       
   47::144     7e-04  22%  364 aa  GCST_SALNS RecName: Full=Aminomethyltransferase;       
   47::144     7e-04  22%  364 aa  GCST_SALHS RecName: Full=Aminomethyltransferase;       
   47::144     7e-04  22%  364 aa  GCST_SALCH RecName: Full=Aminomethyltransferase;       
   47::144     7e-04  22%  364 aa  GCST_SALA4 RecName: Full=Aminomethyltransferase;       
   47::144     7e-04  22%  364 aa  GCST_CITK8 RecName: Full=Aminomethyltransferase;       
   47::144     0.001  21%  369 aa  GCST_XANOR RecName: Full=Aminomethyltransferase;       
   47::144     0.001  21%  369 aa  GCST_XANOP RecName: Full=Aminomethyltransferase;       
   47::144     0.001  21%  369 aa  GCST_XANOM RecName: Full=Aminomethyltransferase;       
   47::144     0.001  21%  364 aa  GCST_SHIB3 RecName: Full=Aminomethyltransferase;       
   47::144     0.001  21%  364 aa  GCST_SALG2 RecName: Full=Aminomethyltransferase;       
   47::144     0.001  21%  364 aa  GCST_SALEP RecName: Full=Aminomethyltransferase;       
   47::144     0.001  21%  364 aa  GCST_SALDC RecName: Full=Aminomethyltransferase;       
   47::143     0.001  24%  363 aa  GCST_SACD2 RecName: Full=Aminomethyltransferase;       
   14::70      0.001  37%  375 aa  CAF17_CRYNE RecName: Full=Putative transferase CAF17,
    1::248

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxFQYINFKILEVSGVDTKKFLQGLTTADLNGLSIDNDILLTAFANLKGRIISLCFVKFISNEKLLLSVE
Y466_HAEIN      -------YQLIEVQGADAEKYLQGQLTSDVVRLA-SGATTLTAHCDPKGKMNAIYRLFKVSSEQFFLLVK
YGFZ_YERPY      ------DWALVTLTGADRVKYLQGQVTADIDALSADQHV-LCAHCDAKGKMWSNLRL-FYRGEGLAFIER
YGFZ_YERPP      ------DWALVTLTGADRVKYLQGQVTADIDALSADQHV-LCAHCDAKGKMWSNLRL-FYRGEGLAFIER
YGFZ_YERPN      ------DWALVTLTGADRVKYLQGQVTADIDALSADQHV-LCAHCDAKGKMWSNLRL-FYRGEGLAFIER
YGFZ_YERPG      ------DWALVTLTGADRVKYLQGQVTADIDALSADQHV-LCAHCDAKGKMWSNLRL-FYRGEGLAFIER
YGFZ_YERPE      ------DWALVTLTGADRVKYLQGQVTADIDALSADQHV-LCAHCDAKGKMWSNLRL-FYRGEGLAFIER
YGFZ_YERPB      ------DWALVTLTGADRVKYLQGQVTADIDALSADQHV-LCAHCDAKGKMWSNLRL-FYRGEGLAFIER
YGFZ_YERPA      ------DWALVTLTGADRVKYLQGQVTADIDALSADQHV-LCAHCDAKGKMWSNLRL-FYRGEGLAFIER
YGFZ_YERPS      ------DWALVTLTGADRVKYLQGQVTADIDALSADQHV-LCAHCDAKGKMWSNLRL-FYRGEGLAFIER
YGFZ_YERP3      ------DWALVTLTGADRVKYLQGQVTADIDALSADQHV-LCAHCDAKGKMWSNLRL-FYRGEGLAFIER
YGFZ_PHOLL      ---------LVTATGPDTEKYLQGQVTADISALA-TNQHVLSAHCDAKGKMWSNLRL-FHRGESFAYIER
YGFZ_ECO5E      ------DWALATITGADSEKYLQGQVTADVSQMT-DDQHLLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_ECO57      ------DWALATITGADSEKYLQGQVTADVSQMT-DDQHLLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_SALAR      ------DWALATITGVDSEKYIQGQVTADVSQMT-EQQHLLTAHCDAKGKMWSNLRL-FREREGFVWIER
YGFZ_ENTS8      ------DWALATITGPDSEKYLQGQVTADVTELG-ENQHLLVAHCDAKGKMWSNLRL-FRHGDGFAWIER
YGFZ_SHISS      ------DWALATITGADSEKYMQGQVTADVSQMAEDQH-LLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_SHIB3      ------DWALATITGADSEKYMQGQVTADVSQMT-ENQHLLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_ECOSE      ------DWALATITGADSEKYMQGQVTADVSQMT-ENQHLLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_ECO7I      ------DWALATITGADSEKYMQGQVTADVSQMTEDQH-LLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_YERE8      ------DWALVTLTGADRVKYLQGQVTADIDALPTDQHV-LCAHCDAKGKMWSNLRL-FYRGEGLAFIER
YGFZ_SALTY      ------------ITGVDSEKYIQGQVTADVSQMT-EQQHLLAAHCDAKGKMWSTLRL-FRERDGFAWIER
YGFZ_SHIFL      ------DWALATITGADSEKYMQGQVTADVSQMAEDQH-LLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_SHIF8      ------DWALATITGADSEKYMQGQVTADVSQMAEDQH-LLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_SALPC      ------------ITGVDSEKYIQGQVTADVSQMT-EQQHLLAAHCDAKGKMWSTLRL-FRERDGFAWIER
YGFZ_SALDC      ------------ITGVDSEKYIQGQVTADVSQMT-EQQHLLAAHCDAKGKMWSTLRL-FRERDGFAWIER
YGFZ_SALCH      ------------ITGVDSEKYIQGQVTADVSQMT-EQQHLLAAHCDAKGKMWSTLRL-FRERDGFAWIER
YGFZ_ECOUT      ------DWALATITGADSEKYMQGQVTADVSQMTEDQH-LLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_ECOSM      ------DWALATITGADSEKYMQGQVTADVSQMTEDQH-LLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_ECOLU      ------DWALATITGADSEKYMQGQVTADVSQMTEDQH-LLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_ECOLI      ------DWALATITGADSEKYMQGQVTADVSQMAEDQH-LLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_ECOL6      ------DWALATITGADSEKYMQGQVTADVSQMTEDQH-LLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_ECOL5      ------DWALATITGADSEKYMQGQVTADVSQMTEDQH-LLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_ECOK1      ------DWALATITGADSEKYMQGQVTADVSQMTEDQH-LLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_ECOHS      ------DWALATITGADSEKYMQGQVTADVSQMAEDQH-LLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_ECODH      ------DWALATITGADSEKYMQGQVTADVSQMAEDQH-LLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_ECOBW      ------DWALATITGADSEKYMQGQVTADVSQMAEDQH-LLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_ECO8A      ------DWALATITGADSEKYMQGQVTADVSQMAEDQH-LLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_ECO81      ------DWALATITGADSEKYMQGQVTADVSQMTEDQH-LLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_ECO55      ------DWALATITGADSEKYMQGQVTADVSQMAEDQH-LLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_ECO45      ------DWALATITGADSEKYMQGQVTADVSQMTEDQH-LLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_ECO27      ------DWALATITGADSEKYMQGQVTADVSQMTEDQH-LLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_ECO24      ------DWALATITGADSEKYMQGQVTADVSQMAEDQH-LLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_SALTI      ------DWALSSITGVDSEKYIQGQVTADVSQMT-EQQHLLAAHCDAKGKMWSTLRL-FRERDGFAWIER
YGFZ_SALSV      ------DWALSSITGVDSEKYIQGQVTADVSQMT-EQQHLLAAHCDAKGKMWSTLRL-FRERDGFAWIER
YGFZ_ESCF3      ------DWALATITGTDSEKYMQGQVTADVSQMTEDQH-LLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_ALISL      ------DWALITMIGNDKKSYLQGQVTADVVTLPQD-DITFGGHCDAKGKLWSI-FQLFNHNDGYALFQR
YGFZ_SALPK      ------------ITGVDSEKYIQGQVTADVSQMT-EQQHLLAAHCDAKGKMWSTLRL-FRERDGFAWIER
YGFZ_SALPB      ------------ITGVDSEKYIQGQVTADVSQMT-EQQHLLAAHCDAKGKMWSTLRL-FRERDGFAWIER
YGFZ_SALPA      ------------ITGVDSEKYIQGQVTADVSQMT-EQQHLLAAHCDAKGKMWSTLRL-FRERDGFAWIER
YGFZ_SALNS      ------------ITGVDSEKYIQGQVTADVSQMT-EQQHLLAAHCDAKGKMWSTLRL-FRERDGFAWIER
YGFZ_SALHS      ------------ITGVDSEKYIQGQVTADVSQMT-EQQHLLAAHCDAKGKMWSTLRL-FRERDGFAWIER
