[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD31211.1

[Show Plain Result]


## Summary of Sequence Search
    1::412
   43::330     1e-28  25%  382 aa  YCAD_ESCF3 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     1e-27  24%  382 aa  YCAD_ECOLU RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     2e-27  24%  382 aa  YCAD_ECO7I RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     3e-27  24%  382 aa  YCAD_SHIDS RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     3e-27  24%  382 aa  YCAD_ECOSM RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     3e-27  24%  382 aa  YCAD_ECOLI RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     3e-27  24%  382 aa  YCAD_ECOLC RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     3e-27  24%  382 aa  YCAD_ECOL5 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     3e-27  24%  382 aa  YCAD_ECOHS RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     3e-27  24%  382 aa  YCAD_ECODH RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     3e-27  24%  382 aa  YCAD_ECOBW RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     3e-27  24%  382 aa  YCAD_ECO5E RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     3e-27  24%  382 aa  YCAD_ECO57 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     3e-27  24%  382 aa  YCAD_ECO55 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     3e-27  24%  382 aa  YCAD_ECO27 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     3e-27  24%  382 aa  YCAD_SHISS RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     3e-27  24%  382 aa  YCAD_SHIFL RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     3e-27  24%  382 aa  YCAD_SHIF8 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     3e-27  24%  382 aa  YCAD_ECOSE RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     3e-27  24%  382 aa  YCAD_ECO8A RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     3e-27  24%  382 aa  YCAD_ECO24 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   43::330     6e-27  25%  382 aa  YCAD_SALTY RecName: Full=Uncharacterized MFS-type transporter ycaD;
   43::330     6e-27  25%  382 aa  YCAD_SALTI RecName: Full=Uncharacterized MFS-type transporter ycaD;
   43::330     6e-27  25%  382 aa  YCAD_SALSV RecName: Full=Uncharacterized MFS-type transporter ycaD;
   43::330     6e-27  25%  382 aa  YCAD_SALPK RecName: Full=Uncharacterized MFS-type transporter ycaD;
   43::330     6e-27  25%  382 aa  YCAD_SALPC RecName: Full=Uncharacterized MFS-type transporter ycaD;
   43::330     6e-27  25%  382 aa  YCAD_SALPA RecName: Full=Uncharacterized MFS-type transporter ycaD;
   43::330     6e-27  25%  382 aa  YCAD_SALNS RecName: Full=Uncharacterized MFS-type transporter ycaD;
   43::330     6e-27  25%  382 aa  YCAD_SALHS RecName: Full=Uncharacterized MFS-type transporter ycaD;
   43::330     6e-27  25%  382 aa  YCAD_SALCH RecName: Full=Uncharacterized MFS-type transporter ycaD;
   43::330     6e-27  25%  382 aa  YCAD_SALA4 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     6e-27  24%  382 aa  YCAD_ECOUT RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     6e-27  24%  382 aa  YCAD_ECOL6 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     6e-27  24%  382 aa  YCAD_ECOK1 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     6e-27  24%  382 aa  YCAD_ECO81 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   39::330     6e-27  24%  382 aa  YCAD_ECO45 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   43::330     2e-26  25%  382 aa  YCAD_SALEP RecName: Full=Uncharacterized MFS-type transporter ycaD;
   43::330     2e-26  25%  382 aa  YCAD_SALDC RecName: Full=Uncharacterized MFS-type transporter ycaD;
   43::330     2e-26  25%  382 aa  YCAD_SALAR RecName: Full=Uncharacterized MFS-type transporter ycaD;
   43::330     2e-26  25%  382 aa  YCAD_SALPB RecName: Full=Uncharacterized MFS-type transporter ycaD;
   43::330     3e-26  25%  382 aa  YCAD_SALG2 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   43::330     1e-24  23%  382 aa  Y2171_CITK8 RecName: Full=Uncharacterized MFS-type transporter
   43::330     4e-23  24%  382 aa  Y1421_ENT38 RecName: Full=Uncharacterized MFS-type transporter
