[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD31166.1

[Show Plain Result]


## Summary of Sequence Search
    1::240
   13::232     1e-39  40%  237 aa  DEOD_CLOB8 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    9::233     8e-37  37%  233 aa  DEOD_BACSU RecName: Full=Purine nucleoside phosphorylase deoD-type;
    9::231     1e-36  37%  232 aa  DEOD_BACA2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     3e-36  37%  236 aa  DEOD_PSYIN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    8::233     3e-36  34%  235 aa  DEOD_OCEIH RecName: Full=Purine nucleoside phosphorylase deoD-type;
    9::230     7e-36  38%  232 aa  DEOD_BACLD RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     7e-36  36%  236 aa  DEOD2_VIBPA RecName: Full=Purine nucleoside phosphorylase deoD-type
    1::232     2e-34  35%  236 aa  DEOD2_VIBVY RecName: Full=Purine nucleoside phosphorylase deoD-type
    1::232     2e-34  35%  236 aa  DEOD2_VIBVU RecName: Full=Purine nucleoside phosphorylase deoD-type
    8::230     5e-34  35%  234 aa  DEOD_ANOFW RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     5e-34  36%  236 aa  DEOD_ALISL RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     5e-34  34%  236 aa  DEOD2_VIBCH RecName: Full=Purine nucleoside phosphorylase deoD-type
    8::229     6e-34  35%  233 aa  DEOD_THEPX RecName: Full=Purine nucleoside phosphorylase deoD-type;
    8::229     6e-34  35%  233 aa  DEOD_THEP3 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    8::230     6e-34  35%  234 aa  DEOD_BACST RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     6e-34  35%  240 aa  DEOD_ACTPJ RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     8e-34  35%  240 aa  DEOD_ACTPL RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     8e-34  35%  240 aa  DEOD_ACTP7 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     8e-34  35%  240 aa  DEOD_ACTP2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::229     1e-33  35%  235 aa  DEOD_BACCN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-33  35%  241 aa  DEOD1_PHOPR RecName: Full=Purine nucleoside phosphorylase deoD-type
    1::232     1e-33  35%  236 aa  DEOD2_VIBF1 RecName: Full=Purine nucleoside phosphorylase deoD-type
    1::233     2e-33  34%  233 aa  DEOD_PSEHT RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-33  35%  234 aa  DEOD_COLP3 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::229     2e-33  34%  235 aa  DEOD_BACCZ RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-33  36%  241 aa  DEOD1_VIBCH RecName: Full=Purine nucleoside phosphorylase deoD-type
    1::233     2e-33  35%  236 aa  DEOD_TOLAT RecName: Full=Purine nucleoside phosphorylase deoD-type;
    8::229     2e-33  36%  235 aa  DEOD_CLOPS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    8::229     2e-33  36%  235 aa  DEOD_CLOP1 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::229     3e-33  34%  235 aa  DEOD_BACWK RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::229     3e-33  34%  235 aa  DEOD_BACHK RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::229     3e-33  34%  235 aa  DEOD_BACCR RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::229     3e-33  34%  235 aa  DEOD_BACCQ RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::229     3e-33  34%  235 aa  DEOD_BACCE RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::229     3e-33  34%  235 aa  DEOD_BACC7 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::229     3e-33  34%  235 aa  DEOD_BACC4 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::229     3e-33  34%  235 aa  DEOD_BACC3 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::229     3e-33  34%  235 aa  DEOD_BACC2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::229     3e-33  34%  235 aa  DEOD_BACC1 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::229     3e-33  34%  235 aa  DEOD_BACC0 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::229     3e-33  34%  235 aa  DEOD_BACAN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::229     3e-33  34%  235 aa  DEOD_BACAH RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::229     3e-33  34%  235 aa  DEOD_BACAC RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::229     3e-33  34%  235 aa  DEOD_BACAA RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     4e-33  36%  239 aa  DEOD1_VIBPA RecName: Full=Purine nucleoside phosphorylase deoD-type
    1::230     5e-33  34%  236 aa  DEOD_SHEDO RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::228     5e-33  37%  233 aa  DEOD_LISW6 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::228     5e-33  37%  233 aa  DEOD_LISIN RecName: Full=Purine nucleoside phosphorylase deoD-type;
   11::231     5e-33  36%  235 aa  DEOD_EXIS2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::230     5e-33  35%  236 aa  DEOD2_SHEON RecName: Full=Purine nucleoside phosphorylase deoD-type
    4::228     7e-33  37%  233 aa  DEOD_LISMO RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::228     7e-33  37%  233 aa  DEOD_LISMH RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::228     7e-33  37%  233 aa  DEOD_LISMF RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::228     7e-33  37%  233 aa  DEOD_LISMC RecName: Full=Purine nucleoside phosphorylase deoD-type;
    8::229     7e-33  34%  233 aa  DEOD_ALKMQ RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::230     9e-33  35%  236 aa  DEOD_SHESR RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::230     9e-33  35%  236 aa  DEOD_SHESM RecName: Full=Purine nucleoside phosphorylase deoD-type;
    2::232     9e-33  35%  239 aa  DEOD_HAEPS RecName: Full=Purine nucleoside phosphorylase deoD-type;
   11::229     1e-32  34%  235 aa  DEOD_BREBN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-32  35%  239 aa  DEOD1_VIBVY RecName: Full=Purine nucleoside phosphorylase deoD-type
    1::233     1e-32  35%  239 aa  DEOD1_VIBVU RecName: Full=Purine nucleoside phosphorylase deoD-type
    1::230     2e-32  34%  236 aa  DEOD_SHEFN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::230     2e-32  34%  236 aa  DEOD_SHEAM RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::230     2e-32  34%  236 aa  DEOD_HAHCH RecName: Full=Purine nucleoside phosphorylase deoD-type;
   13::232     2e-32  36%  235 aa  DEOD_CLOTE RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     3e-32  33%  239 aa  DEOD_PECCP RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     5e-32  33%  238 aa  DEOD_XENNE RecName: Full=Purine nucleoside phosphorylase deoD-type;
    2::232     5e-32  34%  238 aa  DEOD_MANSM RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::230     8e-32  34%  236 aa  DEOD_SHELP RecName: Full=Purine nucleoside phosphorylase deoD-type;
    2::232     8e-32  35%  238 aa  DEOD_HAEDU RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-31  32%  241 aa  DEOD_YERE8 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::230     1e-31  34%  236 aa  DEOD_SHEB2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    8::229     1e-31  33%  232 aa  DEOD_THETN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::230     1e-31  34%  236 aa  DEOD_SHEB8 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::230     1e-31  34%  236 aa  DEOD_SHEB5 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-31  33%  239 aa  DEOD_ERWT9 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-31  34%  238 aa  DEOD1_VIBF1 RecName: Full=Purine nucleoside phosphorylase deoD-type
    1::233     2e-31  33%  239 aa  DEOD_YERPY RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-31  33%  239 aa  DEOD_YERPS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-31  33%  239 aa  DEOD_YERPP RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-31  33%  239 aa  DEOD_YERPN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-31  33%  239 aa  DEOD_YERPG RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-31  33%  239 aa  DEOD_YERPE RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-31  33%  239 aa  DEOD_YERPB RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-31  33%  239 aa  DEOD_YERPA RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-31  33%  239 aa  DEOD_YERP3 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::230     2e-31  33%  235 aa  DEOD_GEOSW RecName: Full=Purine nucleoside phosphorylase deoD-type;
    2::231     3e-31  33%  234 aa  DEOD3_SHEON RecName: Full=Purine nucleoside phosphorylase
   11::234     9e-31  33%  237 aa  DEOD_EXISA RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     9e-31  32%  239 aa  DEOD_ERWCT RecName: Full=Purine nucleoside phosphorylase deoD-type;
    2::232     1e-30  34%  238 aa  DEOD_HAES2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-30  32%  238 aa  DEOD_PROMH RecName: Full=Purine nucleoside phosphorylase deoD-type;
    2::232     1e-30  33%  238 aa  DEOD_HAES1 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   11::228     1e-30  33%  236 aa  DEOD_GEOKA RecName: Full=Purine nucleoside phosphorylase deoD-type;
    8::229     1e-30  35%  233 aa  DEOD_CLONN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-30  33%  238 aa  DEOD_PHOLL RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     2e-30  33%  236 aa  DEOD2_PHOPR RecName: Full=Purine nucleoside phosphorylase deoD-type
   11::234     2e-30  33%  236 aa  DEOD_GEOTN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::230     2e-30  33%  236 aa  DEOD_CHRVO RecName: Full=Purine nucleoside phosphorylase deoD-type;