YGFZ_SALG2      ------------ITGVDSEKYIQGQVTADVSQMT-EQQHLLAAHCDAKGKMWSTLRL-FRERDGFAWIER
YGFZ_SALEP      ------------ITGVDSEKYIQGQVTADVSQMT-EQQHLLAAHCDAKGKMWSTLRL-FRERDGFAWIER
YGFZ_SALA4      ------------ITGVDSEKYIQGQVTADVSQMT-EQQHLLAAHCDAKGKMWSTLRL-FRERDGFAWIER
YGFZ_ECOLC      ------DWALATITGADSEKYMQGQVTADVSQMTEDQH-LLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_SHIBS      ------DWALATITGADSEKYMQGQVTADVSQMT-ENQHLLAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_SHIDS      ------DWALATITGADSEKYMQGQVTADVSQMTEDQH-LQAAHCDAKGKMWSNLRL-FRDGDGFAWIER
YGFZ_BLOFL      ------NWILIKLQGTDIIQYLHNQFTCDIKNLN-KNQYSFAAHCNFNGRMISNMYVFYINNQKIAFIEP
YGFZ_SERP5      ------DWALVTLNGPDRVKYLQGQVTADIEALPADSHV-LCGHCDAKGKMWSNLRL-FHRGEGFAYLER
YGFZ_KLEP3      ------DWALATISGPDSEKYLQGQITADVSNLT-DAQHLLAAHCDAKGKMWS--NLRVFRRDGGFAWIE
YGFZ_VIBF1      ------DWALITMIGADKKSYLQGQVTCDVVSLAQD-EITFGGHCDAKGKLWSI-FQLFHHNDGYALFQR
YGFZ_PECCP      --------------GPDTVKYLQGQVTADVSALADDRHI-LCAHCDAKGKMWSNLRL-FHHGEGFAFIER
YGFZ_VIBFM      ------DWALITMIGADKKSYLQGQVTCDVVSLAQD-EITFGGHCDAKGKLWSI-FQLFHHNDGYALFQR
YGFZ_ERWCT      --------------GPDTVKYLQGQVTADVGALP-DNGHILCAHCDAKGKMWSNLRL-FHHGEGFAFIER
YGFZ_BUCAP      ---------LIYICGIDSKKHLQNQFTIDINCLKKE-EYKLCAHCNFNGKVWATMFI-FHYKKGFAYIIR
YGFZ_PHOPR      ---------LITLIGDDKKSYLQGQVTCDVVSLPI-NASIFGAHCDAKGKMRTI-FRLFNHNEGYGFLQR
YGFZ_HAMD5      ---------LIRVTGKDRVKYLQGQITLDVPLLK-ENQHILGAHCDPKGKILSTVRL-FHYLKGLAFITR
YGFZ_ENT38      ------DWALATISGADSEKYLQGQVTADVAQLG-EHQHLLVAHCDPKGKMWS--NLRLFRRQDGFACIE
YGFZ_SODGM      ------DWALVTLNGADTVKYLQGQLTCDVASLDADR-FSFAAHCDAKGKMFSLCV--FHHHDGMAFIER
YGFZ_BLOPB      ---------LVRLHGPDVIQCLHNQFTCDIQNLN-KHKYSFAAHCNPKGKMISNLYVFHLKNQEMAFIER
CAF17_USTMA     ---------VVQVSGRDTVKLLQGLVSNDVKALDSTTNMVYAGFMNPQGRMLADVFINQDGSPRWLLDID
CAF17_MAGGR     --------RLISVSGPDAAKYLQGVVTANI--INNNKTGFYTAFLNAQGRVLHDVFIASKDGEGFLIEVD
YGFZ_VIBSL      ------DWSAITMIGDDKKSYLQGQVTCDVVTLPNDESTL-GAHCDAKGKVWSI-FRLFHHNGGYALMQP
YGFZ_VIBHB      ------NLGMITMVGDDKKSYLHGQVTCDVVSLEKDQS-MLGAHCDAKGKVWSV-FRLFHHNDGYAMVQP
CAF17_SCHPO     ---------LIRVEGVDAVKFLQGLTT---NKITLDNPV-YTGFLNTQGRVLSFIYPKVSNNDELYVEID
YGFZ_COLP3      -------FGAISLSGEEQSKYLQGQVTCDVNSIT-ESNLLVGAHCDAKGKVFSVFRLINRSSAHLLLQPT
YGFZ_VIBCM      --------------GADKKAYLQGQVTCNVVSLQ-EQQVTFGAHCDAKGKVWSV-FRLFHHHDGYAMFQP
YGFZ_VIBCH      --------------GADKKAYLQGQVTCNVVSLQ-EQQVTFGAHCDAKGKVWSV-FRLFHHHDGYAMFQP
YGFZ_VIBC3      --------------GTDKKAYLQGQVTCNVVSLQ-EQQVTFGAHCDAKGKVWSV-FRLFHHHDGYAMFQP
YGFZ_VIBVU      ------NLGLITMTGNDKKSYLQGQVTCDVVSLETD-QVTWGGHCDAKGKLWSV-FRLFHYADGYAMLQD
YGFZ_VIBVY      ------NLGLITMTGNDKKSYLQGQVTCDVVSLEAD-QVTWGGHCDAKGKLWS-AFRLFHYGDGYAMLQD
YGFZ_VIBPA      ---------MITMVGDDKKSYLHGQVTCDVVSLEKDQSTL-GAHCDAKGKVWSV-FRLFHHGDGYGMIQP
YGFZ_BAUCH      ---------LITFNGKDAVKYLQDQLACDVTSLK-NNEYTFTVHCNTKGKVYSNVYFLHYQDGFALIT-R
GCST_SODGM      --FDVSHMTIVDLAGPRTRDFLRHLLANDVAKLTVPGKALYTGMLNASGGVIDDLIVYFLSEIEFRLVVN
GCST_SERP5      --FDVSHMTIVDLRGARTREFLRYLLANDVAKLTQPGKALYTGMLNASGGVIDDLIVYFLTEDYFRLVVN
GCST_ENTS8      --FDVSHMTIVDLRGARTREFLRYLLANDVAKLTQPGKALYTAMLNASGGVIDDLIVYFMTEDYFRLVVN
CAF17_ASHGO     ----------------------------------------------------------------------
GCST_THEP3      ----------ITVKGREAFNFLQNLITNDLSKLK-DNQVFYTFMCNYNGGVVDDLLVYKYSDEHFLLVVN
GCST_THEM4      ------------VEGKDSTKFVDFLITNDFKNLK-PGEIVYTAMCNENGGFVDDLLAYKISEEKAMLVIN
GCST_PHOLL      --FDVSHMTIVDLHGTGCRDFLRYLLANDIAKLTEKGKALYTGMLNASGGVIDDLIVYYLSNDFYRLVVN
CAF17_YARLI     ---------MVHVSGRDAAKLLNGLFTLPVSGAATPFSGVFGAFLNGKGRVITDAFLYTTSNQSFVIEFD
YGFZ_BUCBP      ------DWSFITVTGKDCFNYLQGQITYNLKLLK-SNKHIICSHCTIDGKVLSILRL-FMHNDGYAYILR
GCST_YERPY      --FDVSHMTIVDLHGNRTREFLRYLLANDVAKLTQPGKALYTGMLNESGGVIDDLIVYFLSEDYFRLVVN
GCST_YERPS      --FDVSHMTIVDLHGNRTREFLRYLLANDVAKLTQPGKALYTGMLNESGGVIDDLIVYFLSEDYFRLVVN
GCST_YERPP      --FDVSHMTIVDLHGNRTREFLRYLLANDVAKLTQPGKALYTGMLNESGGVIDDLIVYFLSEDYFRLVVN
GCST_YERPN      --FDVSHMTIVDLHGNRTREFLRYLLANDVAKLTQPGKALYTGMLNESGGVIDDLIVYFLSEDYFRLVVN
GCST_YERPG      --FDVSHMTIVDLHGNRTREFLRYLLANDVAKLTQPGKALYTGMLNESGGVIDDLIVYFLSEDYFRLVVN
GCST_YERPE      --FDVSHMTIVDLHGNRTREFLRYLLANDVAKLTQPGKALYTGMLNESGGVIDDLIVYFLSEDYFRLVVN
GCST_YERPB      --FDVSHMTIVDLHGNRTREFLRYLLANDVAKLTQPGKALYTGMLNESGGVIDDLIVYFLSEDYFRLVVN
GCST_YERPA      --FDVSHMTIVDLHGNRTREFLRYLLANDVAKLTQPGKALYTGMLNESGGVIDDLIVYFLSEDYFRLVVN
GCST_YERP3      --FDVSHMTIVDLHGNRTREFLRYLLANDVAKLTQPGKALYTGMLNESGGVIDDLIVYFLSEDYFRLVVN
GCST_ERWT9      --FDVSHMTIVDLHGARTREFLRYLLANDVAKLTQPGKALYSAMLNASAGVIDDLIVYFISEDFFRLVVN
GCST_YERE8      --FDVSHMTIVDLHGARTREFLRYLLANDVAKLTQPGKALYTAMLNASGGVIDDLIVYFLREDYFRLVVN
YGFZ_BUCAI      ------------VEGIDSKKYLQGQLTIDIN-LLLKTHHTLCAHCNFNGRVWSTMHL-FHYEKGYAYIQR
GCST_COLP3      --FDVSHMTIVDVQGADAKAFLRRLVINDVAKLATPGKALYTGMLNEEGGVIDDLIIYFFSDTDYRLVVN
GCST_THETN      ------------VKGKDAFPFLQNLLTNDLSKLN-DNQVLYTFMCNHNGGVIDDLLVYKYSNNYYLLVVN
GCST_METCA      --FDVSHLGVVDVEGLQAAPFLRRVLANDVARLAEPGRMLYGCMLNQDGGIVDDLVVGFIDDRRFRLILN
YGFZ_EDWI9      ----------------------------------------------------------------------
GCST_CLOBK      ------------VTGKDAGKFIQYLMTNDINILK-DNEVLYTFMCNEDGGVIDLLVYKFAENE-FFLVIN
GCST_PROMH      --FDVSHMTIVDLHGPQVKDFLRYLLANDVAKLTEKGKALYTGMLNASGGVIDDLIVYYFDETFYRLVVN
GCST_IDILO      --FDVSHMTIVDVEGSQAQAFLRYLLANDVAKLKTEGKAQYTSMLNENGGVIDDLIVYFFSENAYRMVVN
GCST_ENT38      --FDVSHMTIVDLRGSRTREFLRYLLANDVAKLKTPGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVN
GCST_CLOB6      ------------VKGKDAQKFVQYLMTNDINVLK-DNEVLYTFMCNEDGGVIDDLLVYKFAEDEFFLVIN
GCST_CLOB1      ------------VTGKDAGKFIQYLMTNDINVLK-DNEVLYTFMCNEDGGVIDDLLVYKFAEDEFFLVIN
CAF17_CANGA     ----------------------------------------------------------------------
KSL4_ORYSJ      ----------------------------------------------------------------------
KSL4_ORYSI      ----------------------------------------------------------------------
GCST_XANCP      --FDVSHMTVVDLHGVRVREFLRYLLANSVDKLKVSGKALYTCMLNPQGGVIDDLIVYFMQEEFFRLVVN
GCST_XANC8      --FDVSHMTVVDLHGVRVREFLRYLLANSVDKLKVSGKALYTCMLNPQGGVIDDLIVYFMQEEFFRLVVN
GCST_SALAR      --FDVSHMTIVDLHGSRTREFLRYLLANDVAKLTKTGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVN
GCST_CLOBM      ------------VTGKDAGKFIQYLMTNDINVLK-DNEVLYTFMCNEDGGVIDDLLVYKFAEDEFFLVIN
MURC_GEOUR      -------------------------------------------------------FVQFINKVPFVLCLD