   43::332     2e-17  21%  382 aa  Y2680_YERPY RecName: Full=Uncharacterized MFS-type transporter
   43::332     2e-17  21%  382 aa  Y2592_YERP3 RecName: Full=Uncharacterized MFS-type transporter
   43::332     2e-17  21%  382 aa  Y2315_YERPP RecName: Full=Uncharacterized MFS-type transporter
   43::332     2e-17  21%  382 aa  Y1506_YERPB RecName: Full=Uncharacterized MFS-type transporter
   43::332     2e-17  21%  382 aa  Y1405_YERPS RecName: Full=Uncharacterized MFS-type transporter
   43::332     2e-17  21%  382 aa  Y1380_YERPE RecName: Full=Uncharacterized MFS-type transporter
   43::330     7e-15  22%  382 aa  Y1530_YERE8 RecName: Full=Uncharacterized MFS-type transporter
   10::319     1e-14  24%  391 aa  YFKF_BACSU RecName: Full=Uncharacterized MFS-type transporter yfkF;
   23::171     7e-07  27%  390 aa  Y466_BUCAI RecName: Full=Uncharacterized transporter BU466;
   68::143     3e-05  32%  451 aa  YYAJ_BACSU RecName: Full=Putative metabolite transport protein
   83::225     3e-05  23%  557 aa  ITR2_SCHPO RecName: Full=Myo-inositol transporter 2;
   16::364     1e-04  23%  458 aa  TCR_STRAG RecName: Full=Tetracycline resistance protein;
   16::364     2e-04  23%  458 aa  TCR_STRPN RecName: Full=Tetracycline resistance protein;
   16::364     2e-04  23%  458 aa  TCR_BACSU RecName: Full=Tetracycline resistance protein;
   16::364     2e-04  23%  458 aa  TCR_BACCE RecName: Full=Tetracycline resistance protein;
   16::364     3e-04  23%  458 aa  TCR_BACST RecName: Full=Tetracycline resistance protein;
  208::364     4e-04  23%  458 aa  TCR_STAHY RecName: Full=Tetracycline resistance protein;
   75::219     4e-04  23%  569 aa  STL1_YEAST RecName: Full=Sugar transporter STL1;
  115::268     7e-04  26%  529 aa  TH2A_TRYBB RecName: Full=Glucose transporter 2A;
  115::268     7e-04  26%  337 aa  TH23_TRYBB RecName: Full=Glucose transporter 2C;Flags: Fragment;
    1::412

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxIITPIIAMCVLSFGNGFFTTYSSIELNDLGRSSLMIGIISAAYFFGMTAGSYFSQFTIIRV
YCAD_ESCF3      --------------------------------------------VGMVSSSYFTGNLVGTLLTGYLIKRL
YCAD_ECOLU      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_ECO7I      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_SHIDS      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_ECOSM      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_ECOLI      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_ECOLC      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_ECOL5      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_ECOHS      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_ECODH      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_ECOBW      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_ECO5E      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_ECO57      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_ECO55      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_ECO27      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_SHISS      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_SHIFL      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_SHIF8      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_ECOSE      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_ECO8A      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_ECO24      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_SALTY      --------------------------------------------VGMVSSSYFTGNLVGTLFTGYLIKRI
YCAD_SALTI      --------------------------------------------VGMVSSSYFTGNLVGTLFTGYLIKRI
YCAD_SALSV      --------------------------------------------VGMVSSSYFTGNLVGTLFTGYLIKRI
YCAD_SALPK      --------------------------------------------VGMVSSSYFTGNLVGTLFTGYLIKRI
YCAD_SALPC      --------------------------------------------VGMVSSSYFTGNLVGTLFTGYLIKRI
YCAD_SALPA      --------------------------------------------VGMVSSSYFTGNLVGTLFTGYLIKRI
YCAD_SALNS      --------------------------------------------VGMVSSSYFTGNLVGTLFTGYLIKRI
YCAD_SALHS      --------------------------------------------VGMVSSSYFTGNLVGTLFTGYLIKRI
YCAD_SALCH      --------------------------------------------VGMVSSSYFTGNLVGTLFTGYLIKRI
YCAD_SALA4      --------------------------------------------VGMVSSSYFTGNLVGTLFTGYLIKRI