    2::231     4e-30  31%  238 aa  DEOD_MYCPN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     6e-30  32%  239 aa  DEOD_SALTY RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     6e-30  32%  239 aa  DEOD_SALHS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::231     6e-30  36%  235 aa  DEOD_LACBA RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     7e-30  32%  239 aa  DEOD_SALAR RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     9e-30  32%  239 aa  DEOD_ENTS8 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     9e-30  32%  236 aa  DEOD_BUCAP RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-29  32%  239 aa  DEOD_SALTI RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-29  32%  239 aa  DEOD_SALSV RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-29  32%  239 aa  DEOD_SALPK RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-29  32%  239 aa  DEOD_SALPB RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-29  32%  239 aa  DEOD_SALPA RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-29  32%  239 aa  DEOD_SALNS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-29  32%  239 aa  DEOD_SALEP RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-29  32%  239 aa  DEOD_SALDC RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-29  32%  239 aa  DEOD_SALCH RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-29  32%  239 aa  DEOD_SALA4 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    2::232     3e-29  32%  238 aa  DEOD_PASMU RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     3e-29  32%  239 aa  DEOD_CITK8 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   11::233     4e-29  40%  236 aa  DEOD_STRZT RecName: Full=Purine nucleoside phosphorylase deoD-type;
   11::233     4e-29  40%  236 aa  DEOD_STRPS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    2::232     5e-29  33%  238 aa  DEOD_HAEIN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    2::232     5e-29  33%  238 aa  DEOD_HAEI8 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   11::233     6e-29  40%  236 aa  DEOD_STRZJ RecName: Full=Purine nucleoside phosphorylase deoD-type;
   11::233     6e-29  40%  236 aa  DEOD_STRPI RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     6e-29  32%  239 aa  DEOD_SHISS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     6e-29  32%  239 aa  DEOD_SHIBS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     6e-29  32%  239 aa  DEOD_SHIB3 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     6e-29  32%  239 aa  DEOD_ESCF3 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::234     6e-29  31%  240 aa  DEOD_ENT38 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     6e-29  32%  239 aa  DEOD_ECOSM RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     6e-29  32%  239 aa  DEOD_ECOSE RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     6e-29  32%  239 aa  DEOD_ECOLU RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     6e-29  32%  239 aa  DEOD_ECOLI RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     6e-29  32%  239 aa  DEOD_ECOHS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     6e-29  32%  239 aa  DEOD_ECODH RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     6e-29  32%  239 aa  DEOD_ECOBW RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     6e-29  32%  239 aa  DEOD_ECO8A RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     6e-29  32%  239 aa  DEOD_ECO5E RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     6e-29  32%  239 aa  DEOD_ECO57 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     6e-29  32%  239 aa  DEOD_ECO55 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     6e-29  32%  239 aa  DEOD_ECO45 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     6e-29  32%  239 aa  DEOD_ECO24 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   11::234     8e-29  34%  237 aa  DEOD_STRSY RecName: Full=Purine nucleoside phosphorylase deoD-type;
   11::234     8e-29  34%  237 aa  DEOD_STRS2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     8e-29  32%  239 aa  DEOD_SHIFL RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     8e-29  32%  239 aa  DEOD_SHIF8 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     8e-29  32%  239 aa  DEOD_SHIDS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     8e-29  32%  239 aa  DEOD_SALG2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     8e-29  32%  239 aa  DEOD_ECOLC RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     8e-29  32%  239 aa  DEOD_ECOL6 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     8e-29  32%  239 aa  DEOD_ECOL5 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     8e-29  32%  239 aa  DEOD_ECO81 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     8e-29  32%  239 aa  DEOD_ECO7I RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     8e-29  32%  239 aa  DEOD_ECO27 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   11::233     1e-28  40%  237 aa  DEOD_STRGC RecName: Full=Purine nucleoside phosphorylase deoD-type;
    2::232     1e-28  33%  238 aa  DEOD_HAEIG RecName: Full=Purine nucleoside phosphorylase deoD-type;
    2::229     1e-28  32%  237 aa  DEOD_DICNV RecName: Full=Purine nucleoside phosphorylase deoD-type;
   11::233     2e-28  40%  236 aa  DEOD_STRZP RecName: Full=Purine nucleoside phosphorylase deoD-type;
   11::233     2e-28  40%  236 aa  DEOD_STRPJ RecName: Full=Purine nucleoside phosphorylase deoD-type;
   11::233     2e-28  40%  236 aa  DEOD_STRP7 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   11::233     2e-28  40%  236 aa  DEOD_STRP4 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   11::233     2e-28  40%  236 aa  DEOD_STRP2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    9::233     2e-28  35%  238 aa  DEOD_LACCB RecName: Full=Purine nucleoside phosphorylase deoD-type;
    9::233     2e-28  35%  238 aa  DEOD_LACC3 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-28  31%  239 aa  DEOD_KLEP3 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    2::232     2e-28  33%  238 aa  DEOD_HAEIE RecName: Full=Purine nucleoside phosphorylase deoD-type;
    8::233     7e-28  39%  236 aa  DEOD_STRTD RecName: Full=Purine nucleoside phosphorylase deoD-type;
    8::236     7e-28  37%  237 aa  DEOD_STRPF RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::230     9e-28  32%  239 aa  DEOD_MYXXD RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::231     1e-27  33%  234 aa  DEOD_LACLA RecName: Full=Purine nucleoside phosphorylase deoD-type;
    8::236     2e-27  38%  237 aa  DEOD_STRPC RecName: Full=Purine nucleoside phosphorylase deoD-type;
    8::236     2e-27  38%  237 aa  DEOD_STRPB RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::231     2e-27  32%  234 aa  DEOD_LACLS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::231     2e-27  32%  234 aa  DEOD_LACLM RecName: Full=Purine nucleoside phosphorylase deoD-type;
    8::236     2e-27  33%  237 aa  DEOD_STRPG RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::229     4e-27  38%  234 aa  DEOD_LACSS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     4e-27  31%  237 aa  DEOD_EDWI9 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   11::231     6e-27  35%  236 aa  DEOD_LACRJ RecName: Full=Purine nucleoside phosphorylase deoD-type;
   11::231     6e-27  35%  236 aa  DEOD_LACRD RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::232     1e-26  32%  236 aa  DEOD1_SHEON RecName: Full=Purine nucleoside phosphorylase deoD-type
    2::231     2e-26  36%  238 aa  DEOD_MYCGE RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::230     3e-26  31%  239 aa  DEOD3_VIBF1 RecName: Full=Purine nucleoside phosphorylase
   10::231     8e-26  31%  233 aa  DEOD_TREPA RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-25  31%  234 aa  DEOD_BUCAT RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-25  31%  234 aa  DEOD_BUCAI RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     1e-25  31%  234 aa  DEOD_BUCA5 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   11::229     1e-25  31%  234 aa  DEOD_JANSC RecName: Full=Purine nucleoside phosphorylase deoD-type;
    2::232     2e-25  31%  238 aa  DEOD_ACTSZ RecName: Full=Purine nucleoside phosphorylase deoD-type;
    8::236     7e-25  40%  237 aa  DEOD_STRU0 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::233     2e-24  32%  239 aa  DEOD_KLEPN RecName: Full=Purine nucleoside phosphorylase deoD-type;
    2::229     8e-24  29%  233 aa  DEOD_HELAH RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::213     1e-23  40%  216 aa  DEOD_STRTR RecName: Full=Purine nucleoside phosphorylase deoD-type;
    8::229     2e-23  31%  234 aa  DEOD_ROSDO RecName: Full=Purine nucleoside phosphorylase deoD-type;
    2::229     7e-23  28%  233 aa  DEOD_HELPJ RecName: Full=Purine nucleoside phosphorylase deoD-type;
    2::229     1e-22  27%  233 aa  DEOD_HELPY RecName: Full=Purine nucleoside phosphorylase deoD-type;
    2::229     2e-22  27%  233 aa  DEOD_HELP2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    2::229     3e-22  27%  234 aa  DEOD_HELPS RecName: Full=Purine nucleoside phosphorylase deoD-type;
    2::229     3e-22  31%  233 aa  DEOD_HELPG RecName: Full=Purine nucleoside phosphorylase deoD-type;
    2::229     4e-22  27%  233 aa  DEOD_HELPH RecName: Full=Purine nucleoside phosphorylase deoD-type;
   11::229     6e-22  32%  234 aa  DEOD_DINSH RecName: Full=Purine nucleoside phosphorylase deoD-type;
    3::230     2e-21  28%  238 aa  DEOD_BUCBP RecName: Full=Purine nucleoside phosphorylase deoD-type;
    9::234     6e-08  23%  236 aa  MTAP_SULSO RecName: Full=S-methyl-5'-thioadenosine phosphorylase;  
    1::240

