[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD31135.1

[Show Plain Result]


## Summary of Sequence Search
    1::292
    9::279     1e-82  56%  281 aa  RP32_HAEIN RecName: Full=RNA polymerase sigma-32 factor;
   10::282     4e-81  52%  285 aa  RP32_VIBVU RecName: Full=RNA polymerase sigma-32 factor;
   15::283     3e-80  53%  284 aa  RP32_CITFR RecName: Full=RNA polymerase sigma-32 factor;AltName:
   10::283     3e-79  52%  286 aa  RP32_VIBCH RecName: Full=RNA polymerase sigma-32 factor;
   11::282     3e-79  52%  284 aa  RP32_PSEAE RecName: Full=RNA polymerase sigma-32 factor;
   15::283     5e-79  53%  284 aa  RP32_ECOLI RecName: Full=RNA polymerase sigma-32 factor;AltName:
   15::283     5e-79  53%  284 aa  RP32_ECOL6 RecName: Full=RNA polymerase sigma-32 factor;AltName:
   15::283     5e-79  53%  284 aa  RP32_ECO57 RecName: Full=RNA polymerase sigma-32 factor;AltName:
   10::283     4e-76  52%  284 aa  RP32_BUCAI RecName: Full=RNA polymerase sigma-32 factor;
   10::284     5e-76  53%  285 aa  RP32_SERMA RecName: Full=RNA polymerase sigma-32 factor;
   10::285     6e-76  53%  285 aa  RP32_BUCAP RecName: Full=RNA polymerase sigma-32 factor;
   10::284     6e-74  52%  284 aa  RP32_PROMI RecName: Full=RNA polymerase sigma-32 factor;
   15::284     9e-72  50%  285 aa  RP32_ENTCL RecName: Full=RNA polymerase sigma-32 factor;
   12::286     9e-72  50%  287 aa  RP32_BUCBP RecName: Full=RNA polymerase sigma-32 factor;
   16::288     6e-57  41%  300 aa  RP32_RHIRD RecName: Full=RNA polymerase sigma-32 factor;
   12::284     2e-56  43%  295 aa  RP32_CAUCR RecName: Full=RNA polymerase sigma-32 factor;
   12::284     2e-56  43%  295 aa  RP32_CAUCN RecName: Full=RNA polymerase sigma-32 factor;
   17::288     4e-55  43%  302 aa  RP32_ZYMMO RecName: Full=RNA polymerase sigma-32 factor;
    9::279     2e-51  44%  295 aa  RPSC_MYXXA RecName: Full=RNA polymerase sigma-C factor;
   13::269     4e-50  42%  296 aa  RPSB_STIAU RecName: Full=RNA polymerase sigma-B factor;
    1::230     1e-41  40%  246 aa  RPSB_MYXXA RecName: Full=RNA polymerase sigma-B factor;
   62::319     8e-28  32%  331 aa  RPOS_YEREN RecName: Full=RNA polymerase sigma factor rpoS;
  111::370     2e-27  31%  377 aa  RPSD2_BACSP RecName: Full=RNA polymerase sigma factor rpoD;        
  104::363     2e-27  32%  371 aa  RPOD_STRMU RecName: Full=RNA polymerase sigma factor rpoD;AltName:
   61::320     4e-27  32%  330 aa  RPOS_SHIFL RecName: Full=RNA polymerase sigma factor rpoS;
   61::320     4e-27  32%  330 aa  RPOS_SALTY RecName: Full=RNA polymerase sigma factor rpoS;AltName:
   61::320     4e-27  32%  330 aa  RPOS_SALTI RecName: Full=RNA polymerase sigma factor rpoS;AltName:
   61::320     4e-27  32%  330 aa  RPOS_SALDU RecName: Full=RNA polymerase sigma factor rpoS;AltName:
   61::320     4e-27  32%  330 aa  RPOS_ECOLI RecName: Full=RNA polymerase sigma factor rpoS;AltName:
  108::367     9e-27  31%  374 aa  RPOD_LISMO RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  108::367     9e-27  31%  374 aa  RPOD_LISIN RecName: Full=RNA polymerase sigma factor rpoD;AltName:
   77::341     1e-26  30%  352 aa  RPOS_COXBU RecName: Full=RNA polymerase sigma factor rpoS;
   62::318     8e-26  30%  335 aa  RPOS_VIBCH RecName: Full=RNA polymerase sigma factor rpoS;AltName:
  102::361     1e-25  31%  368 aa  RPOD_STAES RecName: Full=RNA polymerase sigma factor rpoD;
  102::361     1e-25  31%  368 aa  RPOD_STAEQ RecName: Full=RNA polymerase sigma factor rpoD;
  102::361     1e-25  31%  368 aa  RPOD_STAAW RecName: Full=RNA polymerase sigma factor rpoD;
  102::361     1e-25  31%  368 aa  RPOD_STAAS RecName: Full=RNA polymerase sigma factor rpoD;
  102::361     1e-25  31%  368 aa  RPOD_STAAR RecName: Full=RNA polymerase sigma factor rpoD;
  102::361     1e-25  31%  368 aa  RPOD_STAAN RecName: Full=RNA polymerase sigma factor rpoD;
  102::361     1e-25  31%  368 aa  RPOD_STAAM RecName: Full=RNA polymerase sigma factor rpoD;
  102::361     1e-25  31%  368 aa  RPOD_STAAC RecName: Full=RNA polymerase sigma factor rpoD;
  102::361     1e-25  31%  368 aa  RPOD_STAA8 RecName: Full=RNA polymerase sigma factor rpoD;
  425::667     2e-25  35%  681 aa  RPOD_HELPJ RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  415::657     4e-25  35%  671 aa  RPOD_HELPY RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  364::610     7e-25  31%  625 aa  RPOD_XANAC RecName: Full=RNA polymerase sigma factor rpoD;AltName:
   90::352     9e-25  31%  364 aa  RPOD_LACLC RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  105::364     9e-25  30%  371 aa  RPOD_BACSU RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  363::609     1e-24  30%  624 aa  RPOD_XANCP RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  112::374     1e-24  31%  386 aa  RPOD_LACLA RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  313::547     2e-24  33%  572 aa  RPOD_CHLPN RecName: Full=RNA polymerase sigma factor rpoD;       
  128::361     2e-24  31%  369 aa  RPOD_STRR6 RecName: Full=RNA polymerase sigma factor rpoD;
  128::361     2e-24  31%  369 aa  RPOD_STRPN RecName: Full=RNA polymerase sigma factor rpoD;
  341::603     3e-24  29%  618 aa  RPOD_XYLFT RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  121::379     3e-24  33%  399 aa  RPOD_THEMA RecName: Full=RNA polymerase sigma factor rpoD;       
  357::603     4e-24  29%  617 aa  RPOD_BUCAP RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  352::598     4e-24  29%  612 aa  RPOD_BUCAI RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  355::601     6e-24  29%  615 aa  RPOD_SALTY RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  355::601     6e-24  29%  615 aa  RPOD_SALTI RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  353::599     6e-24  29%  613 aa  RPOD_ECOLI RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  341::603     9e-24  28%  618 aa  RPOD_XYLFA RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  431::666     9e-24  31%  674 aa  RPOD_RHOCA RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  132::365     1e-23  30%  372 aa  RPOD_BACHD RecName: Full=RNA polymerase sigma factor rpoD;AltName:
   66::323     2e-23  29%  334 aa  RPOS_PSEAE RecName: Full=RNA polymerase sigma factor rpoS;
  103::371     2e-23  28%  378 aa  RPOD_CLOAB RecName: Full=RNA polymerase sigma factor rpoD;       
  391::615     3e-23  30%  629 aa  RPOD_HAEIN RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  349::595     3e-23  31%  609 aa  RPOD_BUCBP RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  377::623     4e-23  28%  642 aa  RPOD_NEIGO RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  128::361     4e-23  31%  368 aa  RPOD_ENTFA RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  354::600     1e-22  29%  614 aa  RPOD_PSEPU RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  377::601     1e-22  29%  615 aa  RPOD_PSEFL RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  414::644     1e-22  31%  652 aa  RPOD_CAUCR RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  143::382     1e-22  31%  390 aa  RPOD_ANASP RecName: Full=RNA polymerase sigma factor rpoD;       
  446::676     2e-22  31%  684 aa  RPOD_RHIME RecName: Full=RNA polymerase sigma factor rpoD;       
  379::603     2e-22  28%  617 aa  RPOD_PSEAE RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  446::676     2e-22  31%  684 aa  RPOD_AGRT5 RecName: Full=RNA polymerase sigma factor rpoD;       
  377::613     2e-22  29%  635 aa  RPOD_RICTY RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  377::613     2e-22  29%  635 aa  RPOD_RICPR RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  377::613     2e-22  29%  635 aa  RPOD_RICFE RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  376::612     2e-22  29%  634 aa  RPOD_RICCN RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  209::484     3e-22  29%  499 aa  RPOD_MYCPN RecName: Full=RNA polymerase sigma factor rpoD;       
  140::408     3e-22  30%  416 aa  RPOD_MICAE RecName: Full=RNA polymerase sigma factor rpoD1;
  163::391     4e-22  31%  399 aa  RPOD1_SYNE7 RecName: Full=RNA polymerase sigma factor rpoD1;
  221::501     5e-22  31%  514 aa  HRDB_STRGR RecName: Full=RNA polymerase principal sigma factor
  218::498     5e-22  31%  511 aa  HRDB_STRCO RecName: Full=RNA polymerase principal sigma factor
  383::619     7e-22  28%  641 aa  RPOD_RICBR RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  391::621     9e-22  32%  631 aa  RPOD_BORBU RecName: Full=RNA polymerase sigma factor rpoD;AltName:
   35::316     1e-21  29%  329 aa  RPSB_CORDI RecName: Full=RNA polymerase sigma factor sigB;
  376::600     2e-21  28%  614 aa  RPOD_SHEVI RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  448::700     3e-21  30%  708 aa  RPOD_MYXXA RecName: Full=RNA polymerase sigma factor rpoD;AltName:
  193::417     3e-21  31%  425 aa  RPOD_SYNY3 RecName: Full=RNA polymerase sigma factor rpoD;
  160::387     1e-20  30%  404 aa  RPSC_SYNY3 RecName: Full=Probable RNA polymerase sigma-C factor;
  347::577     4e-20  29%  585 aa  RPOD_LEPIN RecName: Full=RNA polymerase sigma factor rpoD;
  347::577     4e-20  29%  585 aa  RPOD_LEPIC RecName: Full=RNA polymerase sigma factor rpoD;
   24::304     6e-20  31%  317 aa  RPOD_STRAU RecName: Full=RNA polymerase sigma factor rpoD;
  373::597     1e-19  29%  611 aa  RPOD_TREPA RecName: Full=RNA polymerase sigma factor rpoD;       
  313::547     1e-19  29%  571 aa  RPOD_CHLMU RecName: Full=RNA polymerase sigma factor rpoD;       
  313::547     1e-19  29%  571 aa  RPOD_CHLTR RecName: Full=RNA polymerase sigma factor rpoD;       
  207::482     2e-19  32%  497 aa  RPOD_MYCGE RecName: Full=RNA polymerase sigma factor rpoD;       
  454::682     3e-19  30%  698 aa  RPOD_COXBU RecName: Full=RNA polymerase sigma factor rpoD;
  137::401     7e-19  28%  416 aa  RPSC_ANASP RecName: Full=RNA polymerase sigma-C factor;
   17::299     7e-19  28%  311 aa  RPOD4_SYNE7 RecName: Full=RNA polymerase sigma factor rpoD4;
   96::321     7e-19  33%  332 aa  HRDD_STRGR RecName: Full=RNA polymerase principal sigma factor
  103::383     1e-18  29%  396 aa  HRDA_STRCO RecName: Full=RNA polymerase principal sigma factor
   39::331     5e-18  29%  339 aa  HRDC_STRCO RecName: Full=RNA polymerase principal sigma factor
    1::201     1e-17  28%  215 aa  RPOD_SERMA RecName: Full=RNA polymerase sigma factor rpoD;AltName:
   75::311     2e-17  33%  332 aa  HRDD_STRVF RecName: Full=RNA polymerase principal sigma factor
   70::310     4e-17  29%  320 aa  RPOD3_SYNE7 RecName: Full=RNA polymerase sigma factor rpoD3;
  291::515     1e-16  26%  528 aa  RPOD_MYCTU RecName: Full=RNA polymerase sigma factor rpoD;       
  291::515     1e-16  26%  528 aa  RPOD_MYCBO RecName: Full=RNA polymerase sigma factor rpoD;       
   11::257     1e-16  29%  257 aa  RPSG_CLOAB RecName: Full=RNA polymerase sigma-G factor;
   96::311     1e-16  33%  332 aa  HRDD_STRCO RecName: Full=RNA polymerase principal sigma factor
   25::328     2e-16  29%  332 aa  RPSB_ANASP RecName: Full=RNA polymerase sigma-B factor;
   16::258     1e-15  29%  260 aa  RPSG_BACSU RecName: Full=RNA polymerase sigma-G factor;AltName:
   85::309     5e-15  27%  320 aa  RPOD2_SYNE7 RecName: Full=RNA polymerase sigma factor rpoD2;
   30::247     8e-15  27%  255 aa  RPSF_BACSU RecName: Full=RNA polymerase sigma-F factor;AltName:
   12::247     1e-14  27%  253 aa  RPSF_BACME RecName: Full=RNA polymerase sigma-F factor;AltName:
   30::249     2e-14  28%  255 aa  RPSF_BACLI RecName: Full=RNA polymerase sigma-F factor;AltName:
   10::252     3e-12  28%  257 aa  RPSB_BACAN RecName: Full=RNA polymerase sigma-B factor;
   37::132     5e-12  40%  239 aa  RPSE_BACSU RecName: Full=RNA polymerase sigma-E factor;AltName:
    7::250     6e-12  26%  254 aa  RPSD_BACSU RecName: Full=RNA polymerase sigma-D factor;AltName:
   28::131     8e-12  35%  239 aa  RP35_BACTK RecName: Full=RNA polymerase sigma-35 factor;Flags:
   28::131     8e-12  35%  239 aa  RP35_BACCR RecName: Full=RNA polymerase sigma-35 factor;Flags:
   28::131     8e-12  35%  239 aa  RP35_BACAN RecName: Full=RNA polymerase sigma-35 factor;Flags:
   10::253     2e-11  30%  262 aa  RPSB_BACSU RecName: Full=RNA polymerase sigma-B factor;AltName:
   33::128     2e-11  35%  235 aa  RPSE_CLOAB RecName: Full=RNA polymerase sigma-E factor;
   16::109     7e-11  36%  125 aa  RPSX_BACTK RecName: Full=Putative RNA polymerase sigma-G
   67::282     9e-11  24%  287 aa  RPOF_STRCO RecName: Full=RNA polymerase sigma-F factor;
   77::278     2e-10  25%  297 aa  RPOF_STRAU RecName: Full=RNA polymerase sigma-F factor;
   31::276     8e-10  25%  294 aa  RPSK_BACSU RecName: Full=RNA polymerase sigma-K factor;AltName:
   46::222     8e-10  36%  237 aa  RP28_BACTK RecName: Full=RNA polymerase sigma-28 factor;Flags:
   46::222     8e-10  36%  237 aa  RP28_BACCR RecName: Full=RNA polymerase sigma-28 factor;Flags:
   46::222     8e-10  36%  237 aa  RP28_BACAN RecName: Full=RNA polymerase sigma-28 factor;Flags:
   39::233     3e-09  25%  239 aa  FLIA_SALTY RecName: Full=RNA polymerase sigma factor for flagellar
   39::233     3e-09  25%  239 aa  FLIA_SALTI RecName: Full=RNA polymerase sigma factor for flagellar
   39::233     1e-08  28%  239 aa  FLIA_ECOLI RecName: Full=RNA polymerase sigma factor for flagellar
   39::233     1e-08  28%  239 aa  FLIA_ECOL6 RecName: Full=RNA polymerase sigma factor for flagellar
   39::233     1e-08  28%  239 aa  FLIA_ECO57 RecName: Full=RNA polymerase sigma factor for flagellar
    8::229     4e-08  25%  247 aa  FLIA_PSEAE RecName: Full=RNA polymerase sigma factor for flagellar
   29::230     4e-07  22%  230 aa  FLIA_YEREN RecName: Full=RNA polymerase sigma factor for flagellar
   18::121     4e-06  32%  218 aa  RPSH_BACSU RecName: Full=RNA polymerase sigma-H factor;AltName:
   23::201     2e-05  26%  223 aa  RPSH_BACLI RecName: Full=RNA polymerase sigma-H factor;AltName:
   33::115     2e-05  35%  280 aa  RPSW_STRCO RecName: Full=RNA polymerase sigma factor whiG;
    3::103     5e-04  34%  251 aa  SIGI_BACSU RecName: Full=RNA polymerase sigma factor sigI;
  585::644     5e-04  38% 1629 aa  RDRP_SHMV RecName: Full=Replicase large subunit;       
  528::739     6e-04  23%  790 aa  SECA2_STRPN RecName: Full=Protein translocase subunit secA 2;
    1::292

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxVVSDNNLSAYLNFVNTLPVLSLEQEQELARRYKYKKDLDAAQQLVLSHLRFVTK
RP32_HAEIN      ----------------LVPQGSIEGYIRAANEYPMLTAEEEKELAERLYYHEDLDAAKKLILSHLRFVIH
RP32_VIBVU      ----------------LVTQDSLDGYIRSVNSYPMLTADEERDLAERLHYKGEIEAAKGLILSHLRFVVH
RP32_CITFR      ---------------------NLESYIRAANAWPMLSADEERALAEKLHYQGDLEAAKTLILSHLRFVVH
RP32_VIBCH      ----------------LVSQDSLDSYIRSVNGYPMLSADEERELAERLHYKGDIDAAKGLILSHLRFVVH
RP32_PSEAE      ----------------LVPGANLEAYVHSVNSIPLLSPEQERELAERLFYQQDLEAARQMVLAHLRFVVH
RP32_ECOLI      ---------------------NLDSYIRAANAWPMLSADEERALAEKLHYHGDLEAAKTLILSHLRFVVH
RP32_ECOL6      ---------------------NLDSYIRAANAWPMLSADEERALAEKLHYHGDLEAAKTLILSHLRFVVH
RP32_ECO57      ---------------------NLDSYIRAANAWPMLSADEERALAEKLHYHGDLEAAKTLILSHLRFVVH
RP32_BUCAI      ----------------VTPPGNLDAYIRIANLWPMLSIEEEKKLTKRLRYNGDLDAAKTLILSHLRFVIH
RP32_SERMA      ----------------LVPQGSLEAYIRAANAYPMLTXXXXXXXXXXXHYQGDLDAAKQLILSHLRFVAH
RP32_BUCAP      ----------------VTALGNLDAYIRIANLWPMLSIKEEKLLTKRLRYHDDLDAAKTLILSHLRFVIH
RP32_PROMI      ----------------LVPQGSIEAYIRAANSYPMLTAEEEKELAERLHYEGDLEAAKTLILSHLRFVIH
RP32_ENTCL      ---------------------NLESYIRAANTWPMLTXXXXXXXXXXXHYQGDLEAAKTLILSHLRFVVH
RP32_BUCBP      -----------------ISLGNLDSYIREANSWPMLSSQEEKYLSEKLFYHGDLNAAKTLILSHLRFVIH
RP32_RHIRD      ----------------------LNRYLDEIRKFPMLEPQEEYMLGKRYAEHGDRDAAHKLVTSHLRLVAK
RP32_CAUCR      -------------------DGGLSRYLTEIRKFPMLSKDEEFMLAQRWKEHQDPQAAHKMVTSHLRLVAK
RP32_CAUCN      -------------------DGGLSRYLTEIRKFPMLSKDEEFMLAQRWKEHQDPQAAHKMVTSHLRLVAK
RP32_ZYMMO      -------------------DQSLNHYLADIRKFPILKPEEEYMLAKRFQEHQDPKAASRLVTSHLRLVAK
RPSC_MYXXA      ------------------SPDSLSTYLSEINQYPLLTQPQEQELSKRFR-AGDLAAGHQLVTANLRFVVK
RPSB_STIAU      ---------------------SLTMYLSEINQYGLLSVEEEQALARKF-VKGDLAAGHRLVTSNLRFVVK
RPSB_MYXXA      -----------------------------------------------------------MVTANLRFVVK
RPOS_YEREN      -------------------------YLGEIGYSPLLTAEEEVYFARR-ALRGDVPSRRRMIESNLRLVVK
RPSD2_BACSP     -------------------------YLKEIGRVPLLSADDEVELAKRIM-NGDEEAKRRLAEANLRLVVS
RPOD_STRMU      -------------------------YLKEIGVVPLLTNEEEKELAIAVE-NGDLEAKQRLAEANLRLVVS
RPOS_SHIFL      -------------------------YLGEIGYSPLLTAEEEVYFARR-ALRGDVASRRRMIESNLRLVVK
RPOS_SALTY      -------------------------YLGEIGYSPLLTAEEEVYFARR-ALRGDVASRRRMIESNLRLVVK
RPOS_SALTI      -------------------------YLGEIGYSPLLTAEEEVYFARR-ALRGDVASRRRMIESNLRLVVK
RPOS_SALDU      -------------------------YLGEIGYSPLLTAEEEVYFARR-ALRGDVASRRRMIESNLRLVVK
RPOS_ECOLI      -------------------------YLGEIGYSPLLTAEEEVYFARR-ALRGDVASRRRMIESNLRLVVK
RPOD_LISMO      -------------------------YLKEIGRVDLLTADEEIALAKRIE-AGDIEAKGRLAEANLRLVVS
RPOD_LISIN      -------------------------YLKEIGRVDLLTADEEIALAKRIE-AGDIEAKGRLAEANLRLVVS
RPOS_COXBU      ------------------SSDPTQIYLRELGFQPLLNAKEELKIARRV-HKGDPKARKQMIEANLRLVVK
RPOS_VIBCH      -------------------------YLSEIGFSPLLTAEEEVLYARR-ALRGDEAARKRMIESNLRLVVK
RPOD_STAES      -------------------------YLKEIGRVNLLSAQEEIELAKRIEQGDEI-AKSRLAEANLRLVVS
RPOD_STAEQ      -------------------------YLKEIGRVNLLSAQEEIELAKRIEQGDEI-AKSRLAEANLRLVVS
RPOD_STAAW      -------------------------YLKEIGRVNLLSAQEEIELAKRIEQGDEV-AKSRLAEANLRLVVS