YCAD_ECOUT      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_ECOL6      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_ECOK1      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_ECO81      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_ECO45      ----------------------------------------STWQVGVVSSSYFTGNLVGTLLTGYVIKRI
YCAD_SALEP      --------------------------------------------VGMVSSSYFTGNLVGTLFTGYLIKRI
YCAD_SALDC      --------------------------------------------VGMVSSSYFTGNLVGTLFTGYLIKRI
YCAD_SALAR      --------------------------------------------VGMVSSSYFTGNLVGTLFTGYLIKRI
YCAD_SALPB      --------------------------------------------VGMVSSSYFTGNLVGTLFTGYLIKRI
YCAD_SALG2      --------------------------------------------VGMVSSSYFTGNLVGTLFTGYLIKRI
Y2171_CITK8     --------------------------------------------VGMVSSSYFTGNLVGTLLTGYLIKRL
Y1421_ENT38     --------------------------------------------VGMVSSSYFXXXXXXXXXXXXXIKRF
Y2680_YERPY     --------------------------------------------VGMVSSSYFTGNLVGTLIAGRFIQQL
Y2592_YERP3     --------------------------------------------VGMVSSSYFTGNLVGTLIAGRFIQQL
Y2315_YERPP     --------------------------------------------VGMVSSSYFTGNLVGTLIAGRFIQQL
Y1506_YERPB     --------------------------------------------VGMVSSSYFTGNLVGTLIAGRFIQQL
Y1405_YERPS     --------------------------------------------VGMVSSSYFTGNLVGTLIAGRFIQQL
Y1380_YERPE     --------------------------------------------VGMVSSSYFTGNLVGTLIAGRFIQQL
Y1530_YERE8     --------------------------------------------VGMVSSSYFSGNLVGTLIAGRIIQQL
YFKF_BACSU      -------------VLLVSISGFSQGMLLPVISIIFETNGESAAINGLHATGLYIGVLLASPFMEAPLRKL
Y466_BUCAI      ----------------------------------------------------------------------
YYAJ_BACSU      --------------------------------------------IANVTAASFLGMFLGASLGGRLSDRI
ITR2_SCHPO      ---------VLSAVAGISGLLFGTGVISGALAVLGSDLGHSSGQKELITSATSFAALISATTSGWLADWV
TCR_STRAG       -------------LIWLCILSFFSVLNEMVLNVSLNDFNKPPASTNWVNTAFMLTFSIGTAVYGKLSDQL
TCR_STRPN       -------------LIWLCILSFFSVLNEMVLNVSLNDFNKPPASTNWVNTAFMLTFSIGTAVYGKLSDQL
TCR_BACSU       -------------LIWLCILSFFSVLNEMVLNVSLNDFNKPPASTNWVNTAFMLTFSIGTAVYGKLSDQL
TCR_BACCE       -------------LIWLCILSFFSVLNEMVLNVSLNDFNKPPASTNWVNTAFMLTFSIGTAVYGKLSDQL
TCR_BACST       -------------LIWLCILSFFSVLNEMVLNVSLNDFNKPPASTNWVNTAFMLTFSIGTAVYGKLSDQL
TCR_STAHY       ----------------------------------------------------------------------
STL1_YEAST      ----------------------------------------ATVVQGATTSCYELGCFAGSLFVMFCGERI
TH2A_TRYBB      -------------------------------------IGYSSLYSGIFASAMIVGSMVGSIIAGKCITMF
TH23_TRYBB      -------------------------------------IGYSSLYSGIFASAMIVGSMVGSIIAGKCITMF


                         .         .         *         .         .         .         .:140
query           GYIRAFVLFASLMAISTLIVGANKSVAVWILFRFLCGYSLAALFIIIESWCILSSDKKNRGLIFSIYLFV
YCAD_ESCF3      GFNRSYYLASLVFAAGCLGLGLMIGFWSWMAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMI
YCAD_ECOLU      GFNRSYYLASFIFAAGCAGLGLMIGFWSWLTWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_ECO7I      GFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_SHIDS      GFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_ECOSM      GFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_ECOLI      GFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_ECOLC      GFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_ECOL5      GFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_ECOHS      GFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_ECODH      GFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_ECOBW      GFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_ECO5E      GFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_ECO57      GFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_ECO55      GFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_ECO27      GFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_SHISS      GFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_SHIFL      GFNRSYYLSSFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_SHIF8      GFNRSYYLSSFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_ECOSE      GFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_ECO8A      GFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_ECO24      GFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_SALTY      GFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMV
YCAD_SALTI      GFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMV
YCAD_SALSV      GFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMV
YCAD_SALPK      GFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMV
YCAD_SALPC      GFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMV
YCAD_SALPA      GFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMV
YCAD_SALNS      GFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMV
YCAD_SALHS      GFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMV
YCAD_SALCH      GFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMV
YCAD_SALA4      GFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMV
YCAD_ECOUT      GFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_ECOL6      GFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_ECOK1      GFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_ECO81      GFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_ECO45      GFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
YCAD_SALEP      GFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMA
YCAD_SALDC      GFNRSYYLASLIFAAGCVGLGGMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMA
YCAD_SALAR      GFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMV
YCAD_SALPB      GFNHSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMV
YCAD_SALG2      GFNRSYYLASLIFAAGCVGLGGMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMA
Y2171_CITK8     GFNRSYYIASLIFAAGCVGLGMMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
Y1421_ENT38     GFNRSYYLASLIFAAGCVGLGLMVGFWSWMTWRFIAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMV
Y2680_YERPY     GFNRSYHCSCILFALATCGLMLTVDFWSWLGWRFLAGIACALIWVIVESALLRSGTLTNRGQLLAAYMMV
Y2592_YERP3     GFNRSYHCSCILFALATCGLMLTVDFWSWLGWRFLAGIACALIWVIVESALLRSGTLTNRGQLLAAYMMV
Y2315_YERPP     GFNRSYHCSCILFALATCGLMLTVDFWSWLGWRFLAGIACALIWVIVESALLRSGTLTNRGQLLAAYMMV
Y1506_YERPB     GFNRSYHCSCILFALATCGLMLTVDFWSWLGWRFLAGIACALIWVIVESALLRSGTLTNRGQLLAAYMMV
Y1405_YERPS     GFNRSYHCSCILFALATCGLMLTVDFWSWLGWRFLAGIACALIWVIVESALLRSGTLTNRGQLLAAYMMV
Y1380_YERPE     GFNRSYHCSCILFALATCGLMLTVDFWSWLGWRFLAGIACALIWVIVESALLRSGTLTNRGQLLAAYMMV
Y1530_YERE8     GFNRSYHYSCILFALATCGLMLSVDFWSWLGWRFFAGVACALIWVIVESALLRSGTVTNRGQLLAAYMMV
YFKF_BACSU      GFKPLIVMGGSIVILSLFGFIWLQSVWVWFLLRLFIGIGDHMLHFSTQTWVTSMSSKQNRGRNLSIYGLS
Y466_BUCAI      ----------------------------------------------------------------------
YYAJ_BACSU      GRKKALNLFVFVFSIASLCNAAAWDIPSLMTFRFLTGFGVAAAMVITNSY--------------------
ITR2_SCHPO      GRKRLLLCADAIFVIGSVIMAASRNVAMMVVGRFIVGYGIGLTSLIVPMYITELAPARLRGRLVIIYVVF
TCR_STRAG       G-IKRLLLFGIIINCFGSVIGGHSFFSLLIMARFIQGAGAAAFPALVMVVVARYIPKENRGKAFGIAHYI
TCR_STRPN       G-IKRLLLFGIIINCFGSVIGGHSFFSLLIMARFIQGAGAAAFPALVMVVVARYIPKENRGKAFGIAHYI
TCR_BACSU       G-IKRLLLFGIIINCFGSVIGGHSFFSLLIMARFIQGAGAAAFPALVMVVVARYIPKENRGKAFGIAHYI
TCR_BACCE       G-IKRLLLFGIIINCFGSVIGGHSFFSLLIMARFIQGAGAAAFPALVMVVVARYIPKENRGKAFGIAHYI
TCR_BACST       G-IKRLLLFGIIINCFGSVIGGHSFFSLLIMARFIQGAGAAAFPALVMVVVARYIPKENRGKAFGIAHYI
TCR_STAHY       ----------------------------------------------------------------------
STL1_YEAST      GR-KPLILMGSVITIIGAVISTCAFRGYWALGQFIIGRXXXXXXXXLNTWQSEMSKAENRGLLVNLESTI
TH2A_TRYBB      GLKKSFIIVGVMSVVASALVATNE---FWVLCRVLMGIGLGVVCVICPMYVNENAHSKVDGVLFQVFITF
TH23_TRYBB      GLKKSFIIVGVMSVVASALVATNE---FWVLCRVLMGIGLGVVCVICPMYVNENAHSKVDGVLFQVFITF


                         +         .         .         .         .         *         .:210
query           YYGTQALSQLMINVHFSNGLLAYCFISSLCSIAIVLMAFTKTVAPVPHSEEIYSPAKIIKKVPLAMVASV
YCAD_ESCF3      YYVGTFLGQLLVSKVSTELMNVLPWVTALILAGILPLLFTRILSQQTESRKTTSITSMLKQARLGVNGCI
YCAD_ECOLU      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKQARLGVNGCI
YCAD_ECO7I      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRVLNQQAENHDATSITSMLKQARLGVNGCI
YCAD_SHIDS      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKQARLGVNGCI
YCAD_ECOSM      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKQARLGVNGCI
YCAD_ECOLI      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKQARLGVNGCI
YCAD_ECOLC      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKQARLGVNGCI
YCAD_ECOL5      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRVLNQQTENHDSTSITSMLKQARLGVNGCI
YCAD_ECOHS      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKQARLGVNGCI
YCAD_ECODH      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKQARLGVNGCI
YCAD_ECOBW      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKQARLGVNGCI
YCAD_ECO5E      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKQARLGVNGCI
YCAD_ECO57      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKQARLGVNGCI
YCAD_ECO55      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKQARLGVNGCI
YCAD_ECO27      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKQARLGVNGCI
YCAD_SHISS      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITAMLKQARLGVNGCI
YCAD_SHIFL      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITAMLKQARLGVNGCI
YCAD_SHIF8      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITAMLKQARLGVNGCI
YCAD_ECOSE      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITAMLKQARLGVNGCI
YCAD_ECO8A      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITAMLKQARLGVNGCI
YCAD_ECO24      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITAMLKQARLGVNGCI
YCAD_SALTY      YYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFTRIVTQARHSSSISAMLK-LRQARLGVNGCI
YCAD_SALTI      YYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFTRIVTQARHSSSISAMLK-LRQARLGVNGCI
YCAD_SALSV      YYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFTRIVTQARHSSSISAMLK-LRQARLGVNGCI
YCAD_SALPK      YYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFTRIVTQTRHSSSISAMLK-LRQARLGVNGCI
YCAD_SALPC      YYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFTRIVTQTRHSSSISAMLK-LRQARLGVNGCI
YCAD_SALPA      YYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFTRIVTQTRHSSSISAMLK-LRQARLGVNGCI
YCAD_SALNS      YYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFTRIVTQARHSSSISAMLK-LRQARLGVNGCI
YCAD_SALHS      YYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFTRIVTQTRHSSSISAMLK-LRQARLGVNGCI
YCAD_SALCH      YYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFTRIVTQTRHSSSISAMLK-LRQARLGVNGCI
YCAD_SALA4      YYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFTRIVTQTRHSSSISAMLK-LRQARLGVNGCI
YCAD_ECOUT      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTHVLNQQAENHDSTSITSMLKQARLGVNGCI
YCAD_ECOL6      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTHVLNQQAENHDSTSITSMLKQARLGVNGCI
YCAD_ECOK1      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTHVLNQQAENHDSTSITSMLKQARLGVNGCI
YCAD_ECO81      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTHVLNQQAENHDSTSITSMLKQARLGVNGCI
YCAD_ECO45      YYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTHVLNQQAENHDSTSITSMLKQARLGVNGCI
YCAD_SALEP      YYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFTRIVTQARHSSSISAMLK-LRQARLGVNGCI
YCAD_SALDC      YYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFTRIVTQARHSSSISAMLK-LRQARLGVNGCI
YCAD_SALAR      YYVGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFTRIVTEARYSTSISAMLK-LRQARLGVNGCI
YCAD_SALPB      YYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFTRIVTQARHSSSISAMLK-LRQARLGVNGCI
YCAD_SALG2      YYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFTRIVTQARHSSSISAMLK-LRQARLGVNGCI
Y2171_CITK8     YYVGTFLGQLLVSKVPTELMSVLPWVTGMILAGILPLLFTRILQSEEHDTTPITSMLRLRQARLGVNGCI
Y1421_ENT38     YYVGTVLGQLMISKLPTDLMSVLPWVTGMVLAAILPLLFTRIVGSEHHEATQVWPMLRLRHARLGVNGCI
Y2680_YERPY     YYLGTVIGQLLLGIVSTQLLSVIPWVGALVITAMLPLLFAQFSHQSRHESPPIAVWPMLKRARLGINGCI
Y2592_YERP3     YYLGTVIGQLLLGIVSTQLLSVIPWVGALVITAMLPLLFAQFSHQSRHESPPIAVWPMLKRARLGINGCI
Y2315_YERPP     YYLGTVIGQLLLGIVSTQLLSVIPWVGALVITAMLPLLFAQFSHQSRHESPPIAVWPMLKRARLGINGCI
Y1506_YERPB     YYLGTVIGQLLLGIVSTQLLSVIPWVGALVITAMLPLLFAQFSHQSRHESPPIAVWPMLKRARLGINGCI
Y1405_YERPS     YYLGTVIGQLLLGIVSTQLLSVIPWVGALVITAMLPLLFAQFSHQSRHESPPIAVWPMLKRARLGINGCI
Y1380_YERPE     YYLGTVIGQLLLGIVSTQLLSVIPWVGALVITAMLPLLFAQFSHQSRHESPPIAVWPMLKRARLGINGCI
Y1530_YERE8     YYXXXXXXXXXXXXXXXQLLSVIPWVSALVITAMLPLLFAQDSGDVPHI--AVWPMLKRRSARLGINGCI
YFKF_BACSU      FGLGFAAGPFMVPLVKLSPSLPFIVSGCISLFAWLFVFFLQNAYPSPHETKSDNSFRRFYQAMLAFMPTF