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxLPTPHIETLRKEEFAKTVIMPGDPLRAKYIADNYLENVVRVNAVRNMFGYTGTYXXXXXXXXXXXXXX
DEOD_CLOB8      ----------------AESVLLPGDPLRAKFIAENFLEDVVCYNEVRGMYGFTGTYKGKKISVQGTGMGI
DEOD_BACSU      ------------KGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGV
DEOD_BACA2      ------------KGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYNGKKVSVQGTGMGV
DEOD_PSYIN      --MTTPHINAV-DGAFAETVLMPGDPLRAKYIAENFLKDAVQVTDVRNMLGFTGTYKGKRVSVMGSGMGI
DEOD_OCEIH      -----------KQGEIADKILLPGDPLRAKYIAETFLEEPKLYNEVRGMYGYTGTYKGERVSVQGTGMGV
DEOD_BACLD      ------------KGQIAETVLLPGDPLRAKYIADTYLENVECYNEVRGMYGFTGTYKGKRVSVQGTGMGV
DEOD2_VIBPA     --MATPHINA-QPGDFAETVLMPGDPLRAKYIAETFLEDVKQVCDVRNMFGFTGTYKGKKVSVMGHGMGI
DEOD2_VIBVY     --MATPHINA-QPGDFAETVLMPGDPLRAKYIAETFLEDVKQVCDVRNMFGFTGTYKGKKVSVMGHGMGI
DEOD2_VIBVU     --MATPHINA-QPGDFAETVLMPGDPLRAKYIAETFLEDVKQVCDVRNMFGFTGTYKGKKVSVMGHGMGI
DEOD_ANOFW      -----------KEHEIADKILLPGDPLRAKYIAETFLEGATCYNQVRGMLGFTGTYKGHRISVQGTGMGV
DEOD_ALISL      --MATPHINA-QVGDFAETVLMPGDPLRAKFIAENFLEDVTQVCDVRNMFGYTGTYKGKKVSVMGHGMGI
DEOD2_VIBCH     --MATPHINA-QPGDFAETVLMPGDPLRAKYIAETFLEDVKQVCDVRSMFGFTGTYKGKKVSVMGHGMGI
DEOD_THEPX      -----------KENEIAQTVLLPGDPLRAKYIAENFLEDAKCYNEVRGMYGFTGYYKGKRVSVQGTGMGV
DEOD_THEP3      -----------KENEIAQTVLLPGDPLRAKYIAENFLEDAKCYNEVRGMYGFTGYYKGKRVSVQGTGMGV
DEOD_BACST      -----------KEHEIADKILLPGDPLRAKYIAETFLEGATCYNQVRGMLGFTGTYKGHRISVQGTGMGV
DEOD_ACTPJ      --MATPHINA-PEGAFADVVLMPGDPLRAKYIAETFLEDTVQVTDVRNMFGYTGTYKGRRISVMGHGMGI
DEOD_ACTPL      --MATPHINA-PEGAFADVVLMPGDPLRAKYIAETFLEDAVQVTDVRNMFGYTGTYKGRRISVMGHGMGI
DEOD_ACTP7      --MATPHINA-PEGAFADVVLMPGDPLRAKYIAETFLEDAVQVTDVRNMFGYTGTYKGRRISVMGHGMGI
DEOD_ACTP2      --MATPHINA-PEGAFADVVLMPGDPLRAKYIAETFLEDAVQVTDVRNMFGYTGTYKGRRISVMGHGMGI
DEOD_BACCN      ------HIEA-KQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGV
DEOD1_PHOPR     --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLQDVKEVCNVRSMFGYTGTYKGRKISVMGHGMGI
DEOD2_VIBF1     --MATPHINA-QAGDFAETVLMPGDPLRAKFIAENFLEDVKQVCDVRNMFGYTGTYKGKKVSVMGHGMGI
DEOD_PSEHT      --MSTPHINA-NVGDFAETVLMPGDPLRAKYIAENFLDDAKQVTSVRNMLGFTGTYKGKPVSIMGSGMGI
DEOD_COLP3      --MPTPHIEA-QDGEFAETVLMPGDPLRAKFIADNFLDDAKCITQVRNMLGYTGTYKGKRVSVMGSGMGV
DEOD_BACCZ      ------HIEA-KQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGV
DEOD1_VIBCH     --MATPHINA-QMGDFADVVLMPGDPLRAKYIAENFLDNAVQVCDVRNMFGYTGTYKGRKISVMGHGMGI
DEOD_TOLAT      --MATPHINA-KDGAFAETVLMPGDPLRAKYIAETYLENAELVTDVRNMFGYTGFYKGQRVSVMGHGMGI
DEOD_CLOPS      -----------KEGQIAETILLPGDPLRAKFIAETFLENPVCYNEVRGMLGYTGTYKGKRISVQGTGMGV
DEOD_CLOP1      -----------KEGQIAETILLPGDPLRAKFIAETFLENPVCYNEVRGMLGYTGTYKGKKISVQGTGMGV
DEOD_BACWK      ------HIEA-KQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGV
DEOD_BACHK      ------HIEA-KQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGV
DEOD_BACCR      ------HIEA-KQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGV
DEOD_BACCQ      ------HIEA-KQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGV
DEOD_BACCE      ------HIEA-KQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGV
DEOD_BACC7      ------HIEA-KQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGV
DEOD_BACC4      ------HIEA-KQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGV
DEOD_BACC3      ------HIEA-KQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGV
DEOD_BACC2      ------HIEA-KQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGV
DEOD_BACC1      ------HIEA-KQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGV
DEOD_BACC0      ------HIEA-KQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGV
DEOD_BACAN      ------HIEA-KQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGV
DEOD_BACAH      ------HIEA-KQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGV
DEOD_BACAC      ------HIEA-KQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGV
DEOD_BACAA      ------HIEA-KQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGV
DEOD1_VIBPA     --MATPHINA-EMGAFADVVLMPGDPLRAKYIAETFLEDVVQVCDVRNMFGYTGTYKGRKISVMGHGMGI
DEOD_SHEDO      --MATPHINAV-PGAFAETMLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGI
DEOD_LISW6      ------HIEA-KQGEIAETILLPGDPLRAKYIAETFLEDVVLFNQVRGMLGFTGTYKGEKVSVMGTGMGI
DEOD_LISIN      ------HIEA-KQGEIAETILLPGDPLRAKYIAETFLEDVVLFNQVRGMLGFTGTYKGEKVSVMGTGMGI
DEOD_EXIS2      --------------QIAETVLLPGDPLRAKYIADTFLEDVVLYNEVRGMYGFTGTYKGKKVSVQGTGMGV
DEOD2_SHEON     --MATPHINAV-EGAFAETVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGI
DEOD_LISMO      ------HIEA-KQGEIAETILLPGDPLRAKYIAETFLEDVVLFNQVRGMLGFTGTYKGEKVSVMGTGMGI
DEOD_LISMH      ------HIEA-KQGEIAETILLPGDPLRAKYIAETFLEDVVLFNQVRGMLGFTGTYKGEKVSVMGTGMGI
DEOD_LISMF      ------HIEA-KQGEIAETILLPGDPLRAKYIAETFLEDVVLFNQVRGMLGFTGTYKGEKVSVMGTGMGI
DEOD_LISMC      ------HIEA-KQGEIAETILLPGDPLRAKYIAETFLEDVVLFNQVRGMLGFTGTYKGEKVSVMGTGMGI
DEOD_ALKMQ      -----------KKGEIAETILLPGDPLRAKFIAENFLENIECYNEVRGMYGFTGSYKGKRISVQGTGMGM
DEOD_SHESR      --MATPHINAV-EGAFAETVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGI
DEOD_SHESM      --MATPHINAV-EGAFAETVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGI
DEOD_HAEPS      ----TPHINA-PAGAFADVVLMPGDPLRAKYIAETFLENAEQVTNVRNMFGYTGTYKGRRISVMGHGMGI
DEOD_BREBN      --------------QIAETILLPGDPLRAKYIAETFLEGAECYNNVRGMLGFTGTYKGKRVSVQGTGMGV
DEOD1_VIBVY     --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDVVQVCDVRNMYGFTGTYKGRKVSVMGHGMGI
DEOD1_VIBVU     --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDVVQVCDVRNMYGFTGTYKGRKVSVMGHGMGI
DEOD_SHEFN      --MATPHINAV-EGAFAETVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGI
DEOD_SHEAM      --MATPHINAV-EGAFAETVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGI
DEOD_HAHCH      --MATPHIAA-NPGDFADTVLMPGDPLRAKHIAETYLANPVLVNDVRGMLGYTGEYRGRMLSVMGSGMGV
DEOD_CLOTE      ----------------AESILLPGDPLRAKFIADTFLEDVVCYNEVRGMYGFTGTYKGKRVSVQGTGMGI
DEOD_PECCP      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLENAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_XENNE      --MATPHINA-EMGDFADVVLMPGDPLRAQYIAETFLEDARQVNNVRGMLGFTGTYKGRRISVMGHGMGI
DEOD_MANSM      ----TPHINA-PEGAFADVVLMPGDPLRAKYIAETFLENAKEVTNVRNMLGYTGTYKGRPVSVMGHGMGI
DEOD_SHELP      --MATPHINAV-DGAFADTVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGVRISVMGSGMGI
DEOD_HAEDU      ----TPHINA-PAGAFADVVLMPGDPLRAKYIAETFLENAEQVTNVRNMFGYTGTYKGRRISIMGHGMGI
DEOD_YERE8      --MATPHINA-EMGDFADVVLMPGDPLRAKHIAETFLKDVKQVNDVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_SHEB2      --MATPHINAV-EGAFAETMLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGI
DEOD_THETN      -----------KEGDIAETVLLPGDPLRAKYIAENLLEDAKCYNEVRGMYGFTGYYKGKRVSVQGTGMGV
DEOD_SHEB8      --MATPHINAV-EGAFAETMLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGI
DEOD_SHEB5      --MATPHINAV-EGAFAETMLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISVMGSGMGI
DEOD_ERWT9      --MATPHINA-EMGDFADVVLMPGDPLRAKHIADTFLQDAVEVNNVRGMLGYTGTYKGRKISVMGHGMGI
DEOD1_VIBF1     --MATPHINA-EMGDFADVVLMPGDPIRAKYIAETFLDDVVQVCDVRNMYGFTGTYKGRKISVMGHGMGI
DEOD_YERPY      --MATPHINA-EMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_YERPS      --MATPHINA-EMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_YERPP      --MATPHINA-EMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_YERPN      --MATPHINA-EMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_YERPG      --MATPHINA-EMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_YERPE      --MATPHINA-EMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_YERPB      --MATPHINA-EMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_YERPA      --MATPHINA-EMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_YERP3      --MATPHINA-EMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_GEOSW      ------HIEA-KQGEIADKILLPGDPLRAQYIAETFLEGATCYNRVRGMLGFTGTYKGHRISVQGTGMGV
DEOD3_SHEON     ----TAHINA-QPTDFAETVIMPGDPLRAKYIAETYLTDAVEVTNVRNMLGYTGYYQGQRISVMGHGMGI
DEOD_EXISA      --------------QIAETVLLPGDPLRAKYIAETFLEDVELYNEVRGMYGFTGTYKGKRISVQGTGMGV
DEOD_ERWCT      --MATPHINA-EMGDFADVVLMPGDPLRAKFIAETFLDDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_HAES2      ----TPHINA-PAGAFADVVLMPGDPLRAKYIAETFLENAQEVTNVRNMLGYTGTYKGRKISVMGHGMGI
DEOD_PROMH      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLQDVRQVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_HAES1      ----TPHINA-PAGAFADVVLMPGDPLRAKYIAETFLENAQEVTNIRNMLGYTGTYKGRKISVMGHGMGI
DEOD_GEOKA      --------------EIAERILLPGDPLRAKYIAETFLEGAVCYNEVRGMLGFTGTYKGERISVQGTGMGV
DEOD_CLONN      -----------KQNEIASTVLLPGDPLRAKFIAENFLEDVICYNDVRGMXXXXXXXXXXRVSVQGTGMGI
DEOD_PHOLL      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLENVRQVNDVRGMLGFTGTYKGRPISVMGHGMGI
DEOD2_PHOPR     --MATPHINA-ELGDFAETVLMPGDPLRAKFIAENFLEDVKQVCDVRSMLGFTGTYKGKRVSVMGHGMGI
DEOD_GEOTN      --------------EIAEHILLPGDPLRAKYIAETFLEGAVCYNEVRGMLGFTGTYKGHRISVQGTGMGV
DEOD_CHRVO      --MATPHINA-KDGAFAETVLMPGDPLRAQLIAETFLEGAELVTNVRNVFGYTGTYKGKRLSVMAHGMGI
DEOD_MYCPN      ----TPHINA-KKDDIAKVVLMPGDPLRAKWIAEQFMEKPRLVNEVRGMLAFTGQYKGKTITIMGHGMGI
DEOD_SALTY      --MATPHINA-EMGDFADVVLMPGDPLRAKHIAETFLENVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_SALHS      --MATPHINA-EMGDFADVVLMPGDPLRAKHIAETFLENVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_LACBA      ------HLEA-KMGDIADTVLLPGDPLRAKYIAETFLENPVCYNTVRNAFGYTGTYKGKRISVQGTGMGI
DEOD_SALAR      --MATPHINA-EMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_ENTS8      --MATPHINA-EMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_BUCAP      --MPTLHIKS-EKNAFSNIVLMPGDPVRAKYIAENYLANPVQINDTRLMLAYTGYYKNKKISVMSHGMGI