RPOD_STAAS      -------------------------YLKEIGRVNLLSAQEEIELAKRIEQGDEV-AKSRLAEANLRLVVS
RPOD_STAAR      -------------------------YLKEIGRVNLLSAQEEIELAKRIEQGDEV-AKSRLAEANLRLVVS
RPOD_STAAN      -------------------------YLKEIGRVNLLSAQEEIELAKRIEQGDEV-AKSRLAEANLRLVVS
RPOD_STAAM      -------------------------YLKEIGRVNLLSAQEEIELAKRIEQGDEV-AKSRLAEANLRLVVS
RPOD_STAAC      -------------------------YLKEIGRVNLLSAQEEIELAKRIEQGDEV-AKSRLAEANLRLVVS
RPOD_STAA8      -------------------------YLKEIGRVNLLSAQEEIELAKRIEQGDEV-AKSRLAEANLRLVVS
RPOD_HELPJ      -------------------------------------LKEILEQIKRGKLISDR-AKNKMAKSNLRLVVS
RPOD_HELPY      -------------------------------------LKEILEQIKRGKLISDR-AKNKMAKSNLRLVVS
RPOD_XANAC      -----------------------------------LTLGEIKEISRAMAYAKARKAKKEMVEANLRLVIS
RPOD_LACLC      -------------------DDPVRMYLKEIGRYPLISLDEETKLXXXXXXXXXXXAKQMLAEANLRLVVS
RPOD_BACSU      -------------------------YLKEIGRVNLLSAKEEIAYAQKIE-EGDEESKRRLAEANLRLVVS
RPOD_XANCP      -----------------------------------LTLAEIKDISRAMAYAKARKAKKEMVEANLRLVIS
RPOD_LACLA      -------------------DDPVRMYLKEIGRYPLISLDEETKLXXXXXXXXXXXAKQMLAEANLRLVVS
RPOD_CHLPN      ---------------------------------------------------KSQEAKKEMVESNLRLVIS
RPOD_STRR6      ----------------------------------------------------DIEAKQRLAEANLRLVVS
RPOD_STRPN      ----------------------------------------------------DIEAKQRLAEANLRLVVS
RPOD_XYLFT      ----------------ITAEQQASIDLEKVNSLTLADIKEINRMMV-YGEAKASKAKKEMVEANLRLVIS
RPOD_THEMA      --------------------DSIKMYLKEIGKIPLLTPAQERELARRAQMG-DKKAKEKLITSNLRLVVS
RPOD_BUCAP      -----------------------------------LTIEQVKDINKRMSIAKAKRAKKEMVEANLRLVIS
RPOD_BUCAI      -----------------------------------LTIEQVKDINKRMSIAKARRAKKEMVEANLRLVIS
RPOD_SALTY      -----------------------------------LTIEQVKDINRRMSIAKARRAKKEMVEANLRLVIS
RPOD_SALTI      -----------------------------------LTIEQVKDINRRMSIAKARRAKKEMVEANLRLVIS
RPOD_ECOLI      -----------------------------------LTIEQVKDINRRMSIAKARRAKKEMVEANLRLVIS
RPOD_XYLFA      ----------------ITAEQQASIDLEKANSLTLADIKEINRMMV-YGEAKASKAKKEMVEANLRLVIS
RPOD_RHOCA      --------------------------------------------------KEARQAKKEMVEANLRLVIS
RPOD_BACHD      ----------------------------------------------------DEEAKRRLAEANLRLVVS
RPOS_PSEAE      -------------------------YLNEIGFSPLLTPEEEVHFARLAQ-KGDPAGRKRMIESNLRLVVK
RPOD_CLOAB      ----------------IAIDDPVRMYLKEIGKVPLLSPEEEIDLAQRIK-NGDRSARKKLAEANLRLVVS
RPOD_HAEIN      -------------------------------------------------------AKKEMVEANLRLVIS
RPOD_BUCBP      -----------------------------------LTIHQVKNINKRISLAKAKRAKKEMVEANLRLVIS
RPOD_NEIGO      -----------------------------------ISIEELKEINKNMVSSEKVSAAQEMIQANLRLVIS
RPOD_ENTFA      ----------------------------------------------------DQEAKQRLAEANLRLVVS
RPOD_PSEPU      -----------------------------------LTVAEIKEINRRMSIAKARRAKKEMVEANLRLVIS
RPOD_PSEFL      -------------------------------------------------------AKKEMVEANLRLVIS
RPOD_CAUCR      -------------------------------------------------------AKKEMVEANLRLVIS
RPOD_ANASP      --------------------------------------------AFRYRLHIGRRAKDKMVQSNLRLVVS
RPOD_RHIME      -------------------------------------------------------AKKEMVEANLRLVIS
RPOD_PSEAE      -------------------------------------------------------AKKEMVEANLRLVIS
RPOD_AGRT5      -------------------------------------------------------AKKEMVEANLRLVIS
RPOD_RICTY      --------------------------------------------------RQTLQAKKDMIEANLRLVIS
RPOD_RICPR      --------------------------------------------------RQTLQAKKDMIEANLRLVIS
RPOD_RICFE      --------------------------------------------------RQTLQAKKDMIEANLRLVIS
RPOD_RICCN      --------------------------------------------------RQTLQAKKDMIEANLRLVIS
RPOD_MYCPN      -------------------DDNVRFFLGSLDSSKMLDFESEQRIAKVLNSTDEESAINQLVTSNLRLVVS
RPOD_MICAE      --------------------SDIKAYLGKTETAPLLELAKSKEYLSAFKRRHGRRAKEKMVQSNLRLVVS
RPOD1_SYNE7     -------------------------------------------------------AKDKMVQSNLRLVVS
HRDB_STRGR      -------------------------YLKQIGKVPLLNAEQEVELAKRIKLKRELEAKNHLLEANLRLVVS
HRDB_STRCO      -------------------------YLKQIGKVPLLNAEQEVELAKRIKLKRELEAKNHLLEANLRLVVS
RPOD_RICBR      --------------------------------------------------RQTLQAKKDMIEANLRLVIS
RPOD_BORBU      -------------------------------------------------------AKDQLIKANLRLVVS
RPSB_CORDI      -------------------------YLNGIGKTALLNAEDEVELAQTIEVKRDLKARSHLLEANLRLVVS
RPOD_SHEVI      -------------------------------------------------------AKKEMVEANLRLVIS
RPOD_MYXXA      --------------------------------LPVESLRRNYDAIRLGERRAER-AKSELVEANLRLVVS
RPOD_SYNY3      -----------------------------------------------------------MVQSNLRLVVS
RPSC_SYNY3      --------------------------------------------------KQGITAKAHMIKANLRLVVS
RPOD_LEPIN      -------------------------------------------------------AKKELVKANLRLVVS
RPOD_LEPIC      -------------------------------------------------------AKKELVKANLRLVVS
RPOD_STRAU      -------------------------YLREIGRIPLLTAAEEVDLARRVEAAADLDAKRRLIESNLRLVVS
RPOD_TREPA      -------------------------------------------------------AKDKLINANLRLVVS
RPOD_CHLMU      ---------------------------------------------------KSQEAKKEMVESNLRLVIS
RPOD_CHLTR      ---------------------------------------------------KSQEAKKEMVESNLRLVIS
RPOD_MYCGE      -------------------DDNVRFFLGSLDFSKMLDFESEQRIAKVLNSTDEESAINQLVTSNLRLVVS
RPOD_COXBU      ---------------------------------------------------KSRRAKKEMIEANLRLVIS
RPSC_ANASP      -----------------------TAGINLCDLKPILSEGKRREIAKEKMQSQGLQSKEHMIKANLRLVVS
RPOD4_SYNE7     ------------------TSDHVSWYLSSIGRIPLLTAEEEVELSRKVQLMMALRAKTKMLKANLRLVVS
HRDD_STRGR      -------------------------------------------------------AKDVFIRSNLRLVVA
HRDA_STRCO      -------------------------YLREIGRIPLLSAAEEVDLARRVEXXXXXXXKRRLIEANLRLVVS
HRDC_STRCO      ----------------------LGQYLTQIGATPLLTAEDEVRLATRVRAREELETADHMVRANLRLVVS
RPOD_SERMA      ----------------------------------------------------------------------
HRDD_STRVF      --------------------------------------EESRTDATREELQALVDAGERFIRSNLRLVVA
RPOD3_SYNE7     --------------------------------LSIEELRQQQHLGEQAKRK--------MIEANLRLVVS
RPOD_MYCTU      -------------------------------------------------------AKNHLLEANLRLVVS
RPOD_MYCBO      -------------------------------------------------------AKNHLLEANLRLVVS
RPSG_CLOAB      -----------------------------VNTLPVLKEKEMRELLISMR-NGNTTAREKFIKGNLRLVLS
HRDD_STRCO      -------------------------------------------------------AKDVFIRSNLRLVVA
RPSB_ANASP      ----------------------VSIYLHKIGRVPLLSHEQEQEWADKMQLKEDVIAKQKMIQANLRLVVS
RPSG_BACSU      --------------------------------LPVLKNEEMRKLFRQLQDEGDDSAREKLVNGNLRLVLS
RPOD2_SYNE7     -------------------------------------------------------AKRKMIEANLRLVVS
RPSF_BACSU      ----------------------------------------------------DQQARDLLIEKNMRLVWS
RPSF_BACME      ---------------------------------PYLKDHEVKDLIKRSQ-QGDQIARDTIVQKNMRLVWS
RPSF_BACLI      ----------------------------------------------------DQKARDLLIEKNMRLVWS
RPSB_BACAN      -----------------------------------LTKEDVIKLIAEFQQNQCGEAQERLVDHYKNLVYS
RPSE_BACSU      ---------------------------------PPLSKDEEQVLLMKLP-NGDQAARAILIERNLRLVVY
RPSD_BACSU      ---------------------------------------EDQVLWTRWKEWKDPKAGDDLMRRYMPLVTH
RP35_BACTK      -------------------------YIGGSEALPPPLTKEEEEVLLNKLPKGDQAARSLLIERNLRLVVY
RP35_BACCR      -------------------------YIGGSEALPPPLTKEEEEVLLNKLPKGDQAARSLLIERNLRLVVY
RP35_BACAN      -------------------------YIGGSEALPPPLTKEEEEVLLNKLPKGDQAARSLLIERNLRLVVY
RPSB_BACSU      -----------------------------------LTKDEVDRLISDYQTKQDEQAQETLVRVYTNLVDM
RPSE_CLOAB      ---------------------------------PPLSKDEEDDLVNKL-VNGDESIRSILIERNLRLVVY
RPSX_BACTK      --------------------------------LPVLKNEEMRKLFREMQ-SGEISAREKLVNGNLRLVLS
RPOF_STRCO      -----------------------------------------------------------LIEANLPLVRY
RPOF_STRAU      -----------------------------------------------------------LIEANLPLVRY
RPSK_BACSU      ---------------------------------PLSSSEEKKYL--ELMAKGDEHARNMLIEHNLRLVAH
RP28_BACTK      ----------------------------------------------------DAQARNLLIEHNLRLVAH
RP28_BACCR      ----------------------------------------------------DAQARNLLIEHNLRLVAH
RP28_BACAN      ----------------------------------------------------DAQARNLLIEHNLRLVAH
FLIA_SALTY      ----------------------------------------------------------------------
FLIA_SALTI      ----------------------------------------------------------------------
FLIA_ECOLI      ----------------------------------------------------------------------
FLIA_ECOL6      ----------------------------------------------------------------------
FLIA_ECO57      ----------------------------------------------------------------------