Y466_BUCAI      ----------------------------------------------------------------------
YYAJ_BACSU      ----------------------------------------------------------------------
ITR2_SCHPO      ITGGQLIA--------------------------------------------------------------
TCR_STRAG       HWSYLLLKEVRIKGHFSVGIVFFMLFTTSYSISFLIVSVLSFLIFVKHIRKVTDPFVDLGKNILFMIGVL
TCR_STRPN       HWSYLLLKEVRIKGHFSVGIVFFMLFTTSYSISFLIVSVLSFLIFVKHIRKVTDPPGLGKNIPF-MIGVL
TCR_BACSU       HWSYLLLKEVRIKGHFSVGIVFFMLFTTSYSISFLIVSVLSFLIFVKHIRKVTDPPGLGKNIPF-MIGVL
TCR_BACCE       HWSYLLLKEVRIKGHFSVGIVFFMLFTTSYSISFLIVSVLSFLIFVKHIRKVTDPPGLGKNIPF-MIGVL
TCR_BACST       HWSYLLLKEVRIKGHFSVGIVFFMLFTTSYSISFLIVSVLSFLIFVKHIRKVTDPPGLGKNIPF-MIGVL
TCR_STAHY       ----------------SVGIVFFMLFTTSYSISFLIVSVLSFLIFVKHIRKVTDPPGLGKNIPF-MIGVL
STL1_YEAST      AFGTMIAYWIDFGLSYTNSSVQWRFVSMQIVFALFLLAF-------------------------------
TH2A_TRYBB      GIMLAAMLGLILDVNYDNDFHGFCAVSSVLSVAMFLV---------------------------------
TH23_TRYBB      GIMLAAMLGLILDVNYDNDFHGFCAVSSVLSVAMFLV---------------------------------


                         .         .         .         +         .         .         .:280
query           IGGSLLGSIYTLLPIFLVRVGSDHDMISVXXXXXXXXXXXXQVPIGKLSDLIDRRKVIFLAGAGIFITSI
YCAD_ESCF3      ISGIVLGSLYGLMPLYLNHQGISNSNIGFWMAVLVSAGIVGQWPIGRLADKFGRLLVLRVQIFVVILGSI
YCAD_ECOLU      ISGIVLGSLYGLMPLFLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_ECO7I      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_SHIDS      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_ECOSM      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_ECOLI      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_ECOLC      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_ECOL5      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_ECOHS      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_ECODH      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_ECOBW      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_ECO5E      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_ECO57      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_ECO55      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_ECO27      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_SHISS      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_SHIFL      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_SHIF8      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_ECOSE      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_ECO8A      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_ECO24      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_SALTY      ISGIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_SALTI      ISGIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_SALSV      ISGIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_SALPK      ISGIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_SALPC      ISGIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_SALPA      ISGIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_SALNS      ISGIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_SALHS      ISGIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_SALCH      ISGIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_SALA4      ISGIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_ECOUT      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_ECOL6      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_ECOK1      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_ECO81      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_ECO45      ISGIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_SALEP      ISGIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_SALDC      ISGIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_SALAR      ISGIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPVGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_SALPB      ISGIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGRXXXXXXXXXXXXXGSI
YCAD_SALG2      ISGIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGRXXXXXXXXXXXXXGSI
Y2171_CITK8     ISGIVLGSLYGLMPLYLNHQGISNASIGFWMAVLVSAGILGQWPIGRLADKFGRXXXXXXXXXXXXXGSI
Y1421_ENT38     ISGIVLGSLYGLMPLYLNHQGVSDSGIGFWMAVMVSAGIVGQWPIGKLADRYGRXXXXXