[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD31158.1

[Show Plain Result]


## Summary of Sequence Search
    1::364
   32::394     4e-31  28%  399 aa  RND_HAEIN RecName: Full=Ribonuclease D;         Short=RNase D;     
  221::567     5e-27  27%  777 aa  RRP6_SCHPO RecName: Full=Exosome complex exonuclease rrp6;       
    5::366     9e-27  26%  375 aa  RND_ECOLI RecName: Full=Ribonuclease D;         Short=RNase D;     
  216::477     2e-23  30%  733 aa  RRP6_YEAST RecName: Full=Exosome complex exonuclease RRP6;       
  291::546     3e-18  30%  885 aa  EXOSX_HUMAN RecName: Full=Exosome component 10;AltName:
  290::546     2e-17  27%  887 aa  EXOSX_MOUSE RecName: Full=Exosome component 10;AltName:
  439::628     2e-09  28%  719 aa  MUT7_AEDAE RecName: Full=Probable exonuclease mut-7 homolog;       
   12::283     3e-07  29%  574 aa  DPO1_AQUAE RecName: Full=DNA polymerase I;         Short=POL I;    
  172::241     2e-06  39%  570 aa  EXD1_MOUSE RecName: Full=Exonuclease 3'-5' domain-containing
  137::210     5e-06  37%  444 aa  EXD1_XENLA RecName: Full=Exonuclease 3'-5' domain-containing
  152::226     6e-06  36%  378 aa  EXD1_DANRE RecName: Full=Exonuclease 3'-5' domain-containing
  167::353     1e-05  26% 1009 aa  SBCC_STAAW RecName: Full=Nuclease sbcCD subunit C;
  167::353     1e-05  26% 1009 aa  SBCC_STAAT RecName: Full=Nuclease sbcCD subunit C;
  167::353     1e-05  26% 1009 aa  SBCC_STAAE RecName: Full=Nuclease sbcCD subunit C;
  167::353     1e-05  26% 1009 aa  SBCC_STAAC RecName: Full=Nuclease sbcCD subunit C;
  167::353     1e-05  26% 1009 aa  SBCC_STAA3 RecName: Full=Nuclease sbcCD subunit C;
  115::184     1e-05  39%  514 aa  EXD1_HUMAN RecName: Full=Exonuclease 3'-5' domain-containing
  167::353     1e-05  26% 1009 aa  SBCC_STAAS RecName: Full=Nuclease sbcCD subunit C;
  167::353     1e-05  26% 1009 aa  SBCC_STAA8 RecName: Full=Nuclease sbcCD subunit C;
  167::346     1e-04  26% 1009 aa  SBCC_STAAB RecName: Full=Nuclease sbcCD subunit C;
  167::346     5e-04  26% 1009 aa  SBCC_STAAR RecName: Full=Nuclease sbcCD subunit C;
    1::364

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xIINTNKQLNNVIEILKNTSQIAVDTEFYWMRTYYPELCLVQLATENEIFLIDTLKDLEFKKLKEIFEDK
RND_HAEIN       -VVTDNTALLEVCNLAQQKSAVALDTEFMRVSTYFPKLGLIQLYDGEHVSLIDPLAITDFSPFVALLANP
RRP6_SCHPO      --VSTESQLSDMLKELQNSKEIAVDLEHHDYRSFRGFVCLMQISNREKDWIVDTLEREELEALNVVFTNP
RND_ECOLI       -MITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPLGITDWSPLKAILRDP
RRP6_YEAST      --VDTSTELESMLEDLKNTKEIAVDLEHHDYRSYYGIVCLMQISTRERDYLVDTLKLRELHILNEVFTNP
EXOSX_HUMAN     --ISSLDELVELNEKLLNCQEFAVDLEHHSYRSFLGLTCLMQISTRTEDFIIDTLERSDMYILNESLTDP
EXOSX_MOUSE     -LVSSLDELVELNEKLLGCQEFAVDLEHHSYRSFLGLTCLMQISTRTEDFIVDTLERSDMYILNESLTDP
MUT7_AEDAE      -LVDSKDKFYAMLSDLCRQSMIAFDSE--WKPTFANEVSLIQLATWDDVYMIDVLEPLDWAALKNVFNRD
DPO1_AQUAE      --------LKKAIKRLENSPYLYLDTE-----TTGDRIRLVQIGDEENTYVIDLYEIQDIEPLRKLINER
EXD1_MOUSE      ------------------------------------KLCWLQVATNSRVYLFDILGSRAFNNLQMILEDK
EXD1_XENLA      ------------------------------------KLSWLQFATRSRVYLFDVLVSKVFKNLQMVLEDK
EXD1_DANRE      -------------------------------------LCWLQVATKKVVYLFDILLGPAFKNLSMILENT