GCST_CLOBJ      ------------VTGKDAGKFIQYLMTNDINVLK-DNEVLYTFMCNEDGGVIDDLLVYKFAEDEFFLVIN
PEAM3_ARATH     ----------------------------------------------------------------------
MURC_PEDPA      --------------------------------------------------------------ESAFQQVA
GCST_THEPX      ----------ITVKGREAFNFLQNLITNDLSKLK-GNQVLYTFMCNYNGGVVDDLLVYKYSDEHFYLVVN
GCST_SHEAM      --FDVSHMTVVDVEGADARAFLRKLLANDIAKLTVPGKALYGGMLNHDGGVIDDLITYYLSDTQYRVVVN
GCST_ECOLU      --FDVSHMTIVDLRGSRTREFLRYLLANDVAKLTKSGKALYSGMLNASGGVIDDLIVYYFSEDFFRLVVN
GCST_CLOBL      ------------VTGKDAGKFIQYLMTNDINVLK-DNEVLYTFMCNEDGGVIDLLVYKFAGDEFFLV---
CAF17_YEAST     ----------------------------------------------------------------------
GCST_SOLTU      ----------LSLKGKDTIPFLEKLVIADVAGLAPGTG-SLTVFTNEKGGAIDDSVVTKVTNDHIYLVVN
GCST_SALTY      --FDVSHMTIVDLHGSRTREFLRYLLANDVAKLTKTGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVN
GCST_SALTI      --FDVSHMTIVDLHGSRTREFLRYLLANDVAKLTKTGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVN
GCST_SALSV      --FDVSHMTIVDLHGSRTREFLRYLLANDVAKLTKTGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVN
GCST_SALPK      --FDVSHMTIVDLHGSRTREFLRYLLANDVAKLTKTGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVN
GCST_SALPC      --FDVSHMTIVDLHGSRTREFLRYLLANDVAKLTKTGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVN
GCST_SALPB      --FDVSHMTIVDLHGSRTREFLRYLLANDVAKLTKTGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVN
GCST_SALPA      --FDVSHMTIVDLHGSRTREFLRYLLANDVAKLTKTGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVN
GCST_SALNS      --FDVSHMTIVDLHGSRTREFLRYLLANDVAKLTKTGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVN
GCST_SALHS      --FDVSHMTIVDLHGSRTREFLRYLLANDVAKLTKTGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVN
GCST_SALCH      --FDVSHMTIVDLHGSRTREFLRYLLANDVAKLTKTGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVN
GCST_SALA4      --FDVSHMTIVDLHGSRTREFLRYLLANDVAKLTKTGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVN
GCST_CITK8      --FDVSHMTIVDLRGSRTREFLRYLLANDVAKLTKTGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVN
GCST_XANOR      --FDVSHMTVVDLHGARVRAFLRDLLANSVDKLKVCGKALYTCMLNPQGGVIDDLIVYYMSEDFFRLVVN
GCST_XANOP      --FDVSHMTVVDLHGARVRAFLRDLLANSVDKLKVCGKALYTCMLNPQGGVIDDLIVYYMSEDFFRLVVN
GCST_XANOM      --FDVSHMTVVDLHGARVRAFLRDLLANSVDKLKVCGKALYTCMLNPQGGVIDDLIVYYMSEDFFRLVVN
GCST_SHIB3      --FDVSHMTIVDLRGSRTREFLRYLLANDVAKLTKSGKALYSGMLNASGGVIDDLIVYYFTEDLFRLVVN
GCST_SALG2      --FDVSHMTIVDLHGSRTREFLRYLLANDVAKLTKTGKALYSGMLNASGGVIDDLIIYYFTEDFFRLVVN
GCST_SALEP      --FDVSHMTIVDLHGSRTREFLRYLLANDVAKLTKTGKALYSGMLNASGGVIDDLIIYYFTEDFFRLVVN
GCST_SALDC      --FDVSHMTIVDLHGSRTREFLRYLLANDVAKLTKTGKALYSGMLNASGGVIDDLIIYYFTEDFFRLVVN
GCST_SACD2      --FDVSHMTVVDVTGAGAKTFLQYVLANDVAKLTKNGKALYSGMLNHEGGVVDDLIV-YLMEWGYRVVVN
CAF17_CRYNE     ---------VLELSGPDAQKFLKGLSCKDVEYLAGG----YSGFLNASGRVLHTAFVFPRSKNSYLITHE


                         .         .         *         .         .         .         .:140
query           QEVFENLLAWLKKYGMFSKVSFNPNDDYALFFTKTGFLNHDILTKGSLTSEMTFEQVRKENIINKLATIN
Y466_HAEIN      KDILPSGLDALKKYAVFSKVSFDPNFSLEIDEKRSILLNETELPVNFNGDEKIWEVA---DIQAGLPNLS
YGFZ_YERPY      RSLLDNQLSELKKYAVFSKVVIEPQPDAVLIFTELPSAEHPVTQMGSLPAELVTDTEQAQQLVEKLAIID
YGFZ_YERPP      RSLLDNQLSELKKYAVFSKVVIEPQPDAVLIFTELPSAEHPVTQMGSLPAELVTDTEQAQQLVEKLAIID
YGFZ_YERPN      RSLLDNQLSELKKYAVFSKVVIEPQPDAVLIFTELPSAEHPVTQMGSLPAELVTDTEQAQQLVEKLAIID
YGFZ_YERPG      RSLLDNQLSELKKYAVFSKVVIEPQPDAVLIFTELPSAEHPVTQMGSLPAELVTDTEQAQQLVEKLAIID
YGFZ_YERPE      RSLLDNQLSELKKYAVFSKVVIEPQPDAVLIFTELPSAEHPVTQMGSLPAELVTDTEQAQQLVEKLAIID
YGFZ_YERPB      RSLLDNQLSELKKYAVFSKVVIEPQPDAVLIFTELPSTEHPVTQMGSLPAELVTDTEQAQQLVEKLAIID
YGFZ_YERPA      RSLLDNQLSELKKYAVFSKVVIEPQPDAVLIFTELPSAEHPVTQMGSLPAELVTDTEQAQQLVEKLAIID
YGFZ_YERPS      RSLLDNQLSELKKYAVFSKVVIAPQPDAVLIFTELPSAEHPVTQMGSLPAELVTDTEQAQQLVEKLAIID
YGFZ_YERP3      RSLLDNQLSELKKYAVFSKVVIAPQPDAVLIFTELPSAEHPVTQMGSLPAELVTDTEQAQQLVEKLAIID
YGFZ_PHOLL      RSVLENQLTELKKYAVFSKIALAPDADNAVVAHEATTLLHFLLVTNTATAEQLTEKLQAQDIEAGFPIID
YGFZ_ECO5E      RSVREPQLAELKKYAVFSKVTIAPDDERVLIFSELPSKEKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_ECO57      RSVREPQLAELKKYAVFSKVTIAPDDERVLIFSELPSKEKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_SALAR      RSVREAQLTELKKYAVFSKVVIAPDDDRVLFQARAALANRFLLVTDVATVNMLTEKLHGEAELNNIPVID
YGFZ_ENTS8      RSVRDTQLAEMKKYAVFSKVTIAPNDDAVLFQARAALANHMVITDAETASQLS-DKLHGEAQLNASAVID
YGFZ_SHISS      RSVREPQLTELKKYAVFSKVTIAPDDEHVLIFSELPSKEKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_SHIB3      RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSREKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_ECOSE      RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSKEKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_ECO7I      RSVRESQLTELKKYAVFSKVTIAPDDERVLIFSELPSKEKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_YERE8      RSVLDNQLSELKKYAVFSKVVIAAQPDAVLLFAELPNADHPVVQQGSLPAELVTDTEQAQQLVEKLAIID
YGFZ_SALTY      RSVLEAQLTELKKYAVFSKVVIAPDDERVLLFSELPNSENQVVRDGAATANMLTEKLHGEAELNNIPVID
YGFZ_SHIFL      RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSKEKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_SHIF8      RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSKEKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_SALPC      RSVLEAQLTELKKYAVFSKVVIAPDDERVLFQARAALANRFLLVTDVATANMLTEKLHGEAELNNIPAID
YGFZ_SALDC      RSVLEAQLTELKKYAVFSKVVIAPDDERVLFQARAALANRFLLVTDVATANMLTEKLHGEAELNNIPVID
YGFZ_SALCH      RSVLEAQLTELKKYAVFSKVVIAPDDERVLFQARAALANRFLLVTDVATANMLTEKLHGEAELNNIPAID