FLIA_PSEAE      ---------------------------------------------RMYSKAQAQNSQEQLIQRYAPLVKR
FLIA_YEREN      ----------------------------------------------------------------------
RPSH_BACSU      -------------------------------------LEDEQVIEK--VHVGDSDALDYLITKYRNFVRA
RPSH_BACLI      -------------------------------------LEDEQVI--EMVHVGDSDALDYLITKYRNFVRA
RPSW_STRCO      ------------------------------------------ELWRSYKTTGDERLREQLILHYSPLVKY
SIGI_BACSU      ---------------------------------PVLSLKQTLEKAVESIQKGNKDLQNELIQQYKPFIAK
RDRP_SHMV       ----------------------------------------------------------------------
SECA2_STRPN     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IARNFSGYGLSIADLIQEGNIGLMKAVSKFDPDQGVRLLSFAVHWIKAEMHDYVLKNWKIVKVATTKAQR
RP32_HAEIN      VARGYSGYGLPQADLIQEGNIGLMKAVKRFNPEVGVRLVSFAVHWIKAEIHEYVLRNWRIVKVATTKAQR
RP32_VIBVU      VARGYSGYGLPMADLVQEGNIGLMKAVKRFNPEVGVRLVSFAVHWIKAEIHEYVLRNWRIVKIATTKAQR
RP32_CITFR      VARNYAGYGLRQADLIQEGNIGLMKAVRRFNPEVGVRLVSFAVHWIKAEIHEYVLRNWRIVKVATTKAQR
RP32_VIBCH      VARGYSGYGLPMADLVQEGNIGLMKAVKRFNPEMGVRLVSFAVHWIKAEIHEYVLRNWRIVKIATTKAQR
RP32_PSEAE      IAKSYSGYGLAQADLIQEGNVGLMKAVKRFNPEMGVRLVSFAVHWIKAEIHEFILRNWRIVKVATTKAQR
RP32_ECOLI      IARNYAGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLVSFAVHWIKAEIHEYVLRNWRIVKVATTKAQR
RP32_ECOL6      IARNYAGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLVSFAVHWIKAEIHEYVLRNWRIVKVATTKAQR
RP32_ECO57      IARNYAGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLVSFAVHWIKAEIHEYVLRNWRIVKVATTKAQR
RP32_BUCAI      ISRNYSGYGLLQSDLIQEGNIGLMKAVRRFNPEIGVRLVSFAVHWIKSEIHEYVLRNWRIVKVATTKSQR
RP32_SERMA      IARNYSGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLVSFAVHWIKAEIHEYVLRNWRIVKVATTKAQR
RP32_BUCAP      ISRNYSGYGLLQADLIQEGNIGLMKAVRRFNPDIGVRLVSFAVHWIKSEIHEYVLRNWRIVKVATTKSQR
RP32_PROMI      VARSYSGYGLPQADLIQEGNIGLMKAVRHFNPEVGVRLVSFAVHWIKAEIHEYVLRNWRIVKVATTKSQR
RP32_ENTCL      VARNYAGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLVSFAVHWIKAEIHEYVLRNWRIVKVATTKAQR
RP32_BUCBP      VSRNYSGYGLLQADLIQEGNIGLMKAVRRFNPKIGVRLVSFAVHWIKSEIHEYVLRNWRIVKVATTKSQR
RP32_RHIRD      IAMGYRGYGLPIGEVVSEGNVGLMQAVKKFDPERGFRLATYAMWWIKASIQEYILRSWSLVKMGTTANQK
RP32_CAUCR      IAMGYRGYGLPIGEVISEGNVGLMQAVKKFEPEKGFRLATYAMWWIRASIQEYILRSWSLVKMGTTAAQK
RP32_CAUCN      IAMGYRGYGLPIGEVISEGNVGLMQAVKKFEPEKGFRLATYAMWWIRASIQEYILRSWSLVKMGTTAAQK
RP32_ZYMMO      IAMGYRGYGLPVSELISEGNIGLMQGVKKFDPERGFRLATYAIWWIKASIQEYILRSWSLVKMGTTAAQK
RPSC_MYXXA      VAYEYRSYGLKMSDLIQEANIGLMKAVQKFDPDKGIRLISYAVWWIRAYIQNCILKNWSLVKLGTTQAQR
RPSB_STIAU      VSYEYRSYGIKMSDLIQEGNIGLMKAVQKFDPDKGIRLISYAVWWIRAYIQNYILKSWSLVKLGTTQAQR
RPSB_MYXXA      VAYEYRSYGIKMSDLIQEGNIGLMKAVQKFDPDKGIRLISYAVWWIRAYIQNYILKSWSLVKLGTTQAHG
RPOS_YEREN      IARRYSNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRL-PIHIVK
RPSD2_BACSP     IAKRYVGRGMLFLDLIQEGNMGLIKAVEKFDHNKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVEN
RPOD_STRMU      IAKRYVGRGMQFLDLIQEGNMGLMKAVDKFDYSKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVEN
RPOS_SHIFL      IARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRL-PIHIVK
RPOS_SALTY      IARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRL-PIHIVK
RPOS_SALTI      IARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRL-PIHIVK
RPOS_SALDU      IARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRL-PIHIVK
RPOS_ECOLI      IARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRL-PIHIVK
RPOD_LISMO      IAKRYVGRGMLFLDLIQEGNMGLMKAVEKFDFNKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVEN
RPOD_LISIN      IAKRYVGRGMLFLDLIQEGNMGLMKAVEKFDFNKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVEN
RPOS_COXBU      IARHYVNRGLPFLDLIEEGNLGLLTAVEKFDPERGFRFSTYATWWIRQTIERAIMNQSRTVRL-PIHVIK
RPOS_VIBCH      ISRRYSNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERALMNQTRTIRL-PIHVVK
RPOD_STAES      IAKRYVGRGMLFLDLIQEGNMGLIKAVEKFDFSKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVEN
RPOD_STAEQ      IAKRYVGRGMLFLDLIQEGNMGLIKAVEKFDFSKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVEN
RPOD_STAAW      IAKRYVGRGMLFLDLIQEGNMGLIKAVEKFDFNKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVEN
RPOD_STAAS      IAKRYVGRGMLFLDLIQEGNMGLIKAVEKFDFNKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVEN
RPOD_STAAR      IAKRYVGRGMLFLDLIQEGNMGLIKAVEKFDFNKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVEN
RPOD_STAAN      IAKRYVGRGMLFLDLIQEGNMGLIKAVEKFDFNKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVEN
RPOD_STAAM      IAKRYVGRGMLFLDLIQEGNMGLIKAVEKFDFNKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVEN
RPOD_STAAC      IAKRYVGRGMLFLDLIQEGNMGLIKAVEKFDFNKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVEN
RPOD_STAA8      IAKRYVGRGMLFLDLIQEGNMGLIKAVEKFDFNKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVEN
RPOD_HELPJ      IAKRFTSRGLPFLDLIQEGNIGLMKAVDKFEHEKGFKFSTYATWWIKQAISRAIADQARTIRIPIHMIDT
RPOD_HELPY      IAKRFTSRGLPFLDLIQEGNIGLMKAVDKFEHEKGFKFSTYATWWIKQAISRAIADQARTIRIPIHMIDT
RPOD_XANAC      IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIET
RPOD_LACLC      IAKRYSGRGMQFLDLIQEGNMGLMKAVDKFDQTKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVEN
RPOD_BACSU      IAKRYVGRGMLFLDLIQEGNMGLMKAVEKFDYRKGYKFSTYATWWIRQAITRAIADQARTIRIPVHMVEN
RPOD_XANCP      IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIET
RPOD_LACLA      IAKRYSGRGMQFLDLIQEGNMGLMKAVDKFDHTKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVEN
RPOD_CHLPN      IAKKYTNRGLSFLDLIQEGNMGLMKAVEKFEYRRGYKFSTYATWWIRQAVTRAIADQARTIRIPVHMIE-
RPOD_STRR6      IAKRYVGRGMQFLDLIQEGNMGLMKAVDKFDYSKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVEN
RPOD_STRPN      IAKRYVGRGMQFLDLIQEGNMGLMKAVDKFDYSKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVEN
RPOD_XYLFT      IAKKYTNRGLQFLDLIQEGNIGLMKAVCKFEHRRGFKFSTYATWWIRQAITRSIADQARTIRIPVHMIET
RPOD_THEMA      IAKRYMGRGLSFQDLIQEGNIGLLKAVEKFDWRKGYKFSTYATWWIRQAITRAIADQARTIRIPVHMVEN
RPOD_BUCAP      IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIEN
RPOD_BUCAI      IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIEN
RPOD_SALTY      IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIET
RPOD_SALTI      IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIET
RPOD_ECOLI      IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIET
RPOD_XYLFA      IAKKYTNRGLQFLDLIQEGNIGLMKAVCKFEHRRGFKFSTYATWWIRQAITRSIADQARTIRIPVHMIET
RPOD_RHOCA      IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIEN
RPOD_BACHD      IAKRYVGRGMLFLDLIQEGNMGLIKAVEKFDYNKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVEN
RPOS_PSEAE      IARRYVNRGLSLLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRL-PIHVVK
RPOD_CLOAB      IAKRYVGRGMLFLDLIQEGNLGLIKAVEKFDFKKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVEN
RPOD_HAEIN      IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIET
RPOD_BUCBP      IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIEN
RPOD_NEIGO      IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPV-----
RPOD_ENTFA      IAKRYVGRGMQFLDLIQEGNMGLMKAVEKFDYRKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVEN
RPOD_PSEPU      IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIET
RPOD_PSEFL      IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIET
RPOD_CAUCR      IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIEN
RPOD_ANASP      IAKKYMNRGLSFQDLIQEGSLGLIRAAEKFDHEKGYKFSTYATWWIRQAITRAIADQSRTIRLPV-----
RPOD_RHIME      IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIEN
RPOD_PSEAE      IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIET
RPOD_AGRT5      IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIEN
RPOD_RICTY      IAKKYANRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRAIADQARTIRIPVHMIEN
RPOD_RICPR      IAKKYANRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRAIADQARTIRIPVHMIEN
RPOD_RICFE      IAKKYANRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRAIADQARTIRIPVHMIEN
RPOD_RICCN      IAKKYANRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRAIADQARTIRIPVHMIEN
RPOD_MYCPN      IAKKHLERGLDFNDLIQEGNLGLLKAISKFNWSLGNKFSTYATWWIKQAITRAIADQARTVRIPVHMVEN
RPOD_MICAE      IAKKYMNRGLSFQDLIQEGSLGLIRAAEKFDHEKGYKFSTYATWWIRQAITRAIADQSRTIRLPV-----
RPOD1_SYNE7     IAKKYMNRGLSFQDLIQEGSLGLIRAAEKFDHEKGYKFSTYATWWIRQAITRAIADQSRTIRLPV-----
HRDB_STRGR      LAKRYTGRGMLFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEN
HRDB_STRCO      LAKRYTGRGMLFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEN
RPOD_RICBR      IAKKYANRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRAIADQARTIRIPVHMIEN
RPOD_BORBU      IAKKYANRGLHFFDLVQEGNIGLIKAVEKFEYKRGFKFSTYATWWIRQAITRSISDQARTIRVPVHMIEQ
RPSB_CORDI      LAKRYTGRGMPLLDLIQEGNLGLIRAMEKFDYSKGFKFSTYATWWIRQAITRGMADQSRTIRLPVHLVEQ
RPOD_SHEVI      IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIET
RPOD_MYXXA      IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYKRGYKFSTYATWWIRQAITRAIADQARTIRIPVHMIEN
RPOD_SYNY3      IAKKYMNRGLSFQDLIQEGSLGLIRAAEKFDHEKGYKFSTYATWWIRQAITRAIADQSRTIRLPV-----
RPSC_SYNY3      VAKKYQNRGLELLDLIQEGTLGLERAVEKFDPTKGYRFSTYSYWWIRQGITRAIATQSRMIRVHITEKLN
RPOD_LEPIN      IAKRYANRGMHFFDLIQEGNIGLIKAVDKFEYKKGYKFSTYATWWIRQAITRAISDQARTIRVPVHMIEQ
RPOD_LEPIC      IAKRYANRGMHFFDLIQEGNIGLIKAVDKFEYKKGYKFSTYATWWIRQAITRAISDQARTIRVPVHMIEQ
RPOD_STRAU      VAKRYVGRGLTMLDLVQEGNLGLIRAVEKFDYARGYKFSTYATWWIRQAMSRALADQARTIRVPVHVVEN
RPOD_TREPA      IAKKYTNRGLLFFDLVQEGNIGLIKAVEKFEYRKGYKFSTYATWWIRQAITRSISDQARTIRVPVHMIEQ
RPOD_CHLMU      IAKKYTNRGLSFLDLIQEGNMGLMKAVEKFEYRRGYKFSTYATWWIRQAVTRAIADQARTIRIPVHMIE-
RPOD_CHLTR      IAKKYTNRGLSFLDLIQEGNMGLMKAVEKFEYRRGYKFSTYATWWIRQAVTRAIADQARTIRIPVHMIE-
RPOD_MYCGE      IAKKHLERGLDFNDLIQEGNLGLLKAISKFNWSLGNKFSTYATWWIKQAITRAIADQARTVRIPVAKAER
RPOD_COXBU      IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIET
RPSC_ANASP      VAKKYQNRGLELLDLVQEGTLGLERAVEKFDPTKGYRFSTYAYWWIRQGITRAIATSSRTIRVHITEKLN
RPOD4_SYNE7     VAKKYQNQGLELLDLIQEGSLGLERAVEKFDPALGYKFSTYAYWWIRQSMTRAIDNHARTIRLPIHVSEK
HRDD_STRGR      VARRYPRSGLPLLDLIQEGNAGLVRAVEKFDYAKGFKFSTYATWWIRQAITRSIADQSRTIRLPVRRVQR
HRDA_STRCO      VAKRYVGRGLTMLDLVQEGNLGLIRAVEKFDYARGYKFSTYATWWIRQAMSRALADQARTIRVPVHVVER
HRDC_STRCO      MAKRHAHRGLPLLDVIQEGNLGLIRAVEKFDHTKGFKFSTYATWWIRQAIERGLATHARTVRLPVHVVEQ
RPOD_SERMA      ---------LQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIET
HRDD_STRVF      VARRYPRSGLPLLDLIQEGNAGLVRAVEKFDYRKGFKFSTYATWWIRQAITRSIADQSRTIRLPVRRVQR
RPOD3_SYNE7     VAKKYLKRNMDLLDLIQEGTIGMQRGVEKFDPTKGYRFSTYAYWWIRQAITRAIAEKARTIRIHITEKLN
RPOD_MYCTU      LAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEN
RPOD_MYCBO      LAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEN
RPSG_CLOAB      VIQRFNNRGENADDLFQVGCIGLIKSIDNFDLSQNVKFSTYAVPMIIGEIRRYLRDN---NSIRVSRSLR
HRDD_STRCO      VARRYPRSGLPLLDLIQEGNAGLVRAVEKFDYRKGFKFSTYATWWIRQAITRSIADQSRTIRLPVRRVQR
RPSB_ANASP      IAKKYQKRNLEFLDLIQEGALGLERGVEKFDPTLGYKFSTYAYWWIRQGITRAIAQQSRTIRLPIHMADK
RPSG_BACSU      VIQRFNNRGEYVDDLFQVGCIGLMKSIDNFDLSHNVKFSTYAVPMIIGEIRRYLRDN---NPIRVSRSLR
RPOD2_SYNE7     IAKKYQKRHMEFLDLIQEGTLGLERGVEKFDPSKGYKFSTYAYWWIRQAITRAIAQQSRTIRIHITEKLN
RPSF_BACSU      VVQRFLNRGYEPDDLFQIGCIGLLKSVDKFDLTYDVRFSTYAVPMIIGEIQRFIRDDG---TVKVSRSLK
RPSF_BACME      VVQRFINRGYEPDDLFQIGCIGLLKSVDKFDLSYDVKFSTYAVPMIIGEIQRFIRDDG---TVKVSRSLK
RPSF_BACLI      VVQRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSYDVRFSTYAVPMIIGEIQRFIRDDG---TVKVSRSLK
RPSB_BACAN      IAYRYSKGGPMHEDIIQVGMLGLLGAIRRYDYSIGNAFEPFAIPTIVGEIKKYLRKTWGIVPRRIKDLGG
RPSE_BACSU      IARKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIKLATYASRCIENEILMYLRRNNKI----------
RPSD_BACSU      VGRISVGLPKSVHDLMSLGMLGLYDALEKFDPSRDLKFDTYASFRIRGAIIDGLRKEDWLPRTSREKTKK
RP35_BACTK      IARKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIKLATYASRCIENEILMHLRRNNK-----------
RP35_BACCR      IARKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIKLATYASRCIENEILMHLRRNNK-----------
RP35_BACAN      IARKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIKLATYASRCIENEILMHLRRNNK-----------
RPSB_BACSU      LAKKYSKGKSFHEDLRQVGMIGLLGAIKRYDPVVGKSFEAFAIPTIIGEIKRFLRKTW---SVHVPRRIK
RPSE_CLOAB      IARKFENTGVGVEDLISVGTIGLIKAVNTFDPTKKIKLATYGSRCIENEILMYLRRNSKV----------
RPSX_BACTK      VIQRFNNRGEYVDDLFQVGCIGLMKSIDNFDLGQNVKFSTYAVPMIIGEIRRYLRDN-------------
RPOF_STRCO      AAARFRSRNEPMEDVVQVGTIGLINAIDRFDPERGVQFPTFAMPTVVGEIKRYFRDNVRTVHV--PRRLH
RPOF_STRAU      AAARFRSRNEPMEDVVQVGTIGLINAIDRFDPERGVQFPTFAMPTVVGEIKRYFRDNVRTVHV--PRRLH
RPSK_BACSU      IVKKFENTGEDAEDLISIGTIGLIKGIESYSAGKGTKLATYAARCIENEIHPSLIR----FNIYGVRIHN
RP28_BACTK      IVKKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTKLATYAARCIENEMHLRVLK----------KTKK
RP28_BACCR      IVKKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTKLATYAARCIENEMHLRVLK----------KTKK
RP28_BACAN      IVKKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTKLATYAARCIENEMHLRVLK----------KTKK
FLIA_SALTY      ---------VELDDLLQAGGIGLLNAVDRYDALQGTAFTTYAVQRIRGAMLD-ELRSRDWVPRSVRRNAR
FLIA_SALTI      ---------VELDDLLQAGGIGLLNAVDRYDALQGTAFTTYAVQRIRGAMLD-ELRSRDWVPRSVRRNAR
FLIA_ECOLI      ---------VELDDLLQAGGIGLLNAVERYDALQGTAFTTYAVQRIRGAMLDELSRDW---------VPR
FLIA_ECOL6      ---------VELDDLLQAGGIGLLNAVERYDALQGTAFTTYAVQRIRGAMLDELSRDW---------VPR
FLIA_ECO57      ---------VELDDLLQAGGIGLLNAVERYDALQGTAFTTYAVQRIRGAMLDELSRDW---------VPR
FLIA_PSEAE      IAYHLLGRSVQVEDLMQAGMIGLLEAAKKYDAGKGASFETYAGIRIRGAMLDEVRKDW---------APR
FLIA_YEREN      ---------VELDDLLQAGGIGLLNAVERYDRLQGTAFTTYAVQRIRGAMLD-ELRSRDWAPRSVRRNAR
RPSH_BACSU      KARSYFLIGADREDIVQEGMIGLYKSIRDFKEDKLTSFKAFAELCITRQI---------ITAIKTATRQK
RPSH_BACLI      KARSYFLIGADREDIVQEGMIGLYKSIRDFREDKLTSFKAFAELCITRQIITAIATRQKHIPLNSYVSLD
RPSW_STRCO      VAGRVS-VGLEQADFVSSGVFGLIDAIEKFDVDREIKFETYAITRIRGAMID------------------
SIGI_BACSU      TVSSVCKRYIDEKD--DEFSIGLIEAIEKYSPEKGNSLLAFAELIIKRKVIDYIRK--------------
RDRP_SHMV       ----------------------------------------------------------------------
SECA2_STRPN     ----------------RQGDPGMSKFFVSLEDDV---IKKFGPSWVHKKYKDYQVQDMTQPEVLKGRKYR


                         +         .         .         .         .         *         .:210
query           KLFFNLRSSKDKIGWLSSENIKELAEELGVKEETVIEMEKRMCQGDASLDLPYTDDDGEQTSQQSLYLED
RP32_HAEIN      KLFFNLRKTKQRLGWFNENEVDMVANELGVSKEDVIEMESRMSGADVGFDLP-TDDAETETYSPALYLED
RP32_VIBVU      KLFFNLRKSKKRLGWFNNGEVETVARELGVEPAEVREMESRLAAVDSTFDLPNEEDDSSSVSTAPLYLED
RP32_CITFR      KLFFNLRKTKQRLGWFNQDEVEMVARELGVSSKDVREMESRMAAQDMTFDMSSDDESDSQPMAPVLYLQD
RP32_VIBCH      KLFFNLRKSKKRLGWFNNGEVETVARELGVEPAEVREMESRLAAQDAAFEMSAEDDEGMAYTAPVLYLED
RP32_PSEAE      KLFFNLRSQKKRLAWLNNEEVHRVAESLGVEPREVREMESRLTGQXXXXXXXXXXXXXXXYQSPAHYLED
RP32_ECOLI      KLFFNLRKTKQRLGWFNQDEVEMVARELGVTSKDVREMESRMAAQDMTFDLXXXXXXXXQPMAPVLYLQD
RP32_ECOL6      KLFFNLRKTKQRLGWFNQDEVEMVARELGVTSKDVREMESRMAAQDMTFDLXXXXXXXXQPMAPVLYLQD
RP32_ECO57      KLFFNLRKTKQRLGWFNQDEVEMVARELGVTSKDVREMESRMAAQDMTFDLXXXXXXXXQPMAPVLYLQD
RP32_BUCAI      KLFFNLRKTKKRLGWFNEEEIQIVARELGVSSRDVREMESRMSAQDVAFNPSPEEHCDSKTNSSIQYLQD
RP32_SERMA      KLFFNLRKTKQRLGWFNQDEVELVARELGVTSKDVREMESRMAAQDMTFD-PTPDDEARQSMAPVLYLQD
RP32_BUCAP      KLFFNLRKNKKRLGWFNQEEIEIVARELGVSSEDVREMESRMSAQDITFN-PFPEEDDGKINGNMFYLQD
RP32_PROMI      KLFFNLRKNKKRLGWFNQDEVELVAKELGVSESDVREMESRXXXXXXXXXXXXXXXXXPHPVAPVLFLED
RP32_ENTCL      KLFFNLRKTKQRLGWFNQDEVEMVARELGVSSKDVREMESRMAQXXXXXXXXXXXXXXXXXXXPVLYLQD
RP32_BUCBP      KLFFNLRKTKQRLGWFNDHELELVAQELGVKREDVREMESRMSAQDIALHVPDNFREEQNFSYTIPYLKD
RP32_RHIRD      RLFFNLRRLKGRIGDLKPEHVKEIATKLQVSEEEVISMNRRL-HGDASLNAPIKASEGESGQWQDWLVDD
RP32_CAUCR      KLFFNLRKAKSQIGDLHPDQVSQIATKLGVLDSEVISMNRRLSGPDASLNAPLR-ADGESEWQDWLADEE
RP32_CAUCN      KLFFNLRKAKSQIGDLHPDQVSQIATKLGVLDSEVISMNRRLSGPDASLNAPLR-ADGESEWQDWLADEE
RP32_ZYMMO      KLFFNLRRLKSNMGDLKPDEVDSIATNLGVSNEEVVNMNRRMAMGDSSLNITMR-EDGE--GQMQDWLVD
RPSC_MYXXA      RLFFSLARTRRELGDANVVNAEEIARKLNVKASEVREMEQRMGGRDLSLDAP-MGEDGDATHLDFXXXXX
RPSB_STIAU      KLFFSLARTRRELGDGAVVNVDEIANKLNVKASEVREMEQRMGGRDLSLDAPMGEDGGNSHVD---FVAS
RPSB_MYXXA      KLFFSLARTRRELEKFGSVNVDDIARRLHVKPGEVREMEQRMGGRDLSLDAPMGEDGGNSHVD---FVVS
RPOS_YEREN      ELNVYLRTARELSHKLDHESAEEIAEQLDKPVDDVSRM-LRLNERITSVDTPLGGD-----SEKALILSD
RPSD2_BACSP     KL---IRVSRQLLQELGRETPEEIAAEMELSVEKVREIMK-IAQEPVSLETPIGEEDDSHLGD---FIED
RPOD_STRMU      KLVREQRNLLQELG--QDPTPEQIAERMDMTPDKVREILK-IAQEPVSLETPIGEEDDSHLGD---FIED
RPOS_SHIFL      ELNVYLRTARELSHKLDHESAEEIAEQLDKPVDDVSRM-LRLNERITSVDTPLGGD-----SEKALILAD
RPOS_SALTY      ELNVYLRTARELSHKLDHESAEEIAEQLDKPVDDVSRM-LRLNERITSVDTPLGGD-----SEKALILAD
RPOS_SALTI      ELNVYLRTARELSHKLDHESAEEIAEQLDKPVDDVSRM-LRLNERITSVDTPLGGD-----SEKALILAD
RPOS_SALDU      ELNVYLRTARELSHKLDHESAEEIAEQLDKPVDDVSRM-LRLNERITSVDTPLGGD-----SEKALILAD
RPOS_ECOLI      ELNVYLRTARELSHKLDHESAEEIAEQLDKPVDDVSRM-LRLNERITSVDTPLGGD-----SEKALILAD
RPOD_LISMO      KLIRVQRSLLQDLG--RDPSPEEIGEEMDLPTEKVREILK-IAQEPVSLETPIGEEDDSHLGD---FIED
RPOD_LISIN      KLIRVQRSLLQDLG--RDPSPEEIGEEMDLPTEKVREILK-IAQEPVSLETPIGEEDDSHLGD---FIED
RPOS_COXBU      ELNVYLRTAKKLTQEVDHEATPEDVAHLIDKPVQEIRRIMDLAPSATSIDVPISEDG--QKSLVDTLADD
RPOS_VIBCH      ELNIYLRTARELSQRLDHETPEEIALELDRPVDDVTKM-LRLNERISSVDTPI----GGDGDKALLDILP
RPOD_STAES      KLIRVQRQLLQDLG--RDPAPEEIGEEMDLPPEKVREILK-IAQEPVSLETPIGEEDDSHLGD---FIED
RPOD_STAEQ      KLIRVQRQLLQDLG--RDPAPEEIGEEMDLPPEKVREILK-IAQEPVSLETPIGEEDDSHLGD---FIED
RPOD_STAAW      KLIRVQRQLLQDLG--RDPAPEEIGEEMDLPAEKVREILK-IAQEPVSLETPIGEEDDSHLGD---FIED
RPOD_STAAS      KLIRVQRQLLQDLG--RDPAPEEIGEEMDLPAEKVREILK-IAQEPVSLETPIGEEDDSHLGD---FIED
RPOD_STAAR      KLIRVQRQLLQDLG--RDPAPEEIGEEMDLPAEKVREILK-IAQEPVSLETPIGEEDDSHLGD---FIED
RPOD_STAAN      KLIRVQRQLLQDLG--RDPAPEEIGEEMDLPAEKVREVLK-IAQEPVSLETPIGEEDDSHLGD---FIED
RPOD_STAAM      KLIRVQRQLLQDLG--RDPAPEEIGEEMDLPAEKVREILK-IAQEPVSLETPIGEEDDSHLGD---FIED