DEOD_SALTI      --MATPHINA-EMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_SALSV      --MATPHINA-EMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_SALPK      --MATPHINA-EMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_SALPB      --MATPHINA-EMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_SALPA      --MATPHINA-EMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_SALNS      --MATPHINA-EMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_SALEP      --MATPHINA-EMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_SALDC      --MATPHINA-EMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_SALCH      --MATPHINA-EMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_SALA4      --MATPHINA-EMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_PASMU      ----TPHINA-PAGAFADVVLMPGDPLRAKYIAETFLQDVKEITNVRNMLGFTGTYKGRKISVMGHGMGI
DEOD_CITK8      --MATPHINA-EMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_STRZT      --------------EIADKILLPGDPLRAKFIAENFLDDAVCFNEVRNMFGYTGTYKGHCVSVMGTGMGM
DEOD_STRPS      --------------EIADKILLPGDPLRAKFIAENFLDDAVCFNEVRNMFGYTGTYKGHCVSVMGTGMGM
DEOD_HAEIN      ----TPHINA-PEGAFADVVLMPGDPLRAKYIAETFLQDVVEVTNVRNMLGFTGTYKGRKISIMGHGMGI
DEOD_HAEI8      ----TPHINA-PEGAFADVVLMPGDPLRAKYIAETFLQDVVEVTNVRNMLGFTGTYKGRKISIMGHGMGI
DEOD_STRZJ      --------------EIADKILLPGDPLRAKFIAENFLDDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGM
DEOD_STRPI      --------------EIADKILLPGDPLRAKFIAENFLDDAVCFNEVRNMFGYTGTYKGHCVSVMGTGMGM
DEOD_SHISS      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_SHIBS      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_SHIB3      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_ESCF3      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_ENT38      --MATPHINA-EMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_ECOSM      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_ECOSE      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_ECOLU      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_ECOLI      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_ECOHS      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_ECODH      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_ECOBW      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_ECO8A      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_ECO5E      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_ECO57      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_ECO55      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_ECO45      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_ECO24      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_STRSY      --------------EIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGI
DEOD_STRS2      --------------EIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGI
DEOD_SHIFL      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_SHIF8      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_SHIDS      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_SALG2      --MATPHINA-EMGDFADVVLMPGDPLRAKHIAETSLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_ECOLC      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_ECOL6      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_ECOL5      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_ECO81      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_ECO7I      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_ECO27      --MATPHINA-EMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_STRGC      --------------EIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGM
DEOD_HAEIG      ----TPHINA-PEGAFADVVLMPGDPLRAKYIAETFLQDVVEVTNVRNMLGFTGTYKGRKISIMGHGMGI
DEOD_DICNV      ----TPHINA-PAGAFAETVLFCGDPLRAQFIAHHFLKNAQEITNVRAMLGFTGEYQQHKLSVMGHGMGI
DEOD_STRZP      --------------EIADKILLPGDPLRAKFIAENFLGDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGM
DEOD_STRPJ      --------------EIADKILLPGDPLRAKFIAENFLGDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGM
DEOD_STRP7      --------------EIADKILLPGDPLRAKFIAENFLGDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGM
DEOD_STRP4      --------------EIADKILLPGDPLRAKFIAENFLGDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGM
DEOD_STRP2      --------------EIADKILLPGDPLRAKFIAENFLGDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGM
DEOD_LACCB      ------------KGAIADVVLLPGDPLRAQYIAENFLDNAQRYNTVRNAFGFTGTFEGRRVSVQATGMGI
DEOD_LACC3      ------------KGAIADVVLLPGDPLRAQYIAENFLDNAQRYNTVRNAFGFTGTFEGRRVSVQATGMGI
DEOD_KLEP3      --MATPHINA-EMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_HAEIE      ----TPHINA-PEGAFADVVLMPGDPLRAKYIAETFLQDVVEVTNVRNMLGFTGTYKGRKISIMGHGMGI
DEOD_STRTD      -----------KQGDIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGERVSVMGTGMGM
DEOD_STRPF      -----------KKGDIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGM
DEOD_MYXXD      --MATPHISAA-PGDFADVVLMPGDPLRARYISDRFLEGAREVTSVRNMLGFTGTFRGRRVSVMGHGMGV
DEOD_LACLA      --MPTPHIEA-QKGEIADKILLPGDPLRAKFIAENFLEDAVQFNQVRGMLGFTGTYKGHRVSVMGTGMGI
DEOD_STRPC      -----------KKGDIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGM
DEOD_STRPB      -----------KKGDIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGM
DEOD_LACLS      --MPTPHIEA-QKGEIADKILLPGDPLRAKFIAENFLEDAVQFNQVRGMLGFTGTYKGHRVSVMGTGMGI
DEOD_LACLM      --MPTPHIEA-QKGEIADKILLPGDPLRAKFIAENFLEDAVQFNQVRGMLGFTGTYKGHRVSVMGTGMGI
DEOD_STRPG      -----------KKGDIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGM
DEOD_LACSS      ------HIEA-QQGDIAETVLLPGDPLRAKYIAETFLTDVHRYNTIRNAFGYTGYYKGQAISVQASGMGI
DEOD_EDWI9      --MATPHINA-EMGDFADVVLMPGDPLRAKHIAETFLQDVRQVNNVRGMLGFTGTYKGRKISVMGHGMGI
DEOD_LACRJ      --------------DYADTVLLPGDPLRAKYIAENFLENVKQVNSVRNAFGYTGEYKGHRISVQGSGMGI
DEOD_LACRD      --------------DYADTVLLPGDPLRAKYIAENFLENVKQVNSVRNAFGYTGEYKGHRISVQGSGMGI
DEOD1_SHEON     --MSTPHINA-NPGDFAKTIIMSGDPLRAKLIAETYLEDVKEVTNVRGILGFTGKYKSKDISIMGHGMGA
DEOD_MYCGE      ----TPHISA-KKDDISKVVLMPGDPLRAKWIAEQFLDQAKLVNEVRGMFAYTGQYKSKTVTVMGHGMGI
DEOD3_VIBF1     --MSTPHINA-PLDAFADTILMPGDPLRAKLIAETYLENVVQVTDVRGMLGFTGEFKGRKISVMGHGMGA
DEOD_TREPA      -------------EDIAPRVLLPGDPLRARFVAERFFHNAYCYNEVRGMLGFTGTYKGVRVSVQGTGMGL
DEOD_BUCAT      --MSTPHINS-KKDDFSDIVLMPGDPVRAKYIAEKYLSNFVQVNDTRLMLAYTGFYKNRKISIMSHGIGI
DEOD_BUCAI      --MSTPHINS-KKDDFSDIVLMPGDPVRAKYIAEKYLSNFVQVNDTRLMLAYTGFYKNRKISIMSHGIGI
DEOD_BUCA5      --MSTPHINS-KKDDFSDIVLMPGDPVRAKYIAEKYLSNFVQVNNTRLMLAYTGFYKNRKISIMSHGIGI
DEOD_JANSC      --------------DIAETVLMPGDPLRAKWAAERFLENPVCVNEVRGMLGFTGMWRGNRVTIHGSGMGM
DEOD_ACTSZ      ----TPHINA-PAGAFADVVLMPGDPLRAKYIAETFLDQPELVTDVRNMLGYTGSYKGRRISVMGHGMGI
DEOD_STRU0      -----------RVGDIADKILLPGDPLRAKFIAENFLEDAVCFNEIRGMLGYTGTYKGHRVSVMGTGMGM
DEOD_KLEPN      --MATPHINA-EMGDFADVVLMPGDPLRANSIAETFLEDAREVNNVRGMLGFTGTYGRRKISVMGHGMGI
DEOD_HELAH      ----TPHINA-KIGDFHPQCILCGDPLRVSYIAKNFLQDAREITNVRNMLGFSGKYKGKEISLMGHGMGI
DEOD_STRTR      ------------------------DPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGERISVMGTGMGM
DEOD_ROSDO      -----------RPDQIAETVLMPGDPYRARWAAQTFLDGAELVNEVRGMLGFTGTYKGNRVTIQGSGMGM
DEOD_HELPJ      ----TPHINA-KIGDFYPQCLLCGDPLRVSYIAKNFLQDAKEITNVRNMLGFSGKYKGKGISLMGHGMGI
DEOD_HELPY      ----TPHINA-KIGDFYPQCLLCGDPLRVSYIAKKFLQDAKEITNVRNMLGFSGKYKGRGISLMGHGMGI
DEOD_HELP2      ----TPHINA-KIGDFYPQCLLCGDPLRVSYIAKKFLQDAKEITNVRNMLGFSGKYKGKGISLMGHGMGI
DEOD_HELPS      ----TPHINA-KIGDFYPQCLLCGDPLRVSYIAKKFLQDAKEITNVRNMLGFSGKYKGKGISLMGHGMGI
DEOD_HELPG      ----TPHINA-KIGDFYPQCLLCGDPLRVSYIAKKFLQDAKEITNVRNMLGFSGKYKGKGISLMGHGMGI
DEOD_HELPH      ----TPHINA-KIGDFYPQCLLCGDPLRVSYIAKKFLQDAKEITNVRNMLGFSGKYKGKGISLMGHGMGI
DEOD_DINSH      --------------DIAETVLMPGDPLRAKWAAETFLDDPVCVNEVRGMLGFTGTWCGHRVTIHGSGMGM
DEOD_BUCBP      ----TPHINA-KKGDFSDCVLMPGDPLRARYIAKNYLKNAIEVTNIRSMLGYTGRYKGHRISVMSHGIGI
MTAP_SULSO      -----------KKGEVAERVLVVGDPGRARLLS-TLLQNPKLTNENRGFLVYTGKYNGETVSIATHGIGG


                         .         .         *         .         .         .         .:140
query           XXXXIYAYELFKYYDVDNIIRVGSAGSYKAEFKVYDVVLIEESYCESNFIEIVTGSKTSDVRSSEELNKE
DEOD_CLOB8      PSISIYANELIQSYGVKNLIRVGTCGGYSEKVKVRDLIIAMSASTDSNLNLVRFQGRTFAPTASFELLKP
DEOD_BACSU      PSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKN
DEOD_BACA2      PSISIYVNELIQSYDVQNLIRVGSCGAIRNDVKVRDVILAMTSSTDSQMNRVAFGSVDYAPCADFELLNK
DEOD_PSYIN      PSCSIYATELFREYGVQNIIRVGSCGAVSRDIKLRDVIIGMGASTDSKANRIRFKGHDFAAIASYELLEK
DEOD_OCEIH      PSISIYVNELIQSYDVKKLIRVGTCGAIQKDVNVRDVILAQGATTDSQMNRLIFNGIDYAPIADFELLKN
DEOD_BACLD      PSISIYVNELIRSYDVKNLIRVGSCGAIRKDVNVRDVILAMTSSTDSQINRVAFGSIDFAPCADFGLLKA
DEOD2_VIBPA     PSCCIYVHELIAEYGVKNVIRVGSCGAVRDDVNLMDVVIGMGASTDSKVNRIRFNNHDFAAIADFSLLEE
DEOD2_VIBVY     PSACIYVHELIAEYGVKNVIRVGSCGAVRDDVNLMDVVIGMGASTDSKVNRIRFNDHDFAALADYGLLEE
DEOD2_VIBVU     PSACIYVHELIAEYGVKNVIRVGSCGAVRDDVNLMDVVIGMGASTDSKVNRIRFNDHDFAALADYGLLEE
DEOD_ANOFW      PSISIYVTELMQSYNVQTLIRVGTCGAIQKDVKVRDVILAMTSSTDSQMNRMTFGGIDYAPTANFDLLKT
DEOD_ALISL      PSCCIYVHELIAEFGVKNIIRVGSCGAVHDDVKLMDVVIGMGASTDSKVNRIRFNNHDFAAIADFGLLET
DEOD2_VIBCH     PSCSIYVHELIAEYGVKNIIRIGSCGAVRDDVKLMDVVIGMGASTDSKVNRIRFSGHDFAAIADYDLLET
DEOD_THEPX      PSLSIYVNELINSYNVKNLIRIGTCGSLQPDIKLRDIVIAMSSSTDSAINKIRFNGMDYAPTASFKLLKK
DEOD_THEP3      PSLSIYVNELINSYNVKNLIRIGTCGSLQPDIKLRDIVIAMSSSTDSAINKIRFNGMDYAPTASFKLLKK
DEOD_BACST      PSISIYITELMQSYNVQTLIRVGTCGAIQKDVKVRDVILAMTSSTDSQMNRMTFGGIDYAPTANFDLLKT
DEOD_ACTPJ      PSCSIYAKELITEYGVKKIIRVGSCGAVRQDVKVRDVIIGSGACTDSKVNRIRFRNNDFAAISDFDMTLA
DEOD_ACTPL      PSCSIYAKELITEYGVKKIIRVGSCGAVRQDVKVRDVIIGSGACTDSKVNRIRFRDNDFAAISDFDMTLA
DEOD_ACTP7      PSCSIYAKELITEYGVKKIIRVGSCGAVRQDVKVRDVIIGSGACTDSKVNRIRFRDNDFAAISDFDMTLA
DEOD_ACTP2      PSCSIYAKELITEYGVKKIIRVGSCGAVRQDVKVRDVIIGSGACTDSKVNRIRFRDNDFAAISDFDMTLA
DEOD_BACCN      PSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNINRLTFPGFDFAPAANFDLLKK