YGFZ_ECOUT      RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSREKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_ECOSM      RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSKEKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_ECOLU      RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSKEKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_ECOLI      RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSKEKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_ECOL6      RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSREKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_ECOL5      RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSREKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_ECOK1      RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSREKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_ECOHS      RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSKEKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_ECODH      RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSKEKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_ECOBW      RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSKEKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_ECO8A      RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSKEKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_ECO81      RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSREKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_ECO55      RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSKEKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_ECO45      RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSREKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_ECO27      RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSREKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_ECO24      RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSKEKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_SALTI      RSVREAQLTELKKYAVFSKVVIAPDDERVLLFSELPNSENQVVRDGAATANMLTEKLHGEAELNNIPVID
YGFZ_SALSV      RSVREAQLTELKKYAVFSKVVIAPDDERVLLFSELPNSENQVVRDGAATANMLTEKLHGEAELNNIPVID
YGFZ_ESCF3      RSVRESQLTELKKYAVFSKVTIAPDDERVLLFSELPSKEKQVIREGAVTDEATTDKLRGENIEAGFPVID
YGFZ_ALISL      RSAIETELTEIKKYSVFSKVDIAVGDDVLLGISATDWVNKHTTTDANVRAELTFAKIHKKNIINQLPQLD
YGFZ_SALPK      RSVREAQLTELKKYAVFSKVVIAPDDERVLLFSELPNSENQVVRDGAATANMLTEKLHGEAELNNIPVID
YGFZ_SALPB      RSVREAQLTELKKYAVFSKVVIAPDDERVLLFSELPNSENQVVRDGAATANMLTEKLHGEAELNNIPVID
YGFZ_SALPA      RSVREAQLTELKKYAVFSKVVIAPDDERVLLFSELPNSENQVVRDGAATANMLTEKLHGEAELNNIPVID
YGFZ_SALNS      RSVREAQLTELKKYAVFSKVVIAPDDERVLLFSELPNSENQVVRDGAATANMLTEKLHGEAELNNIPVID
YGFZ_SALHS      RSVREAQLTELKKYAVFSKVVIAPDDERVLLFSELPNSENQVVRDGAATANMLTEKLHGEAELNNIPVID
YGFZ_SALG2      RSVREAQLTELKKYAVFSKVVIAPDDERVLLFSELPNSENQVVRDGAATANMLTEKLHGEAELNNIPVID
YGFZ_SALEP      RSVREAQLTELKKYAVFSKVVIAPDDERVLLFSELPNSENQVVRDGAATANMLTEKLHGEAELNNIPVID
YGFZ_SALA4      RSVREAQLTELKKYAVFSKVVIAPDDERVLLFSELPNSENQVVRDGAATANMLTEKLHGEAELNNIPVID
YGFZ_ECOLC      RSVREPQLTELKKYAVFSKVTIAPDDERVLFQARAALANRFLIVTDEATANMLTDKLRGENIEAGFPVID
YGFZ_SHIBS      RSVREPQLTELKKYAVFSKVTIAADDERVLLFSELPSREKQVVKEGAATANMLTDKLRGENIEAGFPVID
YGFZ_SHIDS      RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSKEKQVVREGAATANMLTDKLRGENIEAGFPVID
YGFZ_BLOFL      LNIHHKQISIMQKYATFSNVTITPDYNVTLFFTTLPDTKNMVIHYPGITLLIIYDQTILDFLLNKTQSID
YGFZ_SERP5      RSVLDSQLAEIKKYAVFSKLTIAADSEAVLLFNSLPDAEHQVVQDGETTAEQLVDKLHEQAELNDYPVID
YGFZ_KLEP3      RRSLRDVLTELKKYAVFSKVTIAANDDLVLWFEHPGLLVTDVDTANRVTDALRGEQWLALNIEAGLPVID
YGFZ_VIBF1      KSAIETELTEIKKYAVFSKVDISISDEILLGFTGDKALHTDSNANVRVSKFGTFAKVSDHHIKHALPQID
YGFZ_PECCP      RNLRDAQLSELKKYAVFSKTTIAPDDNAVLLFSQLPDADHPVVQHEGATSASLLEQLGDKVSLNDQPIID
YGFZ_VIBFM      KSAIETELTEIKKYAVFSKVDISISDDILLGFTGDKALHTDSNANVRVSKFGTFAKVSDHHIKHALPQLD
YGFZ_ERWCT      RNLRDVQLSELKKYAVFSKTAIAPDDNTILLFSQLPDAEHPVVQHEGATSASLLEQLGDKVSLNDQPIID
YGFZ_BUCAP      KSIAKIQIKELKKYAIFSKVEIRELDDIYLFFNAKFFLSKNFVDIPNKNCSLISNQDRXENEITLLPIID
YGFZ_PHOPR      KSVMEIQLPELKKYAVFSKVDIEASSDVLLGLSGPGDGDVRVITAGTAIKVFAIAPEQAEQLINTLVRID
YGFZ_HAMD5      KSLLHDELMELRKYAVFSKVEIDHEDDYSLLLVSQAFKEGDFLIQ-KLQDQAVFEQWLALDIESGFPIID
YGFZ_ENT38      RRSLRDALTELKKYAVFSKVTIVADDENVLLVTSLLWFEHPLLVTDVATADRVTEALRGENIEAGLPIID
YGFZ_SODGM      RSVRDSQLAELKKYAVFSKTTITPNDTTLLYFSLPAALQHKLEGQAQLNDS---QQWLALDIEAGYPVID
YGFZ_BLOPB      LNICKKQIEEMKKYMVFSNVTVIPDNHLSMFFSVLPNKTHTIIHTQDVTSERFLLIINKKSVLDYLLNIE
CAF17_USTMA     SRTLPSLVAFIKKFKLRSKVKLTDSTDYHVVIGYRGVLSAEILDVAAAASTVDGLEYTLHRITNGVAE-G
CAF17_MAGGR     ATEAERLTRHIKRYKLRAKLNLRLLDDKADFAPAVGMLGYRVLTPGAQTPQLDLDPTPETSYRIRRYLQG
YGFZ_VIBSL      KSAIEVELVEIKKYAVFSKVDIEQTSDVVIGVSADQYIDSISESQGALVSSSTAEKVSEHEILDAQPNLS
YGFZ_VIBHB      KSAIEVELKEIKKYAVFSKVTIEESSDIVLAFIST--LNADSLLEDSQATLTTHELWTRFDIEAALPYVA
CAF17_SCHPO     KVAESDFLKHLKKYNLRSRCSIAPSEELSI------KVIWDVKEESRLKDTVAYPRFSKQRLLRMIVPXX
YGFZ_COLP3      ASI-EGSLKELKKFGVFAKVTID-----------------------------------------------
YGFZ_VIBCM      QSAMEVELRELKKYAIFSKVTIAESSDIAL-----GVMGSQADAWIDTVSETTGDVRRRMSPQRWLLLVN
YGFZ_VIBCH      QSAMEVELRELKKYAIFSKVTIAESSDIAL-----GVMGSQADAWIDTVSETTGDVRRRMSPQRWLLLVN
YGFZ_VIBC3      QSAMEVELRELKKYAIFSKVTIAESSDIAL-----GVMGSQADAWIDTVSETTGDVRRRMSPQRWLLLVN
YGFZ_VIBVU      KSAIDVELRELKKYAVFAKVEINVSD--AILLGVCGVQAEQAIAKLTNNAEVTFAQNQQDEVLAMLATIP
YGFZ_VIBVY      KSAIDVELRELKKYAVFAKVEINVSD--AILLGVCGVQAEQAIAKLTNNAEATFAQNQQDEVLAMLATIP
YGFZ_VIBPA      KSAIEIELKEIKKYAVFSKVTIEESNDVILGVAGVSALNEDALIENSDATLTTRELWTRFDIESALPFVS
YGFZ_BAUCH      KSVYANELNIFKKYAIFYTVNINFHQNKILLGI-AGLQVKDILSQNLILKKLTKYKIQTNNSKQWLALID
GCST_SODGM      SETRDKDVEWITRHAEPYQVTVTVRDDLAL----------------------------------------
GCST_SERP5      SATREKDLAWIEEHAAPYGVALTVRDDLAL----------------------------------------
GCST_ENTS8      SATREKDLAWINEHAEPYGVSVTVRDDLSL----------------------------------------
CAF17_ASHGO     -----------KKSNIFYMVTTGDVDDIATLFSP------QMVSSKTTAVSVPYTEVRRARLRRGLEGVS
GCST_THEP3      AANIEKDYKWMKDNKGVYEVEINNISDEISELAVQGPKAEEILQKLTYTSEIKFFYFKDECLVSRTGYTG
GCST_THEM4      ASNIEKDFSWMKKISSFDVTLENKSDEYVL----------------------------------------
GCST_PHOLL      SATREKDLAWINEHVANYPVDIQVRDDLAL----------------------------------------
CAF17_YARLI     KAVEDELLLHLKRHRIRAKVKMEKLTDYECIF--------------------------------------
YGFZ_BUCBP      KSTSKFQINELKKYSIFSHVNICQKKDIILL----GIMGREARTKKNIPHERDSVYQENDVIILKLALEI
GCST_YERPY      SATRDKDLAWISQHAEPYQVEVTVRDDLAL----------------------------------------
GCST_YERPS      SATRDKDLAWISQHAEPYQVEVTVRDDLAL----------------------------------------
GCST_YERPP      SATRDKDLAWISQHAEPYQVEVTVRDDLAL----------------------------------------
GCST_YERPN      SATRDKDLAWISQHAEPYQVEVTVRDDLAL----------------------------------------
GCST_YERPG      SATRDKDLAWISQHAEPYQVEVTVRDDLAL----------------------------------------
GCST_YERPE      SATRDKDLAWISQHAEPYQVEVTVRDDLAL----------------------------------------
GCST_YERPB      SATRDKDLAWISQHAEPYQVEVTVRDDLAL----------------------------------------
GCST_YERPA      SATRDKDLAWISQHAEPYQVEVTVRDDLAL----------------------------------------
GCST_YERP3      SATRDKDLAWISQHAEPYQVEVTVRDDLAL----------------------------------------