SBCC_STAAW      ----------------------------------------------------------------------
SBCC_STAAT      ----------------------------------------------------------------------
SBCC_STAAE      ----------------------------------------------------------------------
SBCC_STAAC      ----------------------------------------------------------------------
SBCC_STAA3      ----------------------------------------------------------------------
EXD1_HUMAN      ------------------------------------KLCWLQVATNCRVYLFDILGSRAFHNLQMILEDK
SBCC_STAAS      ----------------------------------------------------------------------
SBCC_STAA8      ----------------------------------------------------------------------
SBCC_STAAB      ----------------------------------------------------------------------
SBCC_STAAR      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DILKIIHSATNDIPIIKRFFNCEVNNIFDTQLAATFLGFQTQSSXXXXXXXXXXXXXXXXSQFSDWRNRP
RND_HAEIN       KVLKILHSCSEDLLVFLQEFDQLPRPMIDTQIMARFLGLGTSAGLAKLAQQYLNVEIDKGATRTNWIKRP
RRP6_SCHPO      NIIKVFHGATMDIIWLQRDFGLYVVNLFDTYYATKVLGFEGH-GLAFLLQKYCDYDADKRYQMADWRIRP
RND_ECOLI       SITKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMSWGFASMVEEYSGVTLDKSESRTDWLARP
RRP6_YEAST      SIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIGL-PRHSLAYLLENFANFKTSKKYQLADWRIRP
EXOSX_HUMAN     AIVKVFHGADSDIEWLQKDFGLYVVNMFDTHQAARLLNL-GRHSLDHLLKLYCNVDSNKQYQLADWRIRP
EXOSX_MOUSE     AIVKVFHGADSDIEWLQKDFGLYVVNMFDTHQAARLLNL-ARHSLDHLLRLYCGVESNKQYQLADWRIRP
MUT7_AEDAE      DVLKLSFAPSTDISMFQKALP-SFNVMYSSQSTSAILDLQVNQNLANLVRLCLGKKLDKSNQFSNWAQRP
DPO1_AQUAE      GIVG--HNLKFDLKYLYRY-GIFPSATFDTMIASYLLGYE-RHSLNHIVSNLLGYSMDKSYQTSDWGASV
EXD1_MOUSE      RILKVIHDCRWLSDCLSHQYGIMLNNVFDTQVA-------------------------------------
EXD1_XENLA      GILKVIHDCRWLGDILSHQYGIILNNVFDTQVGDVYL---------------------------------
EXD1_DANRE      HILKVLHDCRCITRCLRTEFRVQLTNVFDTQVAELLLFF-------------------------------
SBCC_STAAW      ----------------------------------------------------------------------
SBCC_STAAT      ----------------------------------------------------------------------
SBCC_STAAE      ----------------------------------------------------------------------
SBCC_STAAC      ----------------------------------------------------------------------
SBCC_STAA3      ----------------------------------------------------------------------
EXD1_HUMAN      RILKVIHDCRWLSDCLSHQYGILLNNVFDTQVA-------------------------------------
SBCC_STAAS      ----------------------------------------------------------------------
SBCC_STAA8      ----------------------------------------------------------------------
SBCC_STAAB      ----------------------------------------------------------------------
SBCC_STAAR      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LTQNQLNYAIKDVEYLIQLKEYLQQQLAKSEYQDFFEQELIEVQKTQFNSIENIHAKIGNIQKFDEKTQR
RND_HAEIN       LSDIQLQYAAGDVWYLLPLYHILEKELAKTPWEDDCELVLAKTHKLQERDSEKAYLDIPNAWKLNPLELS
RRP6_SCHPO      LPREMLKYAQSDTHYLLYIWDHLRNELISKSAERFNSSKQISLRKYELEPYDNVLTKFGSSKIIGREALM
RND_ECOLI       LTERQCEYAAADVWYLLPITAKLMVETEASGWAALDECRLMQMRRQEVVAPEDAWRDITNAWQLRTRQLA
RRP6_YEAST      LSKPMTAYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFTPSSEVYSPIEKMYQYNIPPER
EXOSX_HUMAN     LPEEMLSYARDDTHYLLYIYDKMQLQVVWQRSRDICLKKFIKPIFTDESYLE-LYRK----QKKHLNTQQ
EXOSX_MOUSE     LPEEMLSYARDDTHYLLYIYDRMQLQVVWQRSRDICLKKFVKPIFTDESYLELYRKQ----KKHLNSQQL
MUT7_AEDAE      LRKEQLRYAALDAFCLLEIYDAIEKQL-------------------------------------------
DPO1_AQUAE      LSDAQLKYAANDVIVLRELFPKMRDML--NELDAERGEELLKTRT----------AKI-----FDLKSPV
EXD1_MOUSE      ----------------------------------------------------------------------
EXD1_XENLA      ----------------------------------------------------------------------
EXD1_DANRE      ----------------------------------------------------------------------
SBCC_STAAW      -------------------KQGILRTLFDSEKFEAIREILKEEVKKEKAQIENRYQQIDEIESFDDDNIK
SBCC_STAAT      -------------------KQGILRTLFDSEKFEAIREILKEEVKKEKAQIENRYQQIDEIESFDDDNIK
SBCC_STAAE      -------------------KQGILRTLFDSEKFEAIREILKEEVKKEKAQIENRYQQIDEIESFDDDNIK
SBCC_STAAC      -------------------KQGILRTLFDSEKFEAIREILKEEVKKEKAQIENRYQQIDEIESFDDDNIK
SBCC_STAA3      -------------------KQGILRTLFDSEKFEAIREILKEEVKKEKAQIENRYQQIDEIESFDDDNIK
EXD1_HUMAN      ----------------------------------------------------------------------
SBCC_STAAS      -------------------KQGILRTLFDSEKFEAIREILKEEVKKEKAQIENRYQQIDEIESFDDDNIK
SBCC_STAA8      -------------------KQGILRTLFDSEKFEAIREILKEEVKKEKAQIENRYQQIDEIESFDDDNIK
SBCC_STAAB      -------------------KQGILRTLFDSEKFEAIREILKEEVKKEKAQIENRYQQIDEIESFDDDKIK
SBCC_STAAR      -------------------KQGILRTLFDSEKFEAIREILKEEVKKENAQIENRYQQIDEIESFDDDKIK


                         .         .         .         +         .         .         .:280
query           NAILIAQWRETIAQEKNIPVRFIFNNKILYTIAHINPKSLNSFEHSELKSLKPWIKKGVVTALNSSKSLD
RND_HAEIN       RLRVLAQWRQNVAIERDLALSYIVKSEHLWKVAKNNPRNTSEMLEMGLTENEVRVRGKEILQLLSQKSIE
RRP6_SCHPO      IYRALHDWRDSVARKEDESVRYVLPNRLLIAIAASKPEAADVFSISQLTPIARMYVEDIVKVVQEAEKLE
RND_ECOLI       CLQLLADWRLRKARERDLAVNFVVREEHLWSVARYMPXXXXXXXXXXXKTLLALVEKAQTLPEDALPQPM
RRP6_YEAST      EVLVLYQWRDLIARRDDESPRFVMPNQLLAALVAYTP---------------------------------
EXOSX_HUMAN     LTALLFAWRDKTARREDESYGYVLPNHMMLKIAEELPK--------------------------------
EXOSX_MOUSE     TAFLLFAWRDKTARREDESYGYVLPNHMMLKIAEELPK--------------------------------
MUT7_AEDAE      ----------------------------------------------------------------------
DPO1_AQUAE      AIVEMAFVREVAKLEINVDVEELTNKYIKYRVDPLSPKQLASLLTKKFKLNLPKTPKGNVSALTSYQDVE
EXD1_MOUSE      ----------------------------------------------------------------------
EXD1_XENLA      ----------------------------------------------------------------------
EXD1_DANRE      ----------------------------------------------------------------------
SBCC_STAAW      GLLEVAT-QQIDKLIENIPLLQARSKEILASVNESKETAIKEFEIIEKKTLENNILKDNINQLNKNK-ID
SBCC_STAAT      GLLEVAT-QQIDKLIENIPLLQARSKEILASVNESKETAIKEFEIIEKKTLENNILKDNINQLNKNK-ID
SBCC_STAAE      GLLEVAT-QQIDKLIENIPLLQARSKEILASVNESKETAIKEFEIIEKKTLENNILKDNINQLNKNK-ID
SBCC_STAAC      GLLEVAT-QQIDKLIENIPLLQARSKEILASVNESKETAIKEFEIIEKKTLENNILKDNINQLNKNK-ID
SBCC_STAA3      GLLEVAT-QQIDKLIENIPLLQARSKEILASVNESKETAIKEFEIIEKKTLENNILKDNINQLNKNK-ID
EXD1_HUMAN      ----------------------------------------------------------------------
SBCC_STAAS      GLLGVAT-QQIDKLIENIPLLQARSKEILASVNESKETAIKEFEIIEKKTLENNILKDNINQLNKNK-ID
SBCC_STAA8      GLLEVAT-QQIDKLIENIPLLQARSKEILASVNESKETAIKEFEIIEKKTLENNILKDNINQLNKNK-ID
SBCC_STAAB      GLLEVATQQIDKVIE-NIPLLQVRSKEILAFVNESKETAIKEYEIIEKKTLENNILKDNINQLNKNK-ID
SBCC_STAAR      GLLEVATQQIDKVIE-NIPLLQARSKEILAFVNESKETAIKDYEIIEKKTLENNILKDNINQLNKNK-ID


                         .         *         .         .         .         .         +:350
query           QVTLEQTSGSKLSTELNDKIIDFFDTYTKQLKFDSSIIASRKDIRSLAYNLNIDTNYKNNKLLNGWRYEI
RND_HAEIN       RIS-EDPRYKKTIRLLQEKV----NSLTPE-GLTPEIVASKRTLEELKYDCSQD---KRPELLIGWR-KP
RRP6_SCHPO      QVDREKSQFKEVEKQ-NQPLAVFSESNTGDYKVDSSVFEISKQNRS------------------------
RND_ECOLI       LNLMDMPGYRKAFKAIKSLITDVSETH----KISAELLASRRQINQL-LNWHWKLKPQNNELISGWRGEL
RRP6_YEAST      ----------------------------------------------------------------------
EXOSX_HUMAN     ----------------------------------------------------------------------
EXOSX_MOUSE     ----------------------------------------------------------------------
MUT7_AEDAE      ----------------------------------------------------------------------
DPO1_AQUAE      PVKL------------------------------------------------------------------
EXD1_MOUSE      ----------------------------------------------------------------------
EXD1_XENLA      ----------------------------------------------------------------------
EXD1_DANRE      ----------------------------------------------------------------------
SBCC_STAAW      FVQLKEIEGIEAKLKLLQDITNLLNYIENREKIETKIANSKKDISKTNNKLNLDCDKRN-----------
SBCC_STAAT      FVQLKEIEGIEAKLKLLQDITNLLNYIENREKIETKIANSKKDISKTNNKLNLDCDKRN-----------
SBCC_STAAE      FVQLKEIEGIEAKLKLLQDITNLLNYIENREKIETKIANSKKDISKTNNKLNLDCDKRN-----------
SBCC_STAAC      FVQLKEIEGIEAKLKLLQDITNLLNYIENREKIETKIANSKKDISKTNNKLNLDCDKRN-----------
SBCC_STAA3      FVQLKEIEGIEAKLKLLQDITNLLNYIENREKIETKIANSKKDISKTNNKLNLDCDKRN-----------
EXD1_HUMAN      ----------------------------------------------------------------------
SBCC_STAAS      FVQLKEIEGIEAKLKLLQDITNLLNYIENREKIETKIANSKKDISKTNNKLNLDCDKRN-----------
SBCC_STAA8      FVQLNEIEGIEAKLKLLQDITNLLNYIENREKIETKIANSKKDISKTNNKLNLDCDKRN-----------
SBCC_STAAB      FVQLKEQQPXXXXXXAKLKLLQ---DITNLLNY----IENREKIETKIANCKKDISKTNNKILN------
SBCC_STAAR      FVQLKEQQPXXXXXXAKLKLLQ---DITNLLNY----IENREKIETKIANSKKDISETNNKILN------


                         .         .         .         .         *         .         .:420
query           VGKKLxxxxxxxxx
RND_HAEIN       IGEKL---------
RRP6_SCHPO      --------------
RND_ECOLI       MAEAL---------
RRP6_YEAST      --------------
EXOSX_HUMAN     --------------
EXOSX_MOUSE     --------------
MUT7_AEDAE      --------------
DPO1_AQUAE      --------------
EXD1_MOUSE      --------------
EXD1_XENLA      --------------
EXD1_DANRE      --------------
SBCC_STAAW      --------------
SBCC_STAAT      --------------
SBCC_STAAE      --------------
SBCC_STAAC      --------------
SBCC_STAA3      --------------
EXD1_HUMAN      --------------
SBCC_STAAS      --------------
SBCC_STAA8      --------------
SBCC_STAAB      --------------
SBCC_STAAR      --------------