RPOD_STAAC      KLIRVQRQLLQDLG--RDPAPEEIGEEMDLPAEKVREILK-IAQEPVSLETPIGEEDDSHLGD---FIED
RPOD_STAA8      KLIRVQRQLLQDLG--RDPAPEEIGEEMDLPAEKVREILK-IAQEPVSLETPIGEEDDSHLGD---FIED
RPOD_HELPJ      INRINKVMRKHIQETGKEPDLEVVAEEVGLSLDKVKNVIK-VTKEPISLETPVNDDDGKFGD----FVED
RPOD_HELPY      INRINKVMRKHIQENGKEPDLEVVAEEVGLSLDKVKNVIK-VTKEPISLETPVNDDDGKFGD----FVED
RPOD_XANAC      INKLN-RISRQMLQQFGRETPEELAKEMDMPEDKIRKVMK-IAKEPISMETPIGDDEDSHLGD---FIED
RPOD_LACLC      KLIRVQRNLLQELG--RDPSPEEIGKELHMAPDKVREVLK-IAQEPVSLETPIGEEDDSHLGD---FIED
RPOD_BACSU      KLIRVQRQLLQDLG--REPTPEEIAEDMDLTPEKVREILK-IAQEPVSLETPIGEEDDSHLGD---FIED
RPOD_XANCP      INKLN-RISRQMLQQFGRETPEELAKEMDMPEDKIRKVMK-IAKEPISMETPIGDDEDSHLGD---FIED
RPOD_LACLA      KLIRVQRNLLQELG--RDPSPEEIGKELHMAPDKVREVLK-IAQEPVSLETPIGEEDDSHLGD---FIED
RPOD_CHLPN      TINKVLRGAKKLMMETGKETPEELAEELGLTPDRVREIYK-IAQHPISLQAEV--GEGSESSFGD-FLED
RPOD_STRR6      KLVREQRNLLQELG--QDPTPEQIAERMDMTPDKVREILK-IAQEPVSLETPIGEEDDSHLGD---FIED
RPOD_STRPN      KLVREQRNLLQELG--QDPTPEQIAERMDMTPDKVREILK-IAQEPVSLETPIGEEDDSHLGD---FIED
RPOD_XYLFT      INKLN-RISRQMLQQFGRETPEELAKEMDMPEDKIRKVMK-IAKEPISMETPIGDDEDSHLGD---FIED
RPOD_THEMA      KLNRLRREYYQKHG--EEPSIEELAKMMG-KPPXXXXXXXXXXXXTISLESPIGEDEDSSIED---FVAD
RPOD_BUCAP      KLNRISRQMLQEIG--REPTPEELSEKMLIPEDKIRKVLK-IAKEPISMETPIGDDDDSHLGD---FIED
RPOD_BUCAI      KLNRISRQMLQEIG--REPTPEELSEKMLIPEDKIRKVLK-IAKEPISMETPIGDDDDSHLGD---FIED
RPOD_SALTY      INKLN-RISRQMLQEMGRETPEELAERMLMPEDKIRKVLK-IAKEPISMETPIGDDEDSHLGD---FIED
RPOD_SALTI      INKLN-RISRQMLQEMGRETPEELAERMLMPEDKIRKVLK-IAKEPISMETPIGDDEDSHLGD---FIED
RPOD_ECOLI      INKLN-RISRQMLQEMGRETPEELAERMLMPEDKIRKVLK-IAKEPISMETPIGDDEDSHLGD---FIED
RPOD_XYLFA      INKLN-RISRQMLQQFGRETPEELAKEMDMPEDKIRKVMK-IAKEPISMETPIGDDEDSHLGD---FIED
RPOD_RHOCA      KLVRTGRQMLHEIG--REPTPEELAEKLQMPLEKVRKVMK-IAKEPISLETPIGD---EEDSQLGDFIED
RPOD_BACHD      KLIRVQRQLLQDLG--REPSPEEVAEEMDLTPEKVREILK-IAQEPVSLETPIGEEDDSHLGD---FIED
RPOS_PSEAE      ELNVYLRAARELTHKLSPEEIANLLEKPVAEVKRMLGLNERVTSVDVSL--------GXXXXXXXXXXXX
RPOD_CLOAB      KL---IRVSRQLLQELGREQPEEIAKIMDMPVDKVREIMK-IAQEPVSLETPIGEEEDSHLG------DF
RPOD_HAEIN      INKLN-RISRQLLQEMGRETPEELAERMGMPEDKIRKVLK-IAKEPISMETPIGDDDDSHLGD---FIED
RPOD_BUCBP      KLNRISRQILQEIG--REPTPEELSERMLIPEDKIRKVLK-IAKEPISMETPIGEDDDSHLGD---FLED
RPOD_NEIGO      ----HMIETINKMNRISRQHLQETGEELMQMPEDKIRKIMKIAKEPISMETPIGDDDDSHLGD---FIED
RPOD_ENTFA      KXXXXXXXXXXDLG--REPTPEEIGAEMDLPTEKVREILK-IAQEPVSLETPIGEEDDSHLGD---FIED
RPOD_PSEPU      INKLN-RISRQMLQEMGRETPEELGERMEMPEDKIRKVLK-IAKEPISMETPIGDDEDSHLGD---FIED
RPOD_PSEFL      INKLN-RISRQMLQEMGRETPEELGERMEMPEDKIRKVLK-IAKEPISMETPIGDDEDSHLGD---FIED
RPOD_CAUCR      KIVRTSRQMLHEIG--REPTPEELAEKLAMPLEKVRKVLK-IAKEPISLETPIGD---EEDSHLGDFIED
RPOD_ANASP      HLYETISRIKKTTKLLSQEGRKPTEEEIATRMEMTIE-KLRFIAKSAQLPISLETPIGEEDSRLGDFIES
RPOD_RHIME      KIVRTSRQMLHEIG--REPTPEELAEKLAMPLEKVRKVLK-IAKEPISLETPVGD---EEDSHLGDFIED
RPOD_PSEAE      INKLN-RISRQMLQEMGRETPEELGERMDMPEDKIRKVLK-IAKEPISMETPIGDDEDSHLGD---FIED
RPOD_AGRT5      KIVRTSRQMLHEIG--REPTPEELAEKLAMPLEKVRKVLK-IAKEPISLETPVGD---EEDSHLGDFIED
RPOD_RICTY      KILRTSRQMLNELGY--EPTATEIANRLSMPLDKVRKVMK-IAKEPISLENPVGDDDGGQLGD---FIED
RPOD_RICPR      KILRTSRQMLNELGY--EPTATEIANRLSMPLDKVRKVMK-IAKEPISLENPVGDDDGGQLGD---FIED
RPOD_RICFE      KILRTSRQMLNELGY--EPTATEIANRLSMPLDKVRKVMK-IAKEPISLENPVGDDDGGQLGD---FIED
RPOD_RICCN      KILRTSRQMLNELGY--EPTATEIANRLSMPLDKVRKVMK-IAKEPISLENPVGDDDGGQLGD---FIED
RPOD_MYCPN      RLAKAERALNQELG--REPTAEELAEKMGGQAETVIAEIKRLSLDPVSLDKTVGHD---EESQFGDFVRD
RPOD_MICAE      HLYETISRIKKTTKILSQERRKPTEEEIATKMEMTIE-KLRFIAKSAQLPISLETPIGEEDSRLGDFIEA
RPOD1_SYNE7     HLYETISRIKKTTKLLSQEGRKPTEEEIATRMEMTIE-KLRFIAKSAQLPISLETPIGEEDSRLGDFIEA
HRDB_STRGR      KLARVQRQMLQDLG--REPTPEELAKELDMTPEKVIEVQK-YGREPISLHTPLGEDGDSEFGD---LIED
HRDB_STRCO      KLARVQRQMLQDLG--REPTPEELAKELDMTPEKVIEVQK-YGREPISLHTPLGEDGDSEFGD---LIED
RPOD_RICBR      KIIRTSRQMLNELGY--EPTPAEIAARLSMPIDKVRKVMK-IAKEPISLENPV--GDGDDNSYLGDFIED
RPOD_BORBU      INRLN-RETRYLIQVLGKDTDEELSDRLG-WELKKVKTVKSVSREPVSLETPIGE---EEDSVLSDFIED
RPSB_CORDI      VNKLS-RIKREMYQQLGREATNXXXXXXXXXXXSKIEMLLRQSRDPVSLDMPVGAD--EEAPLGDFIEDS
RPOD_SHEVI      INKLN-RISRQMLQEMGRETPEELAERMLMPEDKIRKVLK-IAKEPISMETPIGDDEDSHLGD---FIED
RPOD_MYXXA      KLIRTSRYLVQEIG--REPTPEEIAEKMELPLDKVRKVLK-IAKEPISLETPIGE---EEDSHLGDFIED
RPOD_SYNY3      HLYETISRIKKTTKLLSQERRKPTEEEIAEKMEMTIE-KLRFIAKSAQLPISLETPIGEEDSRLGDFIEA
RPSC_SYNY3      KIKRAQRKISQEKG--HTPKIDEVAEELGMTPEQVREV---LTQVPRSVSLELKVGQDKDTELMDL-LET
RPOD_LEPIN      KVIRETRLFIQEFG--RDPNNEEIAERLGWPVQKV-KMVKNVAREPISLEIPV---GSEEDSELGDFIPD
RPOD_LEPIC      KVIRETRLFIQEFG--RDPNNEEIAERLGWPVQKV-KMVKNVAREPISLEIPV---GSEEDSELGDFIPD
RPOD_STRAU      RVVRVQRRMLQERGY--EPTAEEVAVHLELTPERVLEV-LRLAQEPVSLHAPVGEEDDVALGD---LIED
RPOD_TREPA      KVTRESRQLLQKFGREPSD--EEIAQQLCWTVEKVKQV-KSVAREPISLETPIGE---EEDSSLGDFVPD
RPOD_CHLMU      TINKVLRGAKKLMMXXXXXXXXXXXXXXXXXXXDRVREIYKIAQHPISLQAE-VGDSGE--SSFGDFLED
RPOD_CHLTR      TINKVLRGAKKLMMXXXXXXXXXXXXXXXXXXXDRVREIYKIAQHPISLQAE-VGDGGE--SSFGDFLED
RPOD_MYCGE      ALYQELREPTD----------EELAEKMGGQAEKKIAEIKRLSLDPVSLDKTVGHD---EESQFGDFVKD
RPOD_COXBU      INKLNRISRQ----ILQETGIEATPEELGMPEEKVRKVLK-IAKEPISMETPIGEDEDSNLGD---FIED
RPSC_ANASP      KIKKAQRKIAQEKG--RTPTLEDLAIELDMTPTQVREVLLRVPR-SVSLETKVGKDKDTELGE---LLET
RPOD4_SYNE7     RIKKMTRELTHQLKRLPSR--AEIAEALKLPLQDV-EMLLSQSTPCTSLDAQARGDDG-RSFLGDLIPDP
HRDD_STRGR      E--FNRENGRD-------PEPAEIAAELSSTPERVTDV-LDWARDPVSLNMS-VDDEGE--TQFGDLLED
HRDA_STRCO      VVRVQRRMLQER---GCEPTPQEVAAHLDLAPERVGEV-LRLAQEPVSLHAPVGEEDDVALGD---LIED
HRDC_STRCO      LQKLAKVERKLRAGLDREPTTEEVAAESGIDVDKVVWL-RRVGRDAVSLDTP-VDETGDTVVGDLI----
RPOD_SERMA      INKLN-RISRQMLQEMGRETPEELAERMLMPEDKIRKVLK-IAKEPISMETPIGDDEDSHLGD---FIED
HRDD_STRVF      E--FNREHGRD-------PEPAEVAAELGSTPERVIDV-LDWARDPVSLNMA-VDDAGE--TQFGDLLED
RPOD3_SYNE7     KIKKMQRQLSQQLG--RTATLPELAAALDLTPAQVRDLEK--ARHPLSLDLRVGDN---QDTELGDLLET
RPOD_MYCTU      KLGRIQRELLQDLG--REPTPEELAKEMDITPEKVLEIQ-QYAREPISLDQTIGDEGDSQLG------DF
RPOD_MYCBO      KLGRIQRELLQDLG--REPTPEELAKEMDITPEKVLEIQ-QYAREPISLDQTIGDEGDSQLG------DF
RPSG_CLOAB      DIAYRALQVRDRL--ISKNNVSQIAKELKIPREEVI-FALDAIQDPISLFEPIYHDDGD-----AIYVMD
HRDD_STRCO      E--FNREHGRE-------PEPAEIAAELGSTPERVTDV-LDWARDPVSLNMS-VDDEGE--TQFGDLLED
RPSB_ANASP      KIKCVQRELSQKLGYIA--GVTEIAQALNL-EPSQIREYLQLVRQPVSLDMRIGFEXXXXXXXXXXXXMS
RPSG_BACSU      DIAYKALQVRER---LISETSKEIAKVLEVPHEEIV-FALDAIQDPVSLFEPIYNDGGD-----PIYVMD
RPOD2_SYNE7     KLKKTQRELSQQLG--RSATASELAEVLELPLEQVREY-IQMNRQPVSLDVKV----GXXXXXXXXXXXX
RPSF_BACSU      ELGNKIRRAKDELSKTLGRTVQEIADHLEIEAEDVV-LAQEAVRAPSSIHETVYENDGDPIT----LLDQ
RPSF_BACME      EMSNKIRKAKDELSKLLGRTVAEVAEHLDLTPEEVV-LAQEANRAPSSIHETVYENDGDPIT----LLDQ
RPSF_BACLI      ELGNKIRRAKEELSKSNGRTVQEIADYLEISSEEVV-MAQEAVRSPSSIHETVYENDGDPITLLD-QIAD
RPSB_BACAN      KIKLAIEELTDHL--QRSPKIIEIADHLGLSEEEVLEMDAKNNYRVSSL-----DDVVENASDGSSVARI
RPSE_BACSU      ----------------------------------------------------------------------
RPSD_BACSU      ---VEAAIEKLEQRYLRNVSPAEIAEELGMTVQDVVSMNEGFFANLLSIDEKLHDDDGENI--QVMIRDD
RP35_BACTK      ----------------------------------------------------------------------
RP35_BACCR      ----------------------------------------------------------------------
RP35_BACAN      ----------------------------------------------------------------------
RPSB_BACSU      ELGPRIKMAVDQLTTETSPKVEEIAEFLDVSEEEVLEMEMGKSYQALSVDHSIADSDGSTVT----ILDI
RPSE_CLOAB      ----------------------------------------------------------------------
RPSX_BACTK      ----------------------------------------------------------------------
RPOF_STRCO      ELWVQVNSATEDLAFGRSPTTAEIAERLRITEEEVLSIEAGRSYHATSLEAAQEXXXXXXXXXXXXYEDP
RPOF_STRAU      ELWVQVNAATEDLTTLRTPTTPEIAERLRISEDEVLSIEAGRSYHATSLEAAQEGDGMPGLLDRLGYEDP
RPSK_BACSU      GNFFHDKVNNCFFIFKSMPPLFVMNNEILMHLRALKKTKK---------DVSLHDPIGQDKEGNEISLID
RP28_BACTK      DV-----SLHDPIGQDKEGNEISLIDILKSESEDVIDM-----------------------IQLSMELEK
RP28_BACCR      DV-----SLHDPIGQDKEGNEISLIDILKSESEDVIDM-----------------------IQLSMELEK
RP28_BACAN      DV-----SLHDPIGQDKEGNEISLIDILKSESEDVIDM-----------------------IQLSMELEK
FLIA_SALTY      EVAQAMGQLEQELGRNATET--EVAERLGI---PVAEYRQMLLDTNNSQLFSYDEWREEHGDSIELVTEE
FLIA_SALTI      EVAQAMGQLEQELGRNATET--EVAERLGI---PVAEYRQMLLDTNNSQLFSYDEWREEHGDSIELVTEE
FLIA_ECOLI      SVRRNAREVAQAIG--------QLEQELG-RNATETEVAERLGIDIADYRQMLLDTNNSQLFSYDEWREE
FLIA_ECOL6      SVRRNAREVAQAIG--------QLEQELG-RNATETEVAERLGIDIADYRQMLLDTNNSQLFSYDEWREE
FLIA_ECO57      SVRRNAREVAQAIG--------QLEQELG-RNATETEVAERLGIDIADYRQMLLDTNNSQLFSYDEWREE
FLIA_PSEAE      SVHRNTRMVTDAIRAIEARTGRD-AKDHEVAAELQLSLEDYYILSDTQGSRLYSFDDLLQDGEHG--LPE
FLIA_YEREN      EVASAMQKVEQRLGRPATE--QEVAQNLDI---DLTEYRQILLDTNNSQLFSYDEEEHGESVEPMLEGHE
RPSH_BACSU      HIPLNSYASLDK----------------------------------------------------------