GCST_ERWT9      SATREKDLAWIVEHAAAYGVQLTERDDLSL----------------------------------------
GCST_YERE8      SATREKDLNWIIQHAEPYQVDVTVRDDLAL----------------------------------------
YGFZ_BUCAI      KSVSQIQIKEICKYSIFSKIKIRELNSICLLFVKIPNQSCPVINKTILWYEKPSERXXXKRKINQNIFLN
GCST_COLP3      SATRVKDLAWMTKQSTGFDITITERPEFGM----------------------------------------
GCST_THETN      AANIEKDYKWMLNNAGIYKVEIENVSDKIAELAIQGPKAEEILQK--LTDE-------------------
GCST_METCA      AGTREKDLSWLHRQAAPFSVTVTPRDDLAM----------------------------------------
YGFZ_EDWI9      ------------------------------------------------------------DIESGIPLID
GCST_CLOBK      ASNKDKDVKWIMDHKGDFDVEIVDESDSIAQLALQGPLAEEILQKDIDLQEIKFFKLKRDVLVN------
GCST_PROMH      SATREKDLAWITEHAKDYVVDIQVRDDLAL----------------------------------------
GCST_IDILO      SATRDRDLAWIEKVAADFDVTTKERDDMGM----------------------------------------
GCST_ENT38      SATREKDLSWISQHAEKYAVEITVRDDLSL----------------------------------------
GCST_CLOB6      ASNKDKDVKWILDHGDFDVEIVDVSDSIAQLAFQ-GPLAEEILQKDVDLQEIKFFKLKRDVLVN------
GCST_CLOB1      ASNKDKDVKWIMDHGDFDVEIVDVSDSIAQLAFQ-GPLAEEILQKDVDLQEIKFFKLKRDVLVN------
CAF17_CANGA     ----------------------------------------------------TFEKLEKDSSFFKQCKLD
KSL4_ORYSJ      KEEQENLISLVEKWDQYHKVEFYSENVKAVFFALYSTVNQ----LGAMASAVQNRDVTKYNVLRSLATDA
KSL4_ORYSI      KEEQENLISLVEKWDQYHKVEFYSENVKAVFFALYSTVNQ----LGAMASAVQNRDVTKYNVLRSLATDA
GCST_XANCP      AATRDKDLQWIGEQAARFEVRVKERADFAM----------------------------------------
GCST_XANC8      AATRDKDLQWIGEQAARFEVRVKERADFAM----------------------------------------
GCST_SALAR      SATREKDLAWITQHAEPYAIDITVRDDLSL----------------------------------------
GCST_CLOBM      ASNKDKDVKWIMDHKGDFDVEIADVSDSIAQLALQGPLAEEILQKDVDLQEIKFFKLRRDVLVD------
MURC_GEOUR      NGNIADIIPLVKKYGLSTQADFRATDVRHTGFT-TSFVAH---YKGTLLGEITFSMPGAHNVLNALATIA
GCST_CLOBJ      --------------------ASNKDKDVKWIMDHKGDFDVEIVDVSDSIAQLAFQGPLAEEILQKIVDVD
PEAM3_ARATH     --LFRRFYKWLKPGGKYCRSPKTPSPDFAIYIKKRGYDLHDVQAYGQMLRDAGFEEV--------IAEDR
MURC_PEDPA      DQVHKGIFAWLRKINTSVPVYYKENDDFQISRTTTGS-EFDVIHKGEKLGRFTINLFGEHNVLNSLAVIA
GCST_THEPX      AANIEKDYKWMKDNKGVYEVEIENISDEVAELAIQGPKAEEILQKLTDTSEIKFDNVKIECLVSRTGYTG
GCST_SHEAM      SATREKDLAWIGEQAKGFDVTITERPELAM----------------------------------------
GCST_ECOLU      SATREKDLSWITQHAEPFGIEITVRDDLSM----------------------------------------
GCST_CLOBL      ----------------------------------------------------------------------
CAF17_YEAST     ----------------------------------------------------------------------
GCST_SOLTU      AGCRDKDLAHIEEHMKSFKVSWHIHDERSLLALQ-GPLAAPVLTKDDL-SKMYFGEFRVLDILTRTGYTG
GCST_SALTY      SATREKDLSWITQHAEPYAIDITVRDDLSL----------------------------------------
GCST_SALTI      SATREKDLSWITQHAEPYAIDITVRDDLSL----------------------------------------
GCST_SALSV      SATREKDLSWITQHAEPYAIDITVRDDLSL----------------------------------------
GCST_SALPK      SATREKDLSWITQHAEPYAIDITVRDDLSL----------------------------------------
GCST_SALPC      SATREKDLSWITQHAEPYAIDITVRDDLSL----------------------------------------
GCST_SALPB      SATREKDLSWITQHAEPYAIDITVRDDLSL----------------------------------------
GCST_SALPA      SATREKDLSWITQHAEPYAIDITVRDDLSL----------------------------------------
GCST_SALNS      SATREKDLSWITQHAEPYAIDITVRDDLSL----------------------------------------
GCST_SALHS      SATREKDLSWITQHAEPYAIDITVRDDLSL----------------------------------------
GCST_SALCH      SATREKDLSWITQHAEPYAIDITVRDDLSL----------------------------------------
GCST_SALA4      SATREKDLSWITQHAEPYAIDITVRDDLSL----------------------------------------
GCST_CITK8      SATREKDLSWITQHAEPYAIDITVRDDLSL----------------------------------------
GCST_XANOR      AATREKDLQWIGEQAVRFDVRVEERSDFAM----------------------------------------
GCST_XANOP      AATREKDLQWIGEQAVRFDVRVEERSDFAM----------------------------------------
GCST_XANOM      AATREKDLQWIGEQAVRFDVRVEERSDFAM----------------------------------------
GCST_SHIB3      SATREKDLSWITQHAEPFGIEITVRDDLSM----------------------------------------
GCST_SALG2      SATREKDLSWITQHAEPYAIDITVRDDLSL----------------------------------------
GCST_SALEP      SATREKDLSWITQHAEPYAIDITVRDDLSL----------------------------------------
GCST_SALDC      SATREKDLSWITQHAEPYAIDITVRDDLSL----------------------------------------
GCST_SACD2      CATREKDLAWMVEHAKGFEVALNERDDLAM----------------------------------------
CAF17_CRYNE     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AANFEKFLPAELDLDNVDKVVCYTKGCYMGQEVIARMHYXXXXXXXXXXXXXXSDIDDFDLKDSEGKPLA
Y466_HAEIN      PQTQNEFIPQALNLQAIEQAISFTKGCYIGQETVARAKYRGANKRAMFIFKVQTQQEEIEMQEANWRKTG
YGFZ_YERPY      AANSAQFIPQATNIQALNG-ISFTKGCYTGQEMVARAKY-------------------------------
YGFZ_YERPP      AANSAQFIPQATNIQALNG-ISFTKGCYTGQEMVARAKY-------------------------------
YGFZ_YERPN      AANSAQFIPQATNIQALNG-ISFTKGCYTGQEMVARAKY-------------------------------
YGFZ_YERPG      AANSAQFIPQATNIQALNG-ISFTKGCYTGQEMVARAKY-------------------------------
YGFZ_YERPE      AANSAQFIPQATNIQALNG-ISFTKGCYTGQEMVARAKY-------------------------------
YGFZ_YERPB      AANSAQFIPQATNIQALNG-ISFTKGCYTGQEMVARAKY-------------------------------
YGFZ_YERPA      AANSAQFIPQATNIQALNG-ISFTKGCYTGQEMVARAKY-------------------------------
YGFZ_YERPS      AANSAQFIPQATNIQALNG-ISFTKGCYTGQEMVARAKY-------------------------------
YGFZ_YERP3      AANSAQFIPQATNIQALNG-ISFTKGCYTGQEMVARAKY-------------------------------
YGFZ_PHOLL      AANSTQFIPQATNLQALAGGVCFKKGCYTGQEMVARAKY-------------------------------
YGFZ_ECO5E      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_ECO57      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_SALAR      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_ENTS8      APNSNQFIPQATNIQALGG-ISFKKGCYAGQEMVARAKF-------------------------------
YGFZ_SHISS      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_SHIB3      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_ECOSE      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_ECO7I      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_YERE8      TDSSAQFIPQATNIQALNG-ISFSKGCYTGQEMVARAKY-------------------------------