DEOD1_PHOPR     PSCSIYATELIKDFGVKKIIRVGSCGAVRDDVKLRDVVIGMGASTDSKVNRIRFGGHDFAAIADFGMVQN
DEOD2_VIBF1     PSCCIYVHELIAEYGVKNVIRVGSCGAVHDDVKLMDVVIGMGASTDSKVNRIRFNNHDFAAIADFGLLET
DEOD_PSEHT      PSMSLYARELIVTFGVKNLIRIGTCGGIGSDVKIRDVIFAQGACTDSNVNRARVRGTDFAAIADFDLLLN
DEOD_COLP3      PSISIYATELYKDYGVEKIIRIGSCGAXXXXXXXXXXXXGMAASTDSNVNRQRFHNVDFAACADFSLLKS
DEOD_BACCZ      PSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKK
DEOD1_VIBCH     PSCSIYVTELIKDYGVKKIIRVGSCGAVNEGIKVRDVVIGMGACTDSKVNRIRFKDHDFAAIADYKMVXX
DEOD_TOLAT      PSCSIYTKELITEYGVKNIIRIGSCGAVRPDVKVRDVIIGMGACTDSKVNRMRFKDHDFAAIADFGLLRK
DEOD_CLOPS      PSISIYVNELIRDYGVKNLIRVGTAGGMQEDIKVRDLVLAMSSHTDSAINKVRFNGLDFAPTASFKLLKA
DEOD_CLOP1      PSISIYVNELIRDYGVKNLIRVGTAGGMQEDIKVRDLVLAMSSHTDSAINKVRFNGLDFAPTASFKLLKA
DEOD_BACWK      PSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKK
DEOD_BACHK      PSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKK
DEOD_BACCR      PSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKK
DEOD_BACCQ      PSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKK
DEOD_BACCE      PSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKK
DEOD_BACC7      PSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKK
DEOD_BACC4      PSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPTANFDLLKK
DEOD_BACC3      PSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKK
DEOD_BACC2      PSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKK
DEOD_BACC1      PSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKK
DEOD_BACC0      PSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKK
DEOD_BACAN      PSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKK
DEOD_BACAH      PSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKK
DEOD_BACAC      PSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKK
DEOD_BACAA      PSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKK
DEOD1_VIBPA     PSCSIYATELIKDFGVKKIIRVGSCGAVNEDIKVRDVVIGMGACTDSKVNRIRFKGHDFAAIADYKMVRA
DEOD_SHEDO      PSASIYAYELIKEYGVKNLIRVGTCGAISTDVKVRDVIIAMGACTDSKVNRLRFKDHDFAAIADYSLLSA
DEOD_LISW6      PSISIYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVVIAQAASTDSQIRNTFAGVDFAPVADFSLLKKA
DEOD_LISIN      PSISIYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVVIAQAASTDSQIRNTFAGVDFAPVADFSLLKKA
DEOD_EXIS2      PSMSIYANELVQSYGAKNLIRVGTAGGITPDVKVRDVVIAMSASHDMAQNRVRFNGLDYAPTASFDLLHK
DEOD2_SHEON     PSCSIYATELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSQVNRLRFKGQDFAAIANYELMNA
DEOD_LISMO      PSISIYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVVIAQAASTDSQIRNTFAGVDFAPVADFSLLKKA
DEOD_LISMH      PSISIYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVVIAQAASTDSQIRNTFAGVDFAPVADFSLLKKA
DEOD_LISMF      PSISIYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVVIAQAASTDSQIRNTFAGVDFAPVADFSLLKKA
DEOD_LISMC      PSISIYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVVIAQAASTDSQIRNTFAGVDFAPVADFSLLKKA
DEOD_ALKMQ      PSISIYVNELISDYGVKNLIRVGTCGAMQEEIQLRDVILAMSASTDSNMNKLRFGGMDYAPTASFRLLKK
DEOD_SHESR      PSCSIYATELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSQVNRLRFKGQDFAAIANYELMNA
DEOD_SHESM      PSCSIYATELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSQVNRLRFKGQDFAAIANYELMNA
DEOD_HAEPS      PSCSIYAKELITEYGVKKIIRVGSCGAVRQDVKLREVIIGVGACTDSKVNRIRFKDNDFAAIADFDLTLA
DEOD_BREBN      PSISIYANELMQSYGVQNLIRVGTCGAIQEDIKVRDVIIAMSASSESQTNRLLFDQIDFAPTANFELLHK
DEOD1_VIBVY     PSCSIYATELIKDYGVKKIIRVGSCGAVSTDIKVRDVVIGMGACTDSKVNRIRFKGHDFAAIADYKMVXX
DEOD1_VIBVU     PSCSIYATELIKDYGVKKIIRVGSCGAVSTDIKVRDVVIGMGACTDSKVNRIRFKGHDFAAIADYKMVXX
DEOD_SHEFN      PSCSIYAHELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSRVNRLRFKDNDFAAIADYSLLSA
DEOD_SHEAM      PSCSIYATELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSQVNRLRFKGQDFAAIADYSLLSA
DEOD_HAHCH      PSISIYAHELFTQFNVKNIVRIGSCGSIRDEVKVRDIVIGMGAGTDSLVNRVRLNHYDFAAIADYDLLEP
DEOD_CLOTE      PSMSIYATELIESYGVKNLIRVGTCGSYVEKVKVRDLIIAMSACTNSNINLVPFKGRTFAPTASFDLLKP
DEOD_PECCP      PSCSIYAKELITEFGVKKIIRVGSCGAVREDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFDMVRN
DEOD_XENNE      PSCSIYAKELITEFGVKKIIRIGSCGAVSEDVKIRDVVIGMGACTDSKVNRMRFKDHDFAAIADFDLVRH
DEOD_MANSM      PSCSIYTKELITEYGVKKIIRVGSCGAVRNDVKVRDVIIGLGACTDSKVNRIRFKDNDFAAIADFDMTQA
DEOD_SHELP      PSCSIYATELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSQVNRLRFKGQDFAAICDYSLLSA
DEOD_HAEDU      PSCSIYAKELITEYGVKKIIRVGSCGAVRADVKLRDIVIGSGACTDSKVNRIRFRDNDFAAIADFEMTLA
DEOD_YERE8      PSCSIYAKELITDFGVKKIIRVGSCGAVREDVKLRDVVIGMGACTDSKVNRLRFKDHDYAAIADFDMTRN
DEOD_SHEB2      PSCSIYATELIRDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSAVNRLRFKGQDFAAIANYELMNA
DEOD_THETN      PSISIYVNELITSYGVKNLIRIGTCGSLQPDIKIRDIVIAMSASTDSAINKIRFNGMDYAPTASFKLLKK
DEOD_SHEB8      PSCSIYATELIRDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSAVNRLRFKGQDFAAIANYELMNA
DEOD_SHEB5      PSCSIYATELIRDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSAVNRLRFKGQDFAAIANYELMNA
DEOD_ERWT9      PSCSIYAKELITEFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRMRFKDHDFAAIADFDMVRN
DEOD1_VIBF1     PSCSIYMTELIKDFGVKKVIRVGSCGAVNEGIKVRDVVIGMGACTDSKVNRIRFKDHDFAAIADYEMVRN
DEOD_YERPY      PSCSIYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFEMTRN
DEOD_YERPS      PSCSIYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFEMTRN
DEOD_YERPP      PSCSIYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFEMTRN
DEOD_YERPN      PSCSIYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFEMTRN
DEOD_YERPG      PSCSIYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFEMTRN
DEOD_YERPE      PSCSIYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFEMTRN
DEOD_YERPB      PSCSIYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFEMTRN
DEOD_YERPA      PSCSIYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFEMTRN
DEOD_YERP3      PSCSIYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFEMTRN
DEOD_GEOSW      PSISIYVNELIQSYGVQTLIRVGTCGAIQKDVNVRDVILAMSASTDSNMNRLTFRGRDYAPTAHFDLLRT
DEOD3_SHEON     SSMVLYGHELINFFGVKRIIRIGSLGATQQHVEMRDVILAQAAGTDSPTNAKRSSGYHMATSATFSLLHK
DEOD_EXISA      PSMSIYVNELIMSYGAKNLIRVGTAGGIQEDVKVRDVVIAMSASSEMGQNRVRFNGMDYAPTATFDLLHR
DEOD_ERWCT      PSCSIYAKELITEFGVKKIIRVGSCGAVREDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFDMVRN
DEOD_HAES2      PSCSIYAKELITEYGVKKIIRVGSCGAVNMDVKIRDVIIGLGACTDSKVNRIRFKDNDFAAIADFGMARA
DEOD_PROMH      PSCSIYAKELITDFGVKVIIRVGSCGAVLPDVELRDVVIGMGACTDSKVNRLRFKDQDFAAIADFELVQN
DEOD_HAES1      PSCSIYAKELITEYGVKKIIRVGSCGAVNMDVKIRDVIIGLGACTDSKVNRIRFKDNDFAAIADFGMAQA
DEOD_GEOKA      PSISIYVNELIQSYGVKTLIRVGTCGAIQPDVRVRDVILAMSASTDSNMNRLIFRGRDYAPTADFHLLRT
DEOD_CLONN      PSISIYANELIESYGVKNLIRVGTCGSINKDIKVRDIILAMGACTNSGTNRMRFNGMDFAPIASFDLLKK
DEOD_PHOLL      PSCSIYAKELITDFGAKVLIRVGSCGSVRHDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDLVRN
DEOD2_PHOPR     PSCSIYVHELIKDFGVKNIIRVGSCGAVHDDVKLMDIIIGMGASTDSKVNRIRFNDHDFAAIADFHLLET
DEOD_GEOTN      PSISIYVNELIQSYGVKTLIRVGTCGAIQPDVRVRDVILAMSASTDSNMNRLIFRGRDYAPTADFHLLRT
DEOD_CHRVO      PSASIYTTELIKDYGVKNIIRIGSCGAVTPDIKLRELFVAMGASTDSKVNRMRFNDHDYAAIADYTLLRT
DEOD_MYCPN      PSIGIYSYELMKFYEVNTIIRIGSCGALQGSLNLQDLIIAAKAWSESIYANDMGVEVPADLMASPQLVEL
DEOD_SALTY      PSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_SALHS      PSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_LACBA      PSISIYTNELISEYGVKTLFRVGTSGGMSPDVHVRDVVLAQAASTDSSIIHNTFGGGIYYAAISDGLLDT
DEOD_SALAR      PSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_ENTS8      PSCSIYTKELITDFGVKKIIRVGSCGAVRADVKLRDVVIGMGACTDSKVNRLRFKDHDFAAIADFDMVRN
DEOD_BUCAP      PSASLYVRELILEYNVKKIIRVGTCGTIQNNIKLRDIVISMGASTDSKINRIRFNNHDYAAIADFEMIFH
DEOD_SALTI      PSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_SALSV      PSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_SALPK      PSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_SALPB      PSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_SALPA      PSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_SALNS      PSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_SALEP      PSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_SALDC      PSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_SALCH      PSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_SALA4      PSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_PASMU      PSCSIYTKELITEYGVKKIIRVGSCGAVRMDVKLRDVVIGFGACTDSKVNRIRFKNHDFAAIADFDMTMA
DEOD_CITK8      PSCSIYTKELITDFGVKKIIRVGSCGAVRNDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_STRZT      PSISIYARELIVDYGVKKLIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDWPQYDFPQIASFDLLDK
DEOD_STRPS      PSISIYARELIVDYGVKKLIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDWPQYDFPQIASFDLLDK
DEOD_HAEIN      PSCSIYAKELITEYGVKKIIRVGSCGTVRMDVKVRDVIIGLGACTDSKVNRIRXXXXXXXXXXXXXXXXX
DEOD_HAEI8      PSCSIYAKELITEYGVKKIIRVGSCGTVRMDVKVRDVIIGLGACTDSKVNRIRXXXXXXXXXXXXXXXXX
DEOD_STRZJ      PSISIYARELIVDYGVKKLIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDWPQYDFPQIASFDLLDK
DEOD_STRPI      PSISIYARELIVDYGVKKLIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDWPQYDFPQIASFDLLDK
DEOD_SHISS      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_SHIBS      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_SHIB3      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_ESCF3      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_ENT38      PSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRMRFKDHDFAAIADFGMVRN
DEOD_ECOSM      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_ECOSE      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_ECOLU      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_ECOLI      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_ECOHS      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_ECODH      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_ECOBW      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_ECO8A      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_ECO5E      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_ECO57      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_ECO55      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_ECO45      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_ECO24      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_STRSY      PSISIYAHELINEYGVKKLIRVGTAGSLNEDVHVRELVLAQAAATNSRMINIDWPEYDLPQIADFDLLDK
DEOD_STRS2      PSISIYAHELINEYGVKKLIRVGTAGSLNEDVHVRELVLAQAAATNSRMINIDWPEYDLPQIADFDLLDK
DEOD_SHIFL      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_SHIF8      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_SHIDS      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_SALG2      PSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLSDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_ECOLC      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_ECOL6      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_ECOL5      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_ECO81      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_ECO7I      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_ECO27      PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
DEOD_STRGC      PSISIYARELIVDYGVKKLIRVGTAGSLNEDVHVRELVLAQAAATNSNIIRNDWPQYDFPQIASFDLLDK
DEOD_HAEIG      PSCSIYAKELITEYGVKKIIRVGSCGTVRMDVKVRDVIIGLGACTDSKVNRIRXXXXXXXXXXXXXXXXX
DEOD_DICNV      PSCSIYAKELITEYGVKNLIRVGSCGAVLDEIKLHDVIIALSAATDSNVNRLRFRHYDFAATADYSIFSA
DEOD_STRZP      PSISIYARELIVDYGVKKLIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDWPQYDFPQIASFDLLDK
DEOD_STRPJ      PSISIYARELIVDYGVKKLIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDWPQYDFPQIASFDLLDK
DEOD_STRP7      PSISIYARELIVDYGVKKLIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDWPQYDFPQIASFDLLDK
DEOD_STRP4      PSISIYARELIVDYGVKKLIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDWPQYDFPQIASFDLLDK
DEOD_STRP2      PSISIYARELIVDYGVKKLIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDWPQYDFPQIASFDLLDK
DEOD_LACCB      PSISIYVNELIQDYGVKTLIRVGTAGGMGENVKVRDVVLAQGSSTDSSIILNTFGAGLYFAPLADNLLRE
DEOD_LACC3      PSISIYVNELIQDYGVKTLIRVGTAGGMGENVKVRDVVLAQGSSTDSSIILNTFGAGLYFAPLADNLLRE
DEOD_KLEP3      PSCSIYTKELITDFGVKKIIRVGSCGAVREDVKLRDVVIGMGACTDSKVNRLRFKDHDFAAIADFGMVRN
DEOD_HAEIE      PSCSIYAKELITEYGVKKIIRVGSCGSVRMDVKVRDVIIGLGACTDSKVNRIRXXXXXXXXXXXXXXXXX
DEOD_STRTD      PSISIYARELIVDYGVKKLIRVGTAGSLNENVHVRELVLAQAAATNSNIIRNDWPQYDFPQIANFNLLDK
DEOD_STRPF      PSISIYARELIVDYGVKTLIRVGTAGAIDPEVHVRELVLAQAAATNSNIIRNDFPEFDFPQIADFGLLDK
DEOD_MYXXD      PSISIYATELIKTYGVRVIIRVGSCGALSTDVKVREVIVATGAGTDSNVNRMRLMGHDFAAVADFTLXXX
DEOD_LACLA      PSISIYANELITEYGVKRLIRVGTAGSVNEDVHIRDLVIGQAAATTSAIIRNDFPDFDFPQIADFDLLDK
DEOD_STRPC      PSISIYARELIVDYGVKTLIRVGTAGAIDPEVHVRELVLAQAAATNSNIIRNDFPEFDFPQIADFGLLDK
DEOD_STRPB      PSISIYARELIVDYGVKTLIRVGTAGAIDPEVHVRELVLAQAAATNSNIIRNDFPEFDFPQIADFGLLDK
DEOD_LACLS      PSISIYANELITEYGVKRLIRVGTAGSVNEDVHIRDLVIGQAAATTSAIVRHDFPDFDFPQIADFDLLDK
DEOD_LACLM      PSISIYANELITEYGVKRLIRVGTAGSVNEDVHIRDLVIGQAAATTSAIVRHDFPDFDFPQIADFDLLDK
DEOD_STRPG      PSISIYARELIVDYGVKTLIRVGTAGAIDPEVHVRELVLAQAAATNSNIIRNDFPEFDFPQIADFGLLDK
DEOD_LACSS      PSISIYANELIQFYGVKRLIRVGTCGGLGTDVHVRDVMIAQSASTDSAIIQNTFGAGLYYAPTADKLLMK
DEOD_EDWI9      PSCSIYAKELITDFGVKKIIRVGSCGAVSMDVKLRDVVIGMGACTDSKVNRLRFKDNDFAAIADFDMVRN
DEOD_LACRJ      PSMSIYINELVREFGVKTIIRVGSCGGIAPDVHVRDVLLAQGSSTDSAVTVNTFGPGFHYAPLADKLLDT
DEOD_LACRD      PSMSIYINELVREFGVKTIIRVGSCGGIAPDVHVRDVLLAQGSSTDSAVTVNTFGPGFHYAPLADKLLDT
DEOD1_SHEON     PSASIYFHELMATYGVKNFIRVGSCGAISDNIHLKDLIVAMGASTDSKINRIRFLDHDLAAIANYDLLQA
DEOD_MYCGE      PSIGIYSYELMNFYEVETIIRIGSCGALAPQLKLKDLVIASKAWSESIYVEIPEDKILFATSSLVELAKE
DEOD3_VIBF1     PSASIYFHELMTTYKVKNFIRIGSCGAIHDDVKLKDLIVAIGASTDSKMNRIRFKDNDFAATANYNMLSE
DEOD_TREPA      PSHSIYVTELFQDYGVQKAIRVGTAGGLQEEVALKSVVCALGAATDSAINARRFSGMHFAPTASWSLLRT
DEOD_BUCAT      PSASLYTRELIIEFNVKKIIRIGTCGAVRDDIKLRDIVISMGASTDSKVNRIRFNDHDFAAIADFDMIYN
DEOD_BUCAI      PSASLYTRELIIEFNVKKIIRIGTCGAVRDDIKLRDIVISMGASTDSKVNRIRFNDHDFAAIADFDMIYN
DEOD_BUCA5      PSASLYTRELIIEFNVKKIIRIGTCGAVRDDIKLRDIVISMGASTDSKVNRIRFNDHDFAAIADFDMIYN
DEOD_JANSC      PSLSIYANELLRDYGAKTLIRIGSCGAMQADVKLRDVILAMTASTLSTPSSGIFRELNYAPCADYGLLQA
DEOD_ACTSZ      PSCSIYSKELITEYGVKKIIRVGSCGAVRQDVHVRDVIIGLGACTDSKVNRIRFRDNDFAAIADFGMXXX
DEOD_STRU0      PSISIYARELIVDYGVKTLIRVGTAGSIDPNVHVRELVLAQAAATNSNIIR----------NDFPEFDFP
DEOD_KLEPN      PSCSIYTKELITDFGVKKIIRVGSCGAVREDVKLREVVIGHGACTDSKVNRL--RFKDHDFPAIADFGMV
DEOD_HELAH      ASCTIYVTELVKTYQVKELLRIGTCGAISPKVGLRDIIMVTGASTDSKTNRIRFLNHDLSATPDFELSLR
DEOD_STRTR      PSISIYARELIVDYGVKKLIRVGTAGSLNENVHVRELVLAQAAATNSNIIRNDWPQYDFPQIASFNLLDK
DEOD_ROSDO      PSLSIYANELISSYNAQTLIRIGSCGGMQPHVAVRDVIIAMSATTSSGIFREVNFAPTAHYDLLXXXXXX
DEOD_HELPJ      ASCTIYVTELIKTYQVKELLRIGTCGAISPKVGLKDIVMATGASTDSKTNRVRFLNHDLSATPDFELSLR
DEOD_HELPY      ASCTIYVTELIKTYQVKELLRIGTCGAISPKVGLKDIIMATGASTDSKTNRVRFLNHDLSATPDFELSLR
DEOD_HELP2      ASCTIYVTELIKTYQVKELLRIGTCGAISPKVGLKDIIMATGASTDSKTNRVRFLNHDLSATPDFELSLR
DEOD_HELPS      ASCTIYVTELIKTYQVKELLRIGTCGAISPKVGLKDIIMAMGASTDSKTNRVRFLNHDLSATPDFELSLR
DEOD_HELPG      ASCTIYVTELIKTYQVKELLRIGTCGAISPKVGLKDIIMA---------IGASTDSKTNRVRPDFELSLR
DEOD_HELPH      ASCTIYVTELIKTYQVKELLRIGTCGAISPKVGLKDIIMAMGASTDSKTNRVRFLNHDLSATPDFELSLR
DEOD_DINSH      PSLSIYANELITEYGAQTLIRIGSTGAMQNHVALRDVILASGIFCELNF------APCADWXXXXXXXXX
DEOD_BUCBP      PSSLIYVKELVSEYNVKKIIRIGTCGTVXXXXXXXXXXXCLGASTDSKVNRLRFHDNDFSSVADFYLILD
MTAP_SULSO      PSIAIVLEEL-AMLGANVFIRYGTTGALVPYINLGEYIIVTASYNQGGFYQYLRDNACVASTPDFELTNK


                         +         .         .         .         .         *         .:210
query           LIASAQRQDIELKKAKAHCTDVFYRKNSDDYKKIVKKYNCDLVEMXXXXXXXXXXXXGKKASAVVTISDS
DEOD_CLOB8      AYDIAVEKGFDPKVGSIYSSDVFYGDDDEDWKKWA-KFGCLGVEMEAAALYTIAAKFGVNALALLTVSDH
DEOD_BACSU      AYDAAKDKGVPVTVGSVFTADQFY--NDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDH
DEOD_BACA2      AYQEAQKNNLPVAVGSVFTADQFY--NEDSQIEKLARYGVLGVEMETTALYTLAAKYGKKALSILTVSDH
DEOD_PSYIN      AVNAARALGIKARVGNIFSADTFYTPEPEVFDTL-EKYNILGVEMEAAGLYGVAAEEGKNALCILTVSDH
DEOD_OCEIH      AYDAGVDKGLHLRVGNVFTSDTFYRDNAQQVNELLAKYQVLAIEMESTALYTLAAKYGRQALSVLTVSDH
DEOD_BACLD      AYDAASERNIPVTAGNVFTADQFY--NDDSQIEKLAKHGVLAVEMETTALYTLAAKFGRKALSILTVSDH
DEOD2_VIBPA     AVKQARAQEVPVKVGNVFSADLFYTPEADIFEK-MEKLGILGVDMEAAGIYGVAADLGAKALTILTVSDH
DEOD2_VIBVY     AVKQARAQNVPVKVGNVFSADLFYTPEADIFEK-MEKLGILGVDMEAAGIYGVAADLKAKALTILTVSDH
DEOD2_VIBVU     AVKQARAQNVPVKVGNVFSADLFYTPEADIFEK-MEKLGILGVDMEAAGIYGVAADLKAKALTILTVSDH
DEOD_ANOFW      AYEIGKEKGLQLKVGSVFTADMFYNENAQFEK--LARYGVLAVEMETTALYTLAAKFGRKALSVLTVSDH
DEOD_ALISL      AVAQARKLNVPVKVGNVFSADLFYSPETDLFDK-MEKLGILGVDMEAAGIYRVAADLGAKALTILTVSDH
DEOD2_VIBCH     AVNQARAQQVPVKVGNVFSADLFYTPEPEIFEK-MKKLGILGVDMEAAGIYGVAADLGARALTILTVSDH
DEOD_THEPX      AYDKAMELGIQPKVGNILTTDTFYNDDPDSW-KLWAKFGVLAVEMETAGLYTLAAKYNVDALTILTVSDS
DEOD_THEP3      AYDKAMELGIQPKVGNILTTDTFYNDDPDSW-KLWAKFGVLAVEMETAGLYTLAAKYNVDALTILTVSDS
DEOD_BACST      AYEIGKEKGLQLKVGSVFTADMFYNENAQFEK--LARYGVLAVEMETTALYTLAAKFGRKALSVLTVSDH
DEOD_ACTPJ      AVQAAKQKGIAARVGNLFSADLFYTPDVEMF-DVMEKYGILGVEMEAAGIYAVAAEYGAKALAICTVSDH
DEOD_ACTPL      AVQAAKQKGIAARVGNLFSADLFYTPDVEMF-DVMEKYGILGVEMEAAGIYAVAAEYGAKALAICTVSDH
DEOD_ACTP7      AVQAAKQKGIAARVGNLFSADLFYTPDVEMF-DVMEKYGILGVEMEAAGIYAVAAEYGAKALAICTVSDH
DEOD_ACTP2      AVQAAKQKGIAARVGNLFSADLFYTPDVEMF-DVMEKYGILGVEMEAAGIYAVAAEYGAKALAICTVSDH
DEOD_BACCN      AYDAGTEKGLHIRVGNVLTADVFYRESMDMVKKL-GDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDH
DEOD1_PHOPR     AVDAAKAKGIPVKVGNIFSADLFYNPDF-EFFKTMDKYGIVGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD2_VIBF1     AVGQARELNVPVKVGNVFSADLFYSPEADLFDK-MEKLGILGVDMEAAGIYGVAADLGAKALTILTVSDH
DEOD_PSEHT      GVNAAKDLGIKAKVGNVFTTDTFYQAD-DTFYKDLDKLGVLAVDMETAGLYGVAAEYGAKAMALFTVSDH
DEOD_COLP3      VVDTAEKLGKPVHVGNIFTADLFYTPQPEKF-ATMEKYGILAVEMEAAGLYGVAAEYGKKALTVLTVSDH
DEOD_BACCZ      AYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLA-DYGVLAVEMETTALYTLAAKYGVNALSVLTVSDH
DEOD1_VIBCH     XXXXXXXRGIDVKVGNLFSAELFYTPDPSMF-DVMDKYGIVGVEMEAAGIYGVAAEYGAKALAICTVSDH
DEOD_TOLAT      AVTAAETLGIPVKVGNLFSADLFYSPDPQMF-DVMEKFGILGVEMEAAGIYGVAAEYGANALAICTVSDH
DEOD_CLOPS      AYDTAVEKGYSPKVGSVFTADSFYNDNPEAWKQWA-KFGTLAVEMETAALYTLAAKYGVNALTILTISDH
DEOD_CLOP1      AYDTAVEKGYSPKVGSVFTADSFYNDNPEAWKQWA-KFGTLAVEMETAALYTLAAKYGVNALTILTISDH
DEOD_BACWK      AYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKL-GDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDH
DEOD_BACHK      AYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKL-GDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDH
DEOD_BACCR      AYDAGTEKGLHVRVGNVLTADVFYRESMDIVKKL-GDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDH
DEOD_BACCQ      AYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKL-GDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDH
DEOD_BACCE      AYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKL-GDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDH
DEOD_BACC7      AYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKL-GDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDH
DEOD_BACC4      AYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKL-GDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDH
DEOD_BACC3      AYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKL-GDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDH
DEOD_BACC2      AYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKL-GDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDH
DEOD_BACC1      AYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKL-GDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDH
DEOD_BACC0      AYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKL-GDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDH
DEOD_BACAN      AYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKL-GDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDH
DEOD_BACAH      AYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKL-GDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDH
DEOD_BACAC      AYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKL-GDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDH
DEOD_BACAA      AYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKL-GDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDH
DEOD1_VIBPA     AEDAAKARGIDVKVGNLFSAELFYTPDPEMF-DVMDKYGIVGVEMEAAGIYGVAAEYGAKALTICTVSDH
DEOD_SHEDO      VVDSAKEHGTQIRVGNVFSADLFYTPDPQMF-DVMEKMGVLGVEMEAAGLYGVAHELGAKALCVVTVSDH
DEOD_LISW6      YDAGVEK-GLSLKVGNVFSADRFYNDQLD--KQQLADYGVLGIEMEAAALYTLAQKYGRRALAILTVSDH
DEOD_LISIN      YDAGVEK-GLSLKVGNVFSADRFYNDQLD--KQQLADYGVLGIEMEAAALYTLAQKYGRRALAILTVSDH
DEOD_EXIS2      AYMTAKEHGIDAKVGQIFTTDQFYQDDFHHFKKWA-DFGCLAIEMEAAGLYTLAAKHKVNALTILTISDH
DEOD2_SHEON     VIESAKVKGTKIRVGNVFSADLFYTPDPQMF-DVMEKMGVLGVEMEAAGLYGVAHEFGARALCVVTVSDH
DEOD_LISMO      YDAGIEK-GLSLKVGNVFSADRFYNDQLD--KQQLADYGVLGIEMEAAALYTLAQKYGRRALAILTVSDH
DEOD_LISMH      YDAGIEK-GLSLKVGNVFSADRFYNDQLD--KQQLADYGVLGIEMEAAALYTLAQKYGRRALAILTVSDH
DEOD_LISMF      YDAGIEK-GLSLKVGNVFSADRFYNDQLD--KQQLADYGVLGIEMEAAALYTLAQKYGRRALAILTVSDH
DEOD_LISMC      YDAGIEK-GLSLKVGNVFSADRFYNDQLD--KQQLADYGVLGIEMEAAALYTLAQKYGRRALAILTVSDH
DEOD_ALKMQ      AYDVAQEKGILTRVGNVLTVDTFYNEDVNSWKKWA-EFGTLAVEMETAALYTLAAKFGVDALTLLTVSDS
DEOD_SHESR      VIESAKVKGTKIRVGNVFSADLFYTPDPQMF-DVMEKMGVLGVEMEAAGLYGVAHEFGARALCVVTVSDH
DEOD_SHESM      VIESAKVKGTKIRVGNVFSADLFYTPDPQMF-DVMEKMGVLGVEMEAAGLYGVAHEFGARALCVVTVSDH
DEOD_HAEPS      AVQAAKAKGINVRVGNLYSADLFYTPDVEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_BREBN      AYQVATERNLPVKVGNIFTSDSFYRESLDLYKKLA-SYQVLAIEMESSALYTLAAKYKRNALSILTVSDH
DEOD1_VIBVY     XXXXXXXRGIDVKVGNLFSAELFYTPDPEMF-DVMDKYGIVGVEMEAAGIYGVAAEYGAKALTICTVSDH
DEOD1_VIBVU     XXXXXXXRGIDVKVGNLFSAELFYTPDPEMF-DVMDKYGIVGVEMEAAGIYGVAAEYGAKALTICTVSDH
DEOD_SHEFN      VVDSAKAHGTKIRVGNVFSADLFYTPDPQMF-DVMEKMGILGVEMEAAGLYGVAHELGAKALCVVTVSDH
DEOD_SHEAM      VVESAKTHGIQTRVGNVFSADLFYTPDPEMF-DVMEKMGVLGVEMEAAGLYGVAHEFGARALCVVTVSDH
DEOD_HAHCH      VVNAARRREARFHVGALFTTDLFYAADPGLTERL-SAHGVKAVEMEAAGLYGVAAECGGKALALCTVSDH
DEOD_CLOTE      AYDIAVEKGFEPKVGXXXXXXXXXXXXKEDWKTWA-KYGCLGVEMETAALYTIAAKYGVNALTLLTVSDH
DEOD_PECCP      AVDAAKARDVSVRVGNIFSADLFYTPDPQMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALAICTVSDH
DEOD_XENNE      AVDAAKAKNINTRVGNIFSVDLFYSPDPQMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALAICTVSDH
DEOD_MANSM      AVQAAKAKGINYRVGNLFSADLFYTPDVEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALSICTVSDH
DEOD_SHELP      VVKAAEEKGTKYRVGNVFSADLFYTPDPEMF-DVMEKMDVLGVEMEAAGLYGVAKEFGAKALCVVTVSDH
DEOD_HAEDU      AYQVAKQKNISVQVGNLFSADLFYTPDVAMF-DVMEKYGILGVEMEAAGIYVVAAEYGVKSLAICTVSDH
DEOD_YERE8      AVDAAKAKGLNVRVGNLFSADLFYTPDPQMF-DVMKKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_SHEB2      VIESAKVRGTKIRVGNIFSADLFYTPDPQMF-DVMEKMGVLGVEMEAAGLYGVAHEFGARALCVVTVSDH
DEOD_THETN      AYDKAVEMGIEPKVGNILTTDTFYHDDPESW-RLWAKFGVLAVEMETAGLYTLAAKYGVDALTILTVSDS
DEOD_SHEB8      VIESAKVRGTKVRVGNIFSADLFYTPDPQMF-DVMEKMGVLGVEMEAAGLYGVAHEFGARALCVVTVSDH
DEOD_SHEB5      VIESAKVRGTKVRVGNIFSADLFYTPDPQMF-DVMEKMGVLGVEMEAAGLYGVAHEFGARALCVVTVSDH
DEOD_ERWT9      AVDAAQALGVKARVGNIFSADLFYTPDPQMF-DVMEKYGVLGVEMEAAGIYGVAAEFGAKALAICTVSDH
DEOD1_VIBF1     AELAAQARGIDVKVGNLFSAELFYTPDPSMF-DLMDKYGIVGVEMEAAGMYGVAAEYGAKALAICTVSDH
DEOD_YERPY      AVDAAKAKGVNVRVGNLFSADLFYTPDPQMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_YERPS      AVDAAKAKGVNVRVGNLFSADLFYTPDPQMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_YERPP      AVDAAKAKGVNVRVGNLFSADLFYTPDPQMF-DVMEKYGILGVEMEAAGICGVAAEFGAKALTICTVSDH
DEOD_YERPN      AVDAAKAKGVNVRVGNLFSADLFYTPDPQMF-DVMEKYGILGVEMEAAGICGVAAEFGAKALTICTVSDH
DEOD_YERPG      AVDAAKAKGVNVRVGNLFSADLFYTPDPQMF-DVMEKYGILGVEMEAAGICGVAAEFGAKALTICTVSDH
DEOD_YERPE      AVDAAKAKGVNVRVGNLFSADLFYTPDPQMF-DVMEKYGILGVEMEAAGICGVAAEFGAKALTICTVSDH
DEOD_YERPB      AVDAAKAKGVNVRVGNLFSADLFYTPDPQMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_YERPA      AVDAAKAKGVNVRVGNLFSADLFYTPDPQMF-DVMEKYGILGVEMEAAGICGVAAEFGAKALTICTVSDH
DEOD_YERP3      AVDAAKAKGVNVRVGNLFSADLFYTPDPQMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_GEOSW      AYEVGVEKGLKLKVGNVFTADMFYNDQPD--WETWARYGVLAVEMETAALYTLAAKFGRKALSVLTVSDH
DEOD3_SHEON     AYTKANEKGISVKVGNVFSGDLYYDPD-EDMIPALERFGVLGIDMEVAGLYGLAHQQGIESLAILTVSDH
DEOD_EXISA      AYMNAEKAGIPVKVGQIFTADQFYQDDFHHFKKWA-DFGCLAIEMEAAGLYTLAAKHKVNALTILTISDH
DEOD_ERWCT      AVDAAKARDVSVRVGNIFSADLFYTPDPQMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALAICTVSDH
DEOD_HAES2      AVQAAKNKGIDVKVGNLFSADLFYTPDLEMF-DVMEKYGILGVEMEAAGIYGVAAEFKAKALTICTVSDH
DEOD_PROMH      AVSAAKAKDIKVRVGNIFSADLFYSPDPEMF-DVMEKYGILGVEMEAAGIYGVAAEYGARALTICTVSDH
DEOD_HAES1      AVQAAKNKGIDVKVGNLFSADLFYTPDPEMF-DVMEKYGILGVEMEAAGIYGVAAEFKAKALTICTVSDH
DEOD_GEOKA      AYEVGVEKGLALKVGNVFTADMFY--NDEPNWETWARYGVLAVEMETAALYTLAAKFGCRALSVLTVSDH
DEOD_CLONN      AYDIGKSKGLDIKVGNILSSDLFYNDDKDAIK-LWSKYGVLGIEMEASGLYTLGAKYGVNTLAILTVSDS
DEOD_PHOLL      AVDAAKAKNINVRVGNIFSVELFYTPDPQLF-DIMEKYGILGVEMEAAGFYGVAAEYGAKALTICTVSDH
DEOD2_PHOPR     SVQQARLQNVNVRVGNIFSADLFYSPEEGLFDK-MEKLGMLGIDMEAAGIYGVAAELGAKALTILTVSDH
DEOD_GEOTN      AYDVGMEKGLALKVGNVFTADMFY--NDEPNWETWARYGVLAVEMETAALYTLAAKFDCRALSVLTVSDH
DEOD_CHRVO      VVDTAAEQGKKVTVGNVFSADLFYGV-QPNMLDVLSKLQVNVIEMELAGIYSVAAQYGARAVGILTVSDI
DEOD_MYCPN      AKKTANQLQLAFHEGLVFCEDAFHQIRK-DVLKLAQEKHALAVEMEAHALYANAMLLNKQALTMLTVSDS
DEOD_SALTY      AVDAAKALGVDARVGNLFSADLFYSPDGEMF-DVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_SALHS      AVDAAKALGVDARVGNLFSADLFYSPDGEMF-DVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_LACBA      AYHVAQDLKISVRVGNVLAEDRFYNDEMDRQKLV--DYGVIATEMESTALFMLAAKYHVRALSVLTISNH
DEOD_SALAR      AVDAAKALGVDARVGNLFSADLFYSPDGDMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_ENTS8      AVDAAKALGVEARVGNIFSADLFYTPDPSMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_BUCAP      AFSTAKKMNFKVHIGNFFTTDSFYTE-SEDMLKILKKYNIIGIDMETAGIYAVAAELKAQALSICTVSDH
DEOD_SALTI      AVDAAKALGVDARVGNLFSADLFYSPDGEMF-DVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_SALSV      AVDAAKALGVDARVGNLFSADLFYSPDGEMF-DVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_SALPK      AVDAAKALGVDARVGNLFSADLFYSPDGEMF-DVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_SALPB      AVDAAKALGVDARVGNLFSADLFYSPDGEMF-DVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_SALPA      AVDAAKALGVDARVGNLFSADLFYSPDGEMF-DVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_SALNS      AVDAAKALGVDARVGNLFSADLFYSPDGEMF-DVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_SALEP      AVDAAKALGVDARVGNLFSADLFYSPDGEMF-DVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_SALDC      AVDAAKALGVDARVGNLFSADLFYSPDGEMF-DVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_SALCH      AVDAAKALGVDARVGNLFSADLFYSPDGEMF-DVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_SALA4      AVDAAKALGVDARVGNLFSADLFYSPDGEMF-DVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_PASMU      AVQAAKAKGLNVHVGNLFSADLFYTPDVEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_CITK8      AVDAAKALGVDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_STRZT      AYHIAKKLGMTTHVGNVLSSDVFY---SNYFEKNIEKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDS
DEOD_STRPS      AYHIAKKLGMTTHVGNVLSSDVFY---SNYFEKNIEKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDS
DEOD_HAEIN      XXXXXXXXXXXXRVGNLFSADLFYTPDVEMF-DVMEKYGILGVEMEAAGIYGVAAEYGAKALTICTVSDH
DEOD_HAEI8      XXXXXXXXXXXXRVGNLFSADLFYTPDVEMF-DVMEKYGILGVEMEAAGIYGVAAEYGAKALTICTVSDH
DEOD_STRZJ      AYHIAKELGMTTHVGNVLSSDVFY---SNYFEKNIEKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDS
DEOD_STRPI      AYHIAKELGMTTHVGNVLSSDVFY---SNYFEKNIEKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDS
DEOD_SHISS      AVDAAKALGIDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_SHIBS      AVDAAKALGIDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_SHIB3      AVDAAKALGIDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_ESCF3      AVDAAKALGIDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_ENT38      AVDAAKALGVDARVGNIFSADLFYSPDGGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_ECOSM      AVDAAKALGIDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_ECOSE      AVDAAKALGIDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_ECOLU      AVDAAKALGIDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_ECOLI      AVDAAKALGIDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_ECOHS      AVDAAKALGIDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_ECODH      AVDAAKALGIDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_ECOBW      AVDAAKALGIDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_ECO8A      AVDAAKALGIDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_ECO5E      AVDAAKALGIDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_ECO57      AVDAAKALGIDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_ECO55      AVDAAKALGIDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_ECO45      AVDAAKALGIDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_ECO24      AVDAAKALGIDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_STRSY      AYHIAKELNMTTHVGNVLSSDSFYSPKLFSRNLELGQLGVKAVEMEAAALYYLGAKFGVQTLAIMTISDS