RPSH_BACLI      KPIYDEESDRTLLDVISGAKVMN-PEELIINQEEFDDIELKM--GELLSDL--------ERKVLALYLDG
RPSW_STRCO      ----------------------------------------------------------------------
SIGI_BACSU      ----------------------------------------------------------------------
RDRP_SHMV       ------------------EKFQDYCEKLGVDIDTVTELIDAISTGRAGITLDHTDDKEEQLPRSSSYLEE
SECA2_STRPN     KLVEKAQHASDSAGRSARRQTLEYAESMNIQRDIVYKERNRLIDGSRDLEERYTEEAADHYASRELLFHF


                         .         .         .         +         .         .         .:280
query           KSSNIEHQVVQQDYYDNFKAIVKDVLSGFDTRTKDIIMSRYLLDNKATLQDLAAKYNISAERVRQIEEDA
RP32_HAEIN      KXXXXXXXXXXXXXXXQATEQLGAALQSLDARSQDIIKARWLDDNKATLHDLAAKYNVSAERIRQLETNA
RP32_VIBVU      KSSDVADNLEAQNWEAHTNNRLAMALASLDERSQHIVRSRWLDDDKATLQDLAEMYGVSAERIRQLEKNA
RP32_CITFR      KSSNFADGIEEDNWEDQAANKLTHAMEGLDERSQDIIRARWLEDNKSTLQELADRYGVSAERVRQLEKNA
RP32_VIBCH      KHSDLADNLEAENWEAHTTQRLSMALASLDERSQHIVRARWLDDNKTTLQDLAEMYGVSAERIRQLEKNA
RP32_PSEAE      HRYDPARQLEDADWSDSSSANLHEALEGLDERSRDILQQRWLSEEKATLHDLAEKYNVSAERIRQLEKNA
RP32_ECOLI      KSSNFADGIEDDNWEEQAANRLTDAMQGLDERSQDIIRARWLEDNKSTLQELADRYGVSAERVRQLEKNA
RP32_ECOL6      KSSNFADGIEDDNWEEQAANRLTDAMQGLDERSQDIIRARWLEDNKSTLQELADRYGVSAERVRQLEKNA
RP32_ECO57      KSSNFADGIEDDNWEEQAANRLTDAMQGLDERSQDIIRARWLEDNKSTLQELADRYGVSAERVRQLEKNA
RP32_BUCAI      KTSNFANGVEQDNWEEHAANKLSSALLRLDERSRHIIHARWLDKNKKTLQNIANNYGISAERVRQLEKNA
RP32_SERMA      KSSDFAEGIEEDNWESNAADKLAYALEGLDERSQHIIRARWLDDNKSTLQELADQYGVSAERVRQLEKNA
RP32_BUCAP      KTSNFANGLEQDNWNKHTTSKLSNALLRLDERSRNIIRARWLKKEKNTLQKIANNYGISAERVRQLEKNA
RP32_PROMI      KSSDFA-DGIEEDNWDNHAARLTLAIKTLDERSQDIIRARWLEDNKSTLQELADKYGVSAERVRQLEKNA
RP32_ENTCL      KTSNFADGIEEDNWEDQAANKLTFAMEGLDERSQDIIRARWLEDNKSTLQELADRYGVSAERVRQLEKNA
RP32_BUCBP      SLSDFANHVEEDNWEAHKTNKLSNALSSLDERSRNIIHARWLSDHKMTLREIAHNYGISAERVRQLEKNA
RP32_RHIRD      HESQ-EAVLIEQDELETRRRMLAKAMGVLNDRERRIFEARRLAEDPVTLEELSSEFDISRERVRQIEVRA
RP32_CAUCR      QVSQ-ETRVAEDEEKSLRMSLLEEAMVELTDRERHILTERRLKDDPTTLEELAAQYGVSRERVRQIEVRA
RP32_CAUCN      QVSQ-ETRVAEDEEKSLRMSLLEEAMVELTDRERHILTERRLKDDPTTLEELAAQYGVSRERVRQIEVRA
RP32_ZYMMO      QEPLQDQQIEEEEESLVRHKLLIEAMDKLNDREKHILTERRLSDNPKTLEELSQVYGVSRERVRQIEVRA
RPSC_MYXXA      XXXXXXXXXRQQ--ANLTRELVQRALRRLDPRERFIIEQRVMGDAEMTLSELGEHFGFSRERARQLEIRA
RPSB_STIAU      AAAPQDDEFADKEEAGLINSRVHMALMRLDPRERFIIEQRVMNERPMTLKELGEHFGFSRERARQLE---
RPSB_MYXXA      AAAPQDDEFADKEEAGLINARVRAALMRLDPREPFIIEQRVMNERPMTLKELGEHFGFSRERARQLEIRA
RPOS_YEREN      ENENGPEDTTQDD--DMKQSIVK-WLFELNAKQREVLARRFLGYEAATLEDVGREIGLTRERVRQIQVEG
RPSD2_BACSP     QEALTPADAAA---YELLKEQLEDVLDTLTEREENVLRLRFGLDDTRTLEEVGKVFGVTRERIRQIEAKA
RPOD_STRMU      EV--IENPV---DYTTRLREQLDEVLDTLTDREENVLRLRFGLDDMRTLEDVGKVFDVTRERIRQIEAKA
RPOS_SHIFL      EKENGPEDTTQDD--DMKQSIVK-WLFELNAKQREVLARRFLGYEAATLEDVGREIGLTRERVRQIQVEG
RPOS_SALTY      EKENGPEDTTQDD--DMKQSIVK-WLFELNAKQREVLARRFLGYEAATLEDVGREIGLTRERVRQIQVEG
RPOS_SALTI      EKENGPEDTTQDD--DMKQSIVK-WLFELNAKQREVLARRFLGYEAATLEDVGREIGLTRERVRQIQVEG
RPOS_SALDU      EKENGPEDTTQDD--DMKQSIVK-WLFELNAKQREVLARRFLGYEAATLEDVGREIGLTRERVRQIQVEG
RPOS_ECOLI      EKENGPEDTTQDD--DMKQSIVK-WLFELNAKQREVLARRFLGYEAATLEDVGREIGLTRERVRQIQVEG
RPOD_LISMO      QTSPSDHAA-----YELLKEQLEDVLDTLTDREENVLRLRFGLDDTRTLEEVGRVFGVTRERIRQIEAKA
RPOD_LISIN      QTSPSDHAA-----YELLKEQLEDVLDTLTDREENVLRLRFGLDDTRTLEEVGRVFGVTRERIRQIEAKA
RPOS_COXBU      NNIDPARLIQNVDLQDH----IERWLAQLDERHREVVILRFGLNEKGTLEAVGKAVGLTRERVRQIQIDA
RPOS_VIBCH      DSHNADPEFSTQD--DDIRESLLNWLDELNPKQKEVLARRFLGYEPSTLEEVGREINLTRERVRQIQVEG
RPOD_STAES      QQSPSDHAA-----YELLKEQLEDVLDTLTDREENVLRLRFGLDDTRTLEEVGKVFGVTRERIRQIEAKA
RPOD_STAEQ      QQSPSDHAA-----YELLKEQLEDVLDTLTDREENVLRLRFGLDDTRTLEEVGKVFGVTRERIRQIEAKA
RPOD_STAAW      QQSPSDHAA-----YELLKEQLEDVLDTLTDREENVLRLRFGLDDTRTLEEVGKVFGVTRERIRQIEAKA
RPOD_STAAS      QQSPSDHAA-----YELLKEQLEDVLDTLTDREENVLRLRFGLDDTRTLEEVGKVFGVTRERIRQIEAKA
RPOD_STAAR      QQSPSDHAA-----YELLKEQLEDVLDTLTDREENVLRLRFGLDDTRTLEEVGKVFGVTRERIRQIEAKA
RPOD_STAAN      QQSPSDHAA-----YELLKEQLEDVLDTLTDREENVLRLRFGLDDTRTLEEVGKVFGVTRERIRQIEAKA
RPOD_STAAM      QQSPSDHAA-----YELLKEQLEDVLDTLTDREENVLRLRFGLDDTRTLEEVGKVFGVTRERIRQIEAKA
RPOD_STAAC      QQSPSDHAA-----YELLKEQLEDVLDTLTDREENVLRLRFGLDDTRTLEEVGKVFGVTRERIRQIEAKA
RPOD_STAA8      QQSPSDHAA-----YELLKEQLEDVLDTLTDREENVLRLRFGLDDTRTLEEVGKVFGVTRERIRQIEAKA
RPOD_HELPJ      KNSSIDH-IMRED----LKAQIESVLDQLNEREKAVIRMRFLLDDESTLEEIGKELNVTRERVRQIESSA
RPOD_HELPY      KNSSIDH-IMRED----LKAQIESVLDQLNEREKAVIRMRFLLDDESTLEEIGKELNVTRERVRQIESSA
RPOD_XANAC      --TNVE-SPIDNTTNINLSETVRDVLAGLTPREAKVLRMRFGIDMNTTLEEVGKQFDVTRERIRQIEAKA
RPOD_LACLC      --DVIESPV---DYTNRLREQLDEVMDTLTDREENVLRMRFGLDDMHTLEDVGKQFKVTRERIRQIEAKA
RPOD_BACSU      QTSPSDHAA-----YELLKEQLEDVLDTLTDREENVLRLRFGLDDTRTLEEVGKVFGVTRERIRQIEAKA
RPOD_XANCP      --TNVE-SPIDNTTNINLSETVRDVLAGLTPREAKVLRMRFGIDMNTTLEEVGKQFDVTRERIRQIEAKA
RPOD_LACLA      --DVIESPV---DYTNRLREQLDEVMDTLTDREENVLRMRFGLDDMHTLEDVGKQFKVTRERIRQIEAKA
RPOD_CHLPN      TA---VESPAEATGYSMLKDKMKEVLKTLTDRERFVLIHRFLLDGKKTLEEVGSAFNVTRERIRQIEAKA
RPOD_STRR6      EV--IENPV---DYTTRLREQLDEILDTLTDREENVLRLRFGLDDMRTLEDVGKVFNVTRERIRQIEAKA
RPOD_STRPN      EV--IENPV---DYTTRLREQLDEILDTLTDREENVLRLRFGLDDMRTLEDVGKVFNVTRERIRQIEAKA
RPOD_XYLFT      --PNVE-SPVDTTTNVNLSETVREVLAGLTPREAKVLRMRFGIDMNTTLEEVGKQFDVTRERIRQIEAKA
RPOD_THEMA      DSIASPXXXXXXXXXXXXXXXXXXTLS---PREAMVLRMRYLLDGKKTLEEVGQYFNVTRERIRQIEVKA
RPOD_BUCAP      TTLELP---LDSATSESLRSATHDVLSGLTAREAKVLRMRFGIDMNTTLEEVGKQFDVTRERIRQIEAKA
RPOD_BUCAI      TTLELP---LDSATSESLRSATHDVLSGLTAREAKVLRMRFGIDMNTTLEEVGKQFDVTRERIRQIEAKA
RPOD_SALTY      TTLELP---LDSATTESLRAATHDVLAGLTAREAKVLRMRFGIDMNTTLEEVGKQFDVTRERIRQIEAKA
RPOD_SALTI      TTLELP---LDSATTESLRAATHDVLAGLTAREAKVLRMRFGIDMNTTLEEVGKQFDVTRERIRQIEAKA
RPOD_ECOLI      TTLELP---LDSATTESLRAATHDVLAGLTAREAKVLRMRFGIDMNTTLEEVGKQFDVTRERIRQIEAKA
RPOD_XYLFA      --PNVE-SPVDTTTNVNLSETVREVLAGLTPREAKVLRMRFGIDMNTTLEEVGKQFDVTRERIRQIEAKA
RPOD_RHOCA      KNAILP---LDSAIQENLKETTTRVLASLTPREERVLRMRFGMNTDHTLEEVGQQFSVTRERIRQIEAKA
RPOD_BACHD      QDALAPSDAAA---YELLKEQLEDVLDTLTDREENVLRLRFGLDDTRTLEEVGKVFGVTRERIRQIEAKA
RPOS_PSEAE      XXXXXXXCELLQD--DDLSESIDQWLTELTDKQREVVIRRFGLHESSTLEEVGQEIGLTRERVRQIQVEA
RPOD_CLOAB      IXXXXXXXXXXXXXFRMLKEQLLKILNTLTPREEKVLRLRFGLDDARTLEEVGKEFNVTRERIRQIEAKA
RPOD_HAEIN      STLELP---LDSATAQSLKVATHEVLEGLTPREAKVLRMRFGIDMNTTLEEVGKQFDVTRERIRQIEAKA
RPOD_BUCBP      --TNIE-LPLDSATSASLRSATKNVLSGLTTREAKVLRMRFGIDMNTTLEEVGKQFDVTRERIRQIEAKA
RPOD_NEIGO      ANNVAPADAAM---YTSLHEVTKEILESLTPREAKVLRMRFGIDMNTTLEEVGRQFDVTRERIRQIEAKA
RPOD_ENTFA      QTSPAEHAA-----YELLKEQLEDVLDTLTDREENVLRLRFGLDDTRTLEEVGKVFGVTRERIRQIEAKA
RPOD_PSEPU      STMQSPIYVAT---VESLKEATRDVLSGLTAREAKVLRMRFGIDMNTTLEEVGKQFDVTRERIRQIEAKA
RPOD_PSEFL      STMQSPIDVAT---VESLKEATREVLSGLTAREAKVLRMRFGIDMNTTLEEVGKQFDVTRERIRQIEAKA
RPOD_CAUCR      KNAILPIDAAIQ---SNLRETTTRVLASLTPREERVLRMRFGMNTDHTLEEVGQQFSVTRERIRQIEAKA
RPOD_ANASP      DGETPEDQVSK----NLLREDLEKVLDSLSPRERDVLRLRYGLDDMKTLEEIGQIFNVTRERIRQIEAKA
RPOD_RHIME      KNALLPIDAAIQ---ANLRETTTRVLASLTPREERVLRMRFGMNTDHTLEEVGQQFSVTRERIRQIEAKA
RPOD_PSEAE      STM---QSPIEMATSESLKESTREVLAGLTAREAKVLRMRFGIDMNTTLEEVGKQFDVTRERIRQIEAKA
RPOD_AGRT5      KNALLPIDAAIQ---ANLRETTTRVLASLTPREERVLRMRFGMNTDHTLEEVGQQFSVTRERIRQIEAKA
RPOD_RICTY      KNAVAPIDAAIQ---SNLREVTTRVLATLTPREERVLRMRFGMNTDHTLEEVGQQFKVTRERIRQIESKA
RPOD_RICPR      KNAVAPIDAAIQ---SNLREVTTRVLATLTPREERVLRMRFGMNTDHTLEEVGQQFKVTRERIRQIESKA
RPOD_RICFE      KNAVAPIDAAIQ---SNLREVTTRVLATLTPREERVLRMRFGMNTDHTLEEVGQQFKVTRERIRQIESKA
RPOD_RICCN      KNAVAPIDAAIQ---SNLREVTTRVLATLTPREERVLRMRFGMNTDHTLEEVGQQFKVTRERIRQIESKA
RPOD_MYCPN      TDAQMPDEFTERSNYEKIDELLNNCLSEQEELIVRMRIGMPPYNETKTLDEVSQKIKIPREKIRQIETKA
RPOD_MICAE      DGETPEDEVSK----NLLREDLENVLDTLSPRERDVLRLRYGLDDMKTLEEIGQIFNVTRERIRQIEAKA
RPOD1_SYNE7     DGETPEDEVAK----NLLREDLEGVLSTLSPRERDVLRLRYGLDDMKTLEEIGQLFNVTRERIRQIEAKA
HRDB_STRGR      SEAVVPADAVS---FTLLQEQLHSVLDTLSEREAGVVSMRFGLTDPKTLDEIGKVYGVTRERIRQIESKT
HRDB_STRCO      SEAVVPADAVS---FTLLQEQLHSVLDTLSEREAGVVSMRFGLTDPKTLDEIGKVYGVTRERIRQIESKT
RPOD_RICBR      KNAVAPIDAAIQ---SNLREVTTRVLATLTPREERVLRMRFGMNTDHTLEEVGQQFKVTRERIRQIESKA
RPOD_BORBU      KAANHTSFVVLQDQ-------IRAILGTLPEREQEVVKMRFGLEDSLTLEEVGLHFNVTRERIRQIESKA
RPSB_CORDI      EATDAESAVVASLRHSD----IRTVLDTLEQREQDVIRLRYGLDDPRTLDQIGRQFGLSRERVRQIEREV
RPOD_SHEVI      TTLELP---LDSATGESLRNATHEVLAGLTAREAKVLRMRFGIDMNTTLEEVGKQFDVTRERIRQIEAKA
RPOD_MYXXA      KSLVSPADAV---INMNLAEQTRKVLATLTPREEKVLRMRFGIGEKSTLEEVGQDFEVTRERIRQIEAKA
RPOD_SYNY3      DGETPEDEVSK----NLLREDLENVLDTLSPRERDVLRLRYGLDDMKTLEEIGQIFNVTRERIRQIEAKA
RPSC_SYNY3      DTQSPEDELMREALQNDMQEILLDL----TPREQEVIALRFGFQDGVSLSEIGRILNLSRERVRQIEAKA
RPOD_LEPIN      TEVETPVNAAASSI---LAEQIRQVLHTLPAREQKVIRMRFGLDDPQTLEEVGYQFKVTRERIRQIEAKA
RPOD_LEPIC      TEVETPVNAAASSI---LAEQIRQVLHTLPAREQKVIRMRFGLDDPQTLEEVGYQFKVTRERIRQIEAKA
RPOD_STRAU      --GDAASPVESAAFFLRCEHL-EAVLSTLGERERKVVQLRYLADGRRTLEEIGRIFGVTRERIRQIESKT