YGFZ_SALTY      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_SHIFL      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_SHIF8      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_SALPC      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_SALDC      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_SALCH      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_ECOUT      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_ECOSM      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_ECOLU      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_ECOLI      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_ECOL6      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_ECOL5      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_ECOK1      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_ECOHS      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_ECODH      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_ECOBW      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_ECO8A      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_ECO81      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_ECO55      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_ECO45      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_ECO27      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_ECO24      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_SALTI      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_SALSV      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_ESCF3      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_ALISL      NALSNAHIPQAMNLQAVGGI-SFAKGCYTGQETVARAKY-------------------------------
YGFZ_SALPK      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_SALPB      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_SALPA      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_SALNS      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_SALHS      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_SALG2      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_SALEP      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_SALA4      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_ECOLC      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_SHIBS      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_SHIDS      AANSGQFIPQATNLQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_BLOFL      FATSELFFPQAANMD-ILQGISFNKGCYIGQELVARIHY-------------------------------
YGFZ_SERP5      AANSGQFIPQATNLQALDG-ISFSKGCYTGQEMVARAKF-------------------------------
YGFZ_KLEP3      SANSGQFIPQATNLQALGG-ISFRKGCYTGQEMVARAKF-------------------------------
YGFZ_VIBF1      APLCNEHIPQALNLQAING-ISFKKGCYTGQETVARAKY-------------------------------
YGFZ_PECCP      SANSAQFIPQATNLQALNG-ISFSKGCYTGQEMVARAKY-------------------------------
YGFZ_VIBFM      DQLCNEHIPQALNLQAING-ISFKKGCYTGQETVARAKY-------------------------------
YGFZ_ERWCT      SANSAQFIPQATNLQALNG-ISFSKGCYTGQEMVARAKY-------------------------------
YGFZ_BUCAP      KQTSQKFLPQSINLILL-QAVSFDKGCYYGQETIARV---------------------------------
YGFZ_PHOPR      AVTALEFIPQAVNLQAVDG-ISFKKGCYTGQETVARAKY-------------------------------
YGFZ_HAMD5      AKNKTQFIPQAANLKALGG-ISFTKGCYTGQEVVARTEY-------------------------------
YGFZ_ENT38      AVNSAQFIPQATNIQALGG-ISFKKGCYTGQEMVARAKF-------------------------------
YGFZ_SODGM      SANGTQFIPQAANVQALDGI-SFNKGCYAGQEMVARAKY-------------------------------
YGFZ_BLOPB      PITSELFIPQAVNMDILDGI-SFNKGCYIGQESIARIKY-------------------------------
CAF17_USTMA     ALDFPQSLPLENNLDYMHG-VDFRKGCYVGQELTARTHH-------------------------------
CAF17_MAGGR     VAEREHALPAESNMD-VTGAIDFRKGCYVGQELTIRTRH-------------------------------
YGFZ_VIBSL      KAEQNEHIPQALNLQAIGG-ISFSKGCYTGQETVARAKY-------------------------------
YGFZ_VIBHB      ADAQNEHIPQALNVQALGG-ISFTKGCYTGQETVARAKY-------------------------------
CAF17_SCHPO     XXDYKVFFPLESNMDWM-KGIDFHKGCYLGQELTVRTYY-------------------------------
YGFZ_COLP3      ------YVPQMLNLQAINGI-SFTKGCYLGQETVARMQY-------------------------------
YGFZ_VIBCM      AEQAEQYIPQALNVQAVDG-ISFTKGCYTGQETVARAKY-------------------------------
YGFZ_VIBCH      AEQAEQYIPQALNVQAVDG-ISFTKGCYTGQETVARAKY-------------------------------
YGFZ_VIBC3      AEQAEQYIPQALNVQAVDG-ISFTKGCYTGQETVARAKY-------------------------------
YGFZ_VIBVU      AFAQNEHIPQAVNLQAVNG-ISFKKGCYTGQETVARAKY-------------------------------
YGFZ_VIBVY      AFAQNEHIPQAVNLQAVNG-ISFKKGCYTGQETVARAKY-------------------------------
YGFZ_VIBPA      ATAQNEHIPQALNIQALGG-ISFTKGCYTGQETVARAKY-------------------------------
YGFZ_BAUCH      QINSELLLPQALNIEALGGI-SFNKGCYLGQEAIARTKY-------------------------------
GCST_SODGM      ----------------------------------------------------------------------
GCST_SERP5      ----------------------------------------------------------------------
GCST_ENTS8      ----------------------------------------------------------------------
CAF17_ASHGO     ELRSEAVLPLEVNFDLYEDAVSFDKGCYVGQELTARTH--------------------------------
GCST_THEP3      EDGFEIYMPNKYAVELWEKII-------------------------------------------------
GCST_THEM4      ----------------------------------------------------------------------
GCST_PHOLL      ----------------------------------------------------------------------
CAF17_YARLI     ----------------------------------------------------------------------
YGFZ_BUCBP      ASNFKKFFPQSLNLEKLNGLDL-KKGCYYGQEMIAKIHF-------------------------------
GCST_YERPY      ----------------------------------------------------------------------
GCST_YERPS      ----------------------------------------------------------------------
GCST_YERPP      ----------------------------------------------------------------------
GCST_YERPN      ----------------------------------------------------------------------
GCST_YERPG      ----------------------------------------------------------------------
GCST_YERPE      ----------------------------------------------------------------------
GCST_YERPB      ----------------------------------------------------------------------
GCST_YERPA      ----------------------------------------------------------------------
GCST_YERP3      ----------------------------------------------------------------------
GCST_ERWT9      ----------------------------------------------------------------------
GCST_YERE8      ----------------------------------------------------------------------