DEOD_STRS2      AYHIAKELNMTTHVGNVLSSDSFYSPKLFSRNLELGQLGVKAVEMEAAALYYLGAKFGVQTLAIMTISDS
DEOD_SHIFL      AVDAAKALGVDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_SHIF8      AVDAAKALGVDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_SHIDS      AVDAAKALGVDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_SALG2      AVDAAKALGVDARVGNLFSADLFYSPDGEMF-DVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_ECOLC      AVDAAKALGVDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_ECOL6      AVDAAKALGVDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_ECOL5      AVDAAKALGVDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_ECO81      AVDAAKALGVDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_ECO7I      AVDAAKALGVDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_ECO27      AVDAAKALGVDARVGNLFSADLFYSPDGEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_STRGC      AYHIAKDLGMTTHVGNVLSSDVFY---SNYFEKNIEKWGVKAVEMEXXXXXXXXXQHHVDALAIMTISDS
DEOD_HAEIG      XXXXXXXXXXXXXXXNLFSADLFYTPDVEMF-DVMEKYGILGVEMEAAGIYGVAAEYGAKALTICTVSDH
DEOD_DICNV      LIAAAAQQNITARVGTVFSTDSFYHADT-ELMDLLKRFHILGVEMEAAGLFGVAAEYGARAGCILTVSDH
DEOD_STRZP      AYHIAKELGMTTHVGNVLSSDVFY---SNYFEKNIEKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDS
DEOD_STRPJ      AYHIAKELGMTTHVGNVLSSDVFY---SNYFEKNIEKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDS
DEOD_STRP7      AYHIAKELGMTTHVGNVLSSDVFY---SNYFEKNIEKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDS
DEOD_STRP4      AYHIAKELGMTTHVGNVLSSDVFY---SNYFEKNIEKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDS
DEOD_STRP2      AYHIAKELGMTTHVGNVLSSDVFY---SNYFEKNIEKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDS
DEOD_LACCB      AANLADTSAIRYHVGNVLGEDRFYNDEMDRQKLI--DYEVLATEMETPALYLLAAKYHVHALSILTVSNH
DEOD_LACC3      AANLADTSAIRYHVGNVLGEDRFYNDEMDRQKLI--DYEVLATEMETPALYLLAAKYHVHALSILTVSNH
DEOD_KLEP3      AVDAAKALGVDARVGNIFSADLFYTPDPSMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_HAEIE      XXXXXXXXXXXXXXXNLFSADLFYTPDVEMF-DVMEKYGILGVEMEAAGIYGVAAEYSAKALTICTVSDH
DEOD_STRTD      AYHIAKNFGMTTHVGNVLSSDVFY---SNYFEKNIEKWGVKAVEMEXXXXXXXXXQHQVDALAIMTISDS
DEOD_STRPF      AYHIAREMGVTTHVGNVLSSDVFY-TNMPERNMVLGKLGVKAIEMEXXXXXXXXXQHHVKALGIMTISDN
DEOD_MYXXD      XXXXXXXXNKPVRAGPVFTSDLFYHP-QEQLNATLARMGVLAVEMEVAGLYGVAAESGARALGLLTVSDH
DEOD_LACLA      AYHIAKDLGITTHVGNILSSDLFY---GGPDXXXXXXXXXXXXEMEAAGLYYLGAKYKVQTLGIMTISDH
DEOD_STRPC      AYHIAREMGVTTHVGNVLSSDVFY-TNMPERNMALGKLGVKAIEMEXXXXXXXXXQHHVKALGIMTISDN
DEOD_STRPB      AYHIAREMGVTTHVGNVLSSDVFY-TNMPERNMALGKLGVKAIEMEXXXXXXXXXQHHVKALGIMTISDN
DEOD_LACLS      AYHIAKDLGITTHVGNILSSDLFY---GGPDXXXXXXXXXXXXEMEAAGLYYLGAKYKVQTLGIMTISDH
DEOD_LACLM      AYHIAKDLGITTHVGNILSSDLFY---GGPDXXXXXXXXXXXXEMEAAGLYYLGAKYKVQTLGIMTISDH
DEOD_STRPG      AYHIAREMGVTTHVGNVLSSDVFY-TNMPERNMALGKLGVKAIEMEAAALYYLATQHHVKALGIMTISDN
DEOD_LACSS      XXXXXXXXXXXVKVGNILSEDRFYNDEIDRQKLI--QYGVLGSXXXXXXXXXXXXKFNVQALAVLTISNH
DEOD_EDWI9      XXXXXXXXXXXXRVGNLFSADLFYSPDPTMF-DVMEKYGILGVEMEAAGIYGVAAEFGVKALTICTVSDH
DEOD_LACRJ      AYHVAGKLGIETKVGDIFAADRFYNDELDMEK--LRDYGILGTEMESAGLYLLAAKLHFRALSVLTVSDL
DEOD_LACRD      AYHVAGKLGIETKVGDIFAADRFYNDELDMEK--LRDYGILGTEMESAGLYLLAAKLHFRALSVLTVSDL
DEOD1_SHEON     CIEVLKTTTVNYKVGNVFSSDLFYRPNENDY-TLMAKYGVLGVEMEVNALYALAAEHQCRALALCTVTDH
DEOD_MYCGE      ---TAIKNKLDFHEGLVFCEDAFYQTRK-DVISLAKEKNSLAVEMEAHXXXXXXXXXXXXXXXXXXXXXX
DEOD3_VIBF1     CVNTLKTTDINYLVGNVFSSDLFYRPDEEQY-DMMARYGILGVEMEVNALYSAAAENHCNAVALCTVTDH
DEOD_TREPA      AVSVADEMGTGVQVGNVISSDVFYDESGS--WRLWARYGVLAVEMETAELYTLAAKFRREALSILTISDH
DEOD_BUCAT      XXXXXXXXXXXXXXGNFFTTDSFY---NDDKKNILKKYNIIGVDMETAGIYGVASELKVQALSICTVSDH
DEOD_BUCAI      XXXXXXXXXXXXXXGNFFTTDSFY---NDDKKNILKKYNIIGVDMETAGIYGVASELKVQALSICTVSDH
DEOD_BUCA5      XXXXXXXXXXXXXXGNFFTTDSFY---NDDKKNILKKYNIIGVDMETAGIYGVASELKVQALSICTVSDH
DEOD_JANSC      AYKAAEGKGSPIHVGGIYSSDVFYDERPDLNEQMV-RHGVLAVEMEAAELYTLAARHKARALAVLTVSDH
DEOD_ACTSZ      XXXXXXXXXXXXHVGNLFSADLFYTPDVEMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALSICTVSDH
DEOD_STRU0      QIADFGLLDIAYHIAKVLSSDVFY-SNMPERNMALGKLGVKAIEMEXXXXXXXXXQHQVKALGIMTISDN
DEOD_KLEPN      RNADAKALGVEARRSNIFSADLFYTPDPSMF-DVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
DEOD_HELAH      AYQTAKRLEIDLKVGNIFTSDFFYSFETHAF-DLLAKYNHLGIEMEAAGLYATAMELSAKALCLCSVSDH
DEOD_STRTR      AYHIAKNFGMTTHVGNVLSSD---EKYSNYFEKNIEKWGVKAVEMEXXXXXXXXXQHQVDALAIMTISDS
DEOD_ROSDO      XXXXGTRTHV----GGIYSSDVFYAERPDLDEQMV-RHGILGVEMEAAELYTLAARHNRRALAILTVSDH
DEOD_HELPJ      AYQTAKRLGIDLKIGNVFSSDFFYSFETHAF-GLMAQYNHLAIEMEAAGLYATAMELNAKALCLCSVSDH
DEOD_HELPY      AYQTAKRLGIDLKVGNVFSSDFFYSFETHAF-DLMAKYNHLAIEMEAAGLYATAMELNAKALCLCSVSDH
DEOD_HELP2      AYQTAKRLGIDLKVGNVFSSDFFYSFETHAF-DLMAQYNHLAIEMEAAGLYATAMELNSKALCLCSVSDH
DEOD_HELPS      AYQTAKRLGIDLKVGNVFSSDFFYSFETHAFDLMV-QYNHLAIEMEAAGLYATAMELNAKALCLCSVSDH
DEOD_HELPG      AYQTAKRLGIDLKIGNVFSSDFFYSFETHAF-DLMAQYNHLAIEMEAAGLYATAMELSAKALCLCSVSDH
DEOD_HELPH      AYQTAKRLGIDLKVGNVFSSDFFYSFETHAF-DLMAQYNHLAIEMEAAGLYATAMELSAKALCLCSVSDH
DEOD_DINSH      XXXXXXXXHV----GGIYSSDVFYDERPDLTEQMI-RHGVLGVEMEAAELYTLAARHGRRALAVLTVSDH
DEOD_BUCBP      LFXXXXXXXXXXXXXXFFTTDLFYVKN-DKLLDTLQRYNILGIDMETAGIYSLASELGIQVASICTVSDH
MTAP_SULSO      LVTSFSKRNLKYYVGNVFSSDAFYAEDEEFVKKWSSRGNI-AVEMECATLFTLSKVKGWKSATVLVVSDN


                         .         .         .         +         .         .         .:280
query           FITGESTTAQQREQSFTNMMEVALGTIKEN
DEOD_CLOB8      FVTGEVTSAEERQLTFTNMMEVALDTI---
DEOD_BACSU      VLTGEETTAEERQTTFHDMIEVALHSVSQ-
DEOD_BACA2      VLTGEETTAEERQTTFHDMIKLALHTV---
DEOD_PSYIN      IRTGEKTTSDERQSSFNEMLIIALDSI---
DEOD_OCEIH      IITGEETTAEERQTTFNDMMEIALDTI---
DEOD_BACLD      VITGEETTAEERQTTFNDMILLALDT----
DEOD2_VIBPA     IIRGEKLSSEERQKSFNDMMKVALET----
DEOD2_VIBVY     IIRGEKLSSEDRQKSFNDMMKVALET----
DEOD2_VIBVU     IIRGEKLSSEDRQKSFNDMMKVALET----
DEOD_ANOFW      ILTGEETTAEERQTTFNEMIEVALET----
DEOD_ALISL      IKRGEKLSSEDRQKSFNDMMTVALET----
DEOD2_VIBCH     ILRGEKLSSEDRQKSFNDMMKVALET----
DEOD_THEPX      LVTGEATTAEERQKTFMNMVKIAL------
DEOD_THEP3      LVTGEATTAEERQKTFMNMVKIAL------
DEOD_BACST      ILTGEETTAEERQTTFNEMIEVALET----
DEOD_ACTPJ      IRTGEQTSSEERQLTFNDMITIALESV---
DEOD_ACTPL      IRTGEQTSSEERQLTFNDMITIALESV---
DEOD_ACTP7      IRTGEQTSSEERQLTFNDMITIALESV---
DEOD_ACTP2      IRTGEQTSSEERQLTFNDMITIALESV---
DEOD_BACCN      IFTGEETTAEERQTTFNEMIEIAL------
DEOD1_PHOPR     ILRGEATTSEERQLTFNEMMEIALESV---
DEOD2_VIBF1     IKRGEKLSSEDRQKSFNDMMTVALET----
DEOD_PSEHT      VITGEATPADERQSTFNEMVKIALESI---
DEOD_COLP3      IKTGEKTTSEERETTFKDMMELTLESV---
DEOD_BACCZ      IFTGEETTSEERQTTFNEMIEIAL------
DEOD1_VIBCH     IKTGEQTTSEERQNTFNEMIEIALDSV---
DEOD_TOLAT      IKTGEQTSADERQNTFDDMMKIALDSV---
DEOD_CLOPS      LITAEETTSEERQTTFTKMMEVAL------
DEOD_CLOP1      LITAEETTSEERQTTFTKMMEVAL------
DEOD_BACWK      IFTGEETTSEERQTTFNEMIEIAL------
DEOD_BACHK      IFTGEETTSEERQTTFNEMIEIAL------
DEOD_BACCR      IFTGEETTSEERQTTFNEMIEIAL------
DEOD_BACCQ      IFTGEETTSEERQTTFNEMIEIAL------
DEOD_BACCE      IFTGEETTSEERQTTFNEMIEIAL------
DEOD_BACC7      IFTGEETTSEERQTTFNEMIEIAL------
DEOD_BACC4      IFTGEETTSEERQTTFNEMIEIAL------
DEOD_BACC3      IFTGEETTSEERQTTFNEMIEIAL------
DEOD_BACC2      IFTGEETTSEERQTTFNEMIEIAL------
DEOD_BACC1      IFTGEETTSEERQTTFNEMIEIAL------
DEOD_BACC0      IFTGEETTSEERQTTFNEMIEIAL------
DEOD_BACAN      IFTGEETTSEERQTTFNEMIEIAL------
DEOD_BACAH      IFTGEETTSEERQTTFNEMIEIAL------
DEOD_BACAC      IFTGEETTSEERQTTFNEMIEIAL------
DEOD_BACAA      IFTGEETTSEERQTTFNEMIEIAL------
DEOD1_VIBPA     IKTGEQTTSDERQTTFNDMMLIALDSV---
DEOD_SHEDO      IRTGEKTTSDERQTTFNDMIIMTL------
DEOD_LISW6      IFTGEETSAEERQTTFNDMIVVAL------
DEOD_LISIN      IFTGEETSAEERQTTFNDMIVVAL------
DEOD_EXIS2      LLTGEETTAEERQTTFNDMMKVALET----
DEOD2_SHEON     IRTGEKTTSEERQTTFNDMIVMTL------
DEOD_LISMO      IFTGEETSAEERQTTFNDMIVVAL------
DEOD_LISMH      IFTGEETSAEERQTTFNDMIVVAL------
DEOD_LISMF      IFTGEETSAEERQTTFNDMIVVAL------
DEOD_LISMC      IFTGEETSAEERQTTFNDMIVVAL------
DEOD_ALKMQ      LITGGQTTSEERQNTFMGMVKIAL------
DEOD_SHESR      IRTGEKTTSDERQTTFNDMIVMTL------
DEOD_SHESM      IRTGEKTTSDERQTTFNDMIVMTL------
DEOD_HAEPS      IRTHEQTTAEERQLTFNDMIEIALESV---
DEOD_BREBN      ILTGEETSADERQSTFNEMIEVAL------
DEOD1_VIBVY     IKTGEQTTSEERQNTFNDMMIVALDSV---
DEOD1_VIBVU     IKTGEQTTSEERQNTFNDMMIVALDSV---
DEOD_SHEFN      IRTGEKTTSDERQTTFSDMIIMTL------
DEOD_SHEAM      IRTGEKTTSDERQTTFNDMIIMTL------
DEOD_HAHCH      LLSGERLSPEERRTSFNDMVEIAL------
DEOD_CLOTE      FVTHEVTSAEERQTTFKAMMEVALDTI---
DEOD_PECCP      IRTGAQTTSEERQNTFNEMIEIALESV---
DEOD_XENNE      IRTGEQTTAEERQHTFNDMIEIALESI---
DEOD_MANSM      IRTGEQTSSEERQLTFNDMIEIALESV---
DEOD_SHELP      IRTGEKTSSDERQTTFNEMIEMTL------
DEOD_HAEDU      IRSGEKLSAEDRQLTFNEMIEIALESV---
DEOD_YERE8      IVSGEQTTAAERQTTFNDMIEIALESV---
DEOD_SHEB2      IRTGEKTSAEERQTTFNDMIIMTL------
DEOD_THETN      LVTGEATSAEERQKTFMDMVKIAL------
DEOD_SHEB8      IRTGEKTSAEERQTTFNDMIIMTL------
DEOD_SHEB5      IRTGEKTSAEERQTTFNDMIIMTL------
DEOD_ERWT9      IRTHEQTTAAERQTTFSEMIEIALESV---
DEOD1_VIBF1     IKTGEQTTSDERATTFDEMMLIALDSV---
DEOD_YERPY      IRTGEQTTAAERQTTFNDMIEIALESV---
DEOD_YERPS      IRTGEQTTAAERQTTFNDMIEIALESV---
DEOD_YERPP      IRTGEQTTAAERQTTFNDMIEIALESV---
DEOD_YERPN      IRTGEQTTAAERQTTFNDMIEIALESV---
DEOD_YERPG      IRTGEQTTAAERQTTFNDMIEIALESV---
DEOD_YERPE      IRTGEQTTAAERQTTFNDMIEIALESV---
DEOD_YERPB      IRTGEQTTAAERQTTFNDMIEIALESV---
DEOD_YERPA      IRTGEQTTAAERQTTFNDMIEIALESV---
DEOD_YERP3      IRTGEQTTAAERQTTFNDMIEIALESV---
DEOD_GEOSW      ILTGEETTAQERQTTFNEMIEVALET----
DEOD3_SHEON     CLTGEETTAQERQLSFNNMIELALE