RPOD_TREPA      ADVENPSRVTERVL---LKEEVRSILSALPAREHEVLRMRFGLDGSQTLEEVGLYFDVTRERIRQIEAKA
RPOD_CHLMU      TA---VESPAEATGYSMLKDKMKEVLKTLTDRERFVLIHRFLLDGRKTLEEVGSAFNVTRERIRQIEAKA
RPOD_CHLTR      TA---VESPAEATGYSMLKDKMKEVLKTLTDRERFVLIHRFLLDGRKTLEEVGSAFNVTRERIRQIEAKA
RPOD_MYCGE      TDAQTPDEFTES--RSNSEKIDXXXXXXXXXXXXXIVRMRIGMNEPKTLDEVGQKILIPREKIRQIENKA
RPOD_COXBU      --INMESPV---DFATSLMEATREILSTLTPREAKVLRMRFGIDMNTTLEEVGKQFDVTRERIRQIEAKA
RPSC_ANASP      DGVTPEEMLMRESLQRDLQHLLADLTS----RERDVILMRFGLGHPYSLAEIGRALDLSRERVRQIESKA
RPOD4_SYNE7     KSLEPMDAMDRHIQHEQ----ISTWLAHLTEREQQVLQLRFGLHDQHTLAEIGRRLNVSRERIRQVEARA
HRDD_STRGR      TSAVSPEQSVLTLLRSE---ELDDLIGQLDDRTASIIKMRYGIEDERTLTEVGKQHGLTRERIRQIEKHA
HRDA_STRCO      GDA---ASPVESAAFLLLRQHLEAVLSTLGERERKVVQLRYLADGRRTLEEIGRLFGVTRERIRQIESKT
HRDC_STRCO      ----PDTEVLRAPEVAEFQALAAELREAVGTRESLILSLRYGLHDPRTLQQVAQHVGLTRERVRQLEKES
RPOD_SERMA      TTLELP---LDSATSESLRSATHDVLAGLTAREXKVLRMRFGIDMNTTLEEVGKQFDVTRERIRQIEAKA
HRDD_STRVF      TSAVSPEQSVLTLLRSE---ELDDLIGRLDQRTASIIKMRYGIDDERTLTEVGKEHGLTRERIRQI----
RPOD3_SYNE7     DCTTPEEFTLQA----SMRRDIDRLLDQLTEQQRQVIALRYGLEDVMTLASIGDRLQISRERVRQLEREA
RPOD_MYCTU      IXXXXXXXXXXXXXFTLLQDQLQSVLDTLSEREAGVVRLRFGLTDPRTLDEIGQVYGVTRERIRQIESKT
RPOD_MYCBO      IXXXXXXXXXXXXXFTLLQDQLQSVLDTLSEREAGVVRLRFGLTDPRTLDEIGQVYGVTRERIRQIESKT
RPSG_CLOAB      QIS--DNKNLDDSWLQNIS--IKEAMKKLSDREKMILNMRFF--DGRTQMEVADEIGISQAQVSRLEKTA
HRDD_STRCO      TSAVSPEQSVLTLLRSE---ELDDLIGRLDPRTASIIKMRYGIDDERTLTEVGKEHGLTRERIRQI----
RPSB_ANASP      PERYAERELLYQD--------IHNLLAKLTPQQKEVLILRFGLAGELTLVQISQRMGISRERVRQVEKQA
RPSG_BACSU      QISNTDSQWIEE-------LALKEGMRRLNDREKMILRKRFF--QGKTQMEVAEEIGISQAQVSRLEKAA
RPOD2_SYNE7     XXXXXXXXYVEQ---ESLRRDLRNLMAELTPQQQAVIALRYGLDDSLSLAKVGERLNISRERVRKLERQA
RPSF_BACSU      IADNSE-----EKWFD--KIALKEAISDLEEREKLIVYLRYYKDQ--TQSEVAERLGISQVQVSRLEKKI
RPSF_BACME      IADHTEAK-----WFD--KIALKEAIEELDEREKLIVYLRYYKDQ--TQSEVAARLGISQVQVSRLEKKI
RPSF_BACLI      QS--------EEKWFD--KIALKEAIKDLDEREKLIVYLRYYKDK--TQSEVADRLGISQVQVSRLEK--
RPSB_BACAN      ESVGEVEQGYEQ---TERRLVLKDIFNVLNETEKSVI--HYIFEENLNQKDTGERLGISQMHVSRIKRQA
RPSE_BACSU      ----------------------------------------------------------------------
RPSD_BACSU      KNVPPEEKIMKDELIAQLAEKIHEL-----SEKEQLVVSLFYKE-ELTLTEIGQVLNLSTSRISQIHSKA
RP35_BACTK      ----------------------------------------------------------------------
RP35_BACCR      ----------------------------------------------------------------------
RP35_BACAN      ----------------------------------------------------------------------
RPSB_BACSU      VGS-------QEDGYENQQLMLQSVLHVLSDREKQIIDLTY-IQNKSQ-KETGDILGISQMHVSRLQRKA
RPSE_CLOAB      ----------------------------------------------------------------------
RPSX_BACTK      ----------------------------------------------------------------------
RPOF_STRCO      ALDGVEH-----------RDLVRHLLVQLPEREQRILLLRYY--SNLTQSQISAELGVSQMHVSRLLARS
RPOF_STRAU      ELAGVEH-----------RDLVRHLLVQLPEREQRILLLRYY--NNLTQSQISAELGVSQMHV-------
RPSK_BACSU      VLKSENEDVIDTIQLNMELEKVKQYIDILDDREKEVIVGRFGLDLKKTQREIAKELGISRSYVSRIEKRA
RP28_BACTK      ---------------------IKEYIDILDEREKEVIVKRFGLDKEKTQREIAKALGISRSYVSRIEKRA
RP28_BACCR      ---------------------IKEYIDILDEREKEVIVKRFGLDKEKTQREIAKALGISRSYVSRIEKRA
RP28_BACAN      ---------------------IKEYIDILDEREKEVIVKRFGLDKEKTQREIAKALGISRSYVSRIEKRA
FLIA_SALTY      QQENPLHQLLEGD----LRQRVMDAIESLPEREQLVLTLYY--QEELNLKEIGAVLEVGESRVSQLHSQA
FLIA_SALTI      QQENPLHQLLEGD----LRQRVMDAIESLPEREQLVLTLYY--QEELNLKEIGAVLEVGESRVSQLHSQA
FLIA_ECOLI      HGDSIEHQPLQQLLDSNLRQRVMEAIETLPEREKLVLTLYY--QEELNLKEIGAVLEVGESRVSQLHSQA
FLIA_ECOL6      HGDSIEHQPLQQLLDSNLRQRVMEAIETLPEREKLVLTLYY--QEELNLKEIGAVLEVGESRVSQLHSQA
FLIA_ECO57      HGDSIEHQPLQQLLDSNLRQRVMEAIETLPEREKLVLTLYY--QEELNLKEIGAVLEVGESRVSQLHSQA
FLIA_PSEAE      DTSLSHNEPIHGLLDERFQAALADAIAKLPERERLVLALYY--DEELNLKEIGEVLGVSESRVSQL----
FLIA_YEREN      DANPLQHLL-----EGNLRQRVIEAIEALPEREKMVLTLYY--QEELNLKEIGAVLEVGESRVSQLHSQA
RPSH_BACSU      ----------------------------------------------------------------------
RPSH_BACLI      RS----YQEISEELNRHVKSI-------------------------------------------------
RPSW_STRCO      ----------------------------------------------------------------------
SIGI_BACSU      ----------------------------------------------------------------------
RDRP_SHMV       EPSD------------------------------------------------------------------
SECA2_STRPN     IVTNISFHVKEPDYIDAVRSFMKQVIDKELSEKKELLNQHDLYEQFLRLSLLKA---IDDNWVEQV--DY


                         .         *         .         .         .         .         +:350
query           LAKLKKAIKNRS
RP32_HAEIN      LKKLKSAV----
RP32_VIBVU      MKKLKMAV----
RP32_CITFR      MKKLRAAIE---
RP32_VIBCH      MRKLKEAV----
RP32_PSEAE      MSKLKGRI----
RP32_ECOLI      MKKLRAAIE---
RP32_ECOL6      MKKLRAAIE---
RP32_ECO57      MKKLRAAIE---
RP32_BUCAI      MKKLKLAIE---
RP32_SERMA      MKKLKMAIE---
RP32_BUCAP      MKKLKIAIEN--
RP32_PROMI      MKKLRLAIED--
RP32_ENTCL      MKKLRAAIE---
RP32_BUCBP      MKKLKVAIE---
RP32_RHIRD      FEKVQEAVQKEA
RP32_CAUCR      FEKLQKTMR---
RP32_CAUCN      FEKLQKTMR---
RP32_ZYMMO      FDKLQKAI----
RPSC_MYXXA      KDKLKLAL----
RPSB_STIAU      ------------
RPSB_MYXXA      KDKLKSEL----
RPOS_YEREN      LRRLREILQ---
RPSD2_BACSP     LRKLRHPSRSK-
RPOD_STRMU      LRKLRHPSRSK-
RPOS_SHIFL      LRRLREILQTQ-
RPOS_SALTY      LRRLREILQTQ-
RPOS_SALTI      LRRLREILQTQ-
RPOS_SALDU      LRRLREILQTQ-
RPOS_ECOLI      LRRLREILQTQ-
RPOD_LISMO      LRKLRHPSRSK-
RPOD_LISIN      LRKLRHPSRSK-
RPOS_COXBU      LQQLRHILE---
RPOS_VIBCH      LRRLREIL----
RPOD_STAES      LRKLRHPSRSK-
RPOD_STAEQ      LRKLRHPSRSK-
RPOD_STAAW      LRKLRHPSRSK-
RPOD_STAAS      LRKLRHPSRSK-
RPOD_STAAR      LRKLRHPSRSK-
RPOD_STAAN      LRKLRHPSRSK-
RPOD_STAAM      LRKLRHPSRSK-
RPOD_STAAC      LRKLRHPSRSK-
RPOD_STAA8      LRKLRHPSRSK-
RPOD_HELPJ      IKKLR-------
RPOD_HELPY      IKKLR-------
RPOD_XANAC      LRKLR-------
RPOD_LACLC      IKKLR-------
RPOD_BACSU      LRKLRHPSRSK-
RPOD_XANCP      LRKLR-------
RPOD_LACLA      IKKLR-------
RPOD_CHLPN      LRKMRHPIRSK-
RPOD_STRR6      LRKLRQPSRSK-
RPOD_STRPN      LRKLRQPSRSK-
RPOD_XYLFT      LRKLR-------
RPOD_THEMA      LRKLR-------
RPOD_BUCAP      LRKLR-------
RPOD_BUCAI      LRKLR-------
RPOD_SALTY      LRKLR-------
RPOD_SALTI      LRKLR-------
RPOD_ECOLI      LRKLR-------
RPOD_XYLFA      LRKLR-------
RPOD_RHOCA      LRKLKHPSRSR-
RPOD_BACHD      LRKLRHPSRSK-
RPOS_PSEAE      LKRLREILE---
RPOD_CLOAB      LRKLRHPSRSK-
RPOD_HAEIN      LRKLR-------
RPOD_BUCBP      LRKLR-------
RPOD_NEIGO      LRKLR-------
RPOD_ENTFA      LRKLRHPSRSK-
RPOD_PSEPU      WRKLR-------
RPOD_PSEFL      LRKLR-------
RPOD_CAUCR      LRKLKHPSRSR-
RPOD_ANASP      LRKLRHPNRN--
RPOD_RHIME      LRKLKHPSRSR-
RPOD_PSEAE      LRKLR-------
RPOD_AGRT5      LRKLKHPSRSR-
RPOD_RICTY      LRKLQHPIRSK-
RPOD_RICPR      LRKLQHPIRSK-
RPOD_RICFE      LRKLQHPIRSK-
RPOD_RICCN      LRKLQHPIRSK-
RPOD_MYCPN      IRKLRQAVRN--
RPOD_MICAE      LRKLRHPNRN--
RPOD1_SYNE7     LRKLRHPNRN--
HRDB_STRGR      MSKLR-------
HRDB_STRCO      MSKLR-------
RPOD_RICBR      LRKLQHPIRSK-
RPOD_BORBU      LRRLKNPKKTQ-
RPSB_CORDI      MSKLR-------
RPOD_SHEVI      LRKLR-------
RPOD_MYXXA      LRKLRHPSRSK-
RPOD_SYNY3      LRKLRHPNRN--
RPSC_SYNY3      LQKL--------
RPOD_LEPIN      LRRLRHPSRSK-
RPOD_LEPIC      LRRLRHPSRSK-
RPOD_STRAU      LNKLR-------
RPOD_TREPA      LKRLR-------
RPOD_CHLMU      LRKMRHPIRSK-
RPOD_CHLTR      LRKMRHPIRSK-
RPOD_MYCGE      IRKLRHAVRN--
RPOD_COXBU      LRKLR-------
RPSC_ANASP      LQKLRQ------
RPOD4_SYNE7     LQKLR-------
HRDD_STRGR      LLELKR------
HRDA_STRCO      LSKLR-------
HRDC_STRCO      LAHL-RAPENR-
RPOD_SERMA      LRKLR-------
HRDD_STRVF      ------------
RPOD3_SYNE7     LHTLRQA-----
RPOD_MYCTU      MSKLR-------
RPOD_MYCBO      MSKLR-------
RPSG_CLOAB      LKHMKKYV----
HRDD_STRCO      ------------
RPSB_ANASP      LTLLRRGIDSRS
RPSG_BACSU      IKQMNKNI----
RPOD2_SYNE7     MDHLRR------
RPSF_BACSU      LKQIK-------
RPSF_BACME      LKQMK-------
RPSF_BACLI      --KILKQIKNQ-
RPSB_BACAN      ISKLKQA-----
RPSE_BACSU      ------------
RPSD_BACSU      LFKLKNLLE---
RP35_BACTK      ------------
RP35_BACCR      ------------
RP35_BACAN      ------------
RPSB_BACSU      VKKLREAL----
RPSE_CLOAB      ------------
RPSX_BACTK      ------------
RPOF_STRCO      FQRLRSA-----
RPOF_STRAU      ------------
RPSK_BACSU      LMKM--------
RP28_BACTK      LMKM--------
RP28_BACCR      LMKM--------
RP28_BACAN      LMKM--------
FLIA_SALTY      IKRLR-------
FLIA_SALTI      IKRLR-------
FLIA_ECOLI      IKRLR-------
FLIA_ECOL6      IKRLR-------
FLIA_ECO57      IKRLR-------
FLIA_PSEAE      ------------
FLIA_YEREN      IKRLRARLNNDS
RPSH_BACSU      ------------
RPSH_BACLI      ------------
RPSW_STRCO      ------------
SIGI_BACSU      ------------
RDRP_SHMV       ------------
SECA2_STRPN     LQQLSMAIGGQS