YGFZ_BUCAI      NSKQWLLLDIEAGLPVIDKIISFKKGCYYGQETIARIFF-------------------------------
GCST_COLP3      ----------------------------------------------------------------------
GCST_THETN      ----------------------------------------------------------------------
GCST_METCA      ----------------------------------------------------------------------
YGFZ_EDWI9      EPNCDSFLPQAVNLQALGGI-SFTKGCYSGQEMVARAKY-------------------------------
GCST_CLOBK      ----------------------------------------------------------------------
GCST_PROMH      ----------------------------------------------------------------------
GCST_IDILO      ----------------------------------------------------------------------
GCST_ENT38      ----------------------------------------------------------------------
GCST_CLOB6      ----------------------------------------------------------------------
GCST_CLOB1      ----------------------------------------------------------------------
CAF17_CANGA     AIQPDSLMPLELNFDYFPNTVSNNKGCYVGQELTARTY--------------------------------
KSL4_ORYSJ      EWQRSKYVPVTFALGPTILIALYFMGQNLWEDIVKNAEYDELFRLMNTCGRLQNDIQSFERECKDGK--L
KSL4_ORYSI      EWQRSKYVPVTFALGPTILIALYFMGQNLWEDIVKNAEYDELFRLMNTCGRLQNDIQSFERECKDGK--L
GCST_XANCP      ----------------------------------------------------------------------
GCST_XANC8      ----------------------------------------------------------------------
GCST_SALAR      ----------------------------------------------------------------------
GCST_CLOBM      ----------------------------------------------------------------------
MURC_GEOUR      VA--------------------------------------------------------------------
GCST_CLOBJ      LQEI-KFFKLKRDVLVDGKKCLVSRTGYTGED--------------------------------------
PEAM3_ARATH     TDQFMKVLKRELDAVEKEK---------------------------------------------------
MURC_PEDPA      VAYFEK-----VDLDLVQKELLTYQG--------------------------------------------
GCST_THEPX      EDGFEIYMPNKYAVELWEKIV-------------------------------------------------
GCST_SHEAM      ----------------------------------------------------------------------
GCST_ECOLU      ----------------------------------------------------------------------
GCST_CLOBL      ----------------------------------------------------------------------
CAF17_YEAST     ----ETLLPLELNFDFFPNTISTNKGCYVGQELTARTY----ATGILRKRLVPVKLDNYQLLDTDPEHID
GCST_SOLTU      EDGFEISVPSENALD-------------------------------------------------------
GCST_SALTY      ----------------------------------------------------------------------
GCST_SALTI      ----------------------------------------------------------------------
GCST_SALSV      ----------------------------------------------------------------------
GCST_SALPK      ----------------------------------------------------------------------
GCST_SALPC      ----------------------------------------------------------------------
GCST_SALPB      ----------------------------------------------------------------------
GCST_SALPA      ----------------------------------------------------------------------
GCST_SALNS      ----------------------------------------------------------------------
GCST_SALHS      ----------------------------------------------------------------------
GCST_SALCH      ----------------------------------------------------------------------
GCST_SALA4      ----------------------------------------------------------------------
GCST_CITK8      ----------------------------------------------------------------------
GCST_XANOR      ----------------------------------------------------------------------
GCST_XANOP      ----------------------------------------------------------------------
GCST_XANOM      ----------------------------------------------------------------------
GCST_SHIB3      ----------------------------------------------------------------------
GCST_SALG2      ----------------------------------------------------------------------
GCST_SALEP      ----------------------------------------------------------------------
GCST_SALDC      ----------------------------------------------------------------------
GCST_SACD2      ----------------------------------------------------------------------
CAF17_CRYNE     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NVVNKVFVDNQCYMLVVFHKEASEQEYQLDDGKIIxxx
Y466_HAEIN      TITSAVNLDGVLWLQVVMNNDISEQQFRLLNSEIL---
YGFZ_YERPY      --------------------------------------
YGFZ_YERPP      --------------------------------------
YGFZ_YERPN      --------------------------------------
YGFZ_YERPG      --------------------------------------
YGFZ_YERPE      --------------------------------------
YGFZ_YERPB      --------------------------------------
YGFZ_YERPA      --------------------------------------
YGFZ_YERPS      --------------------------------------
YGFZ_YERP3      --------------------------------------
YGFZ_PHOLL      --------------------------------------
YGFZ_ECO5E      --------------------------------------
YGFZ_ECO57      --------------------------------------
YGFZ_SALAR      --------------------------------------
YGFZ_ENTS8      --------------------------------------
YGFZ_SHISS      --------------------------------------
YGFZ_SHIB3      --------------------------------------
YGFZ_ECOSE      --------------------------------------
YGFZ_ECO7I      --------------------------------------
YGFZ_YERE8      --------------------------------------
YGFZ_SALTY      --------------------------------------
YGFZ_SHIFL      --------------------------------------
YGFZ_SHIF8      --------------------------------------
YGFZ_SALPC      --------------------------------------
YGFZ_SALDC      --------------------------------------
YGFZ_SALCH      --------------------------------------
YGFZ_ECOUT      --------------------------------------
YGFZ_ECOSM      --------------------------------------
YGFZ_ECOLU      --------------------------------------
YGFZ_ECOLI      --------------------------------------
YGFZ_ECOL6      --------------------------------------
YGFZ_ECOL5      --------------------------------------
YGFZ_ECOK1      --------------------------------------
YGFZ_ECOHS      --------------------------------------
YGFZ_ECODH      --------------------------------------
YGFZ_ECOBW      --------------------------------------
YGFZ_ECO8A      --------------------------------------
YGFZ_ECO81      --------------------------------------
YGFZ_ECO55      --------------------------------------
YGFZ_ECO45      --------------------------------------
YGFZ_ECO27      --------------------------------------
YGFZ_ECO24      --------------------------------------
YGFZ_SALTI      --------------------------------------
YGFZ_SALSV      --------------------------------------
YGFZ_ESCF3      --------------------------------------
YGFZ_ALISL      --------------------------------------
YGFZ_SALPK      --------------------------------------
YGFZ_SALPB      --------------------------------------
YGFZ_SALPA      --------------------------------------
YGFZ_SALNS      --------------------------------------
YGFZ_SALHS      --------------------------------------
YGFZ_SALG2      --------------------------------------
YGFZ_SALEP      --------------------------------------
YGFZ_SALA4      --------------------------------------
YGFZ_ECOLC      --------------------------------------
YGFZ_SHIBS      --------------------------------------
YGFZ_SHIDS      --------------------------------------
YGFZ_BLOFL      --------------------------------------
YGFZ_SERP5      --------------------------------------
YGFZ_KLEP3      --------------------------------------
YGFZ_VIBF1      --------------------------------------
YGFZ_PECCP      --------------------------------------
YGFZ_VIBFM      --------------------------------------
YGFZ_ERWCT      --------------------------------------
YGFZ_BUCAP      --------------------------------------
YGFZ_PHOPR      --------------------------------------
YGFZ_HAMD5      --------------------------------------
YGFZ_ENT38      --------------------------------------
YGFZ_SODGM      --------------------------------------
YGFZ_BLOPB      --------------------------------------
CAF17_USTMA     --------------------------------------
CAF17_MAGGR     --------------------------------------
YGFZ_VIBSL      --------------------------------------
YGFZ_VIBHB      --------------------------------------
CAF17_SCHPO     --------------------------------------
YGFZ_COLP3      --------------------------------------
YGFZ_VIBCM      --------------------------------------
YGFZ_VIBCH      --------------------------------------
YGFZ_VIBC3      --------------------------------------
YGFZ_VIBVU      --------------------------------------
YGFZ_VIBVY      --------------------------------------
YGFZ_VIBPA      --------------------------------------
YGFZ_BAUCH      --------------------------------------
GCST_SODGM      --------------------------------------
GCST_SERP5      --------------------------------------
GCST_ENTS8      --------------------------------------
CAF17_ASHGO     --------------------------------------
GCST_THEP3      --------------------------------------
GCST_THEM4      --------------------------------------
GCST_PHOLL      --------------------------------------
CAF17_YARLI     --------------------------------------
YGFZ_BUCBP      --------------------------------------
GCST_YERPY      --------------------------------------
GCST_YERPS      --------------------------------------
GCST_YERPP      --------------------------------------
GCST_YERPN      --------------------------------------
GCST_YERPG      --------------------------------------
GCST_YERPE      --------------------------------------
GCST_YERPB      --------------------------------------
GCST_YERPA      --------------------------------------
GCST_YERP3      --------------------------------------
GCST_ERWT9      --------------------------------------
GCST_YERE8      --------------------------------------
YGFZ_BUCAI      --------------------------------------
GCST_COLP3      --------------------------------------
GCST_THETN      --------------------------------------
GCST_METCA      --------------------------------------
YGFZ_EDWI9      --------------------------------------
GCST_CLOBK      --------------------------------------
GCST_PROMH      --------------------------------------
GCST_IDILO      --------------------------------------
GCST_ENT38      --------------------------------------
GCST_CLOB6      --------------------------------------
GCST_CLOB1      --------------------------------------
CAF17_CANGA     --------------------------------------
KSL4_ORYSJ      NSVSLLVLDSKDVMSVEEAKEA----------------
KSL4_ORYSI      NSVSLLVLDSKDVMSVEEAKEA----------------
GCST_XANCP      --------------------------------------
GCST_XANC8      --------------------------------------
GCST_SALAR      --------------------------------------
GCST_CLOBM      --------------------------------------
MURC_GEOUR      --------------------------------------
GCST_CLOBJ      --------------------------------------
PEAM3_ARATH     --------------------------------------
MURC_PEDPA      --------------------------------------
GCST_THEPX      --------------------------------------
GCST_SHEAM      --------------------------------------
GCST_ECOLU      --------------------------------------
GCST_CLOBL      --------------------------------------
CAF17_YEAST     NVVEKSLAENE---------------------------
GCST_SOLTU      --------------------------------------
GCST_SALTY      --------------------------------------
GCST_SALTI      --------------------------------------
GCST_SALSV      --------------------------------------
GCST_SALPK      --------------------------------------
GCST_SALPC      --------------------------------------
GCST_SALPB      --------------------------------------
GCST_SALPA      --------------------------------------
GCST_SALNS      --------------------------------------
GCST_SALHS      --------------------------------------
GCST_SALCH      --------------------------------------
GCST_SALA4      --------------------------------------
GCST_CITK8      --------------------------------------
GCST_XANOR      --------------------------------------
GCST_XANOP      --------------------------------------
GCST_XANOM      --------------------------------------
GCST_SHIB3      --------------------------------------
GCST_SALG2      --------------------------------------
GCST_SALEP      --------------------------------------
GCST_SALDC      --------------------------------------
GCST_SACD2      --------------------------------------
CAF17_CRYNE     --------------------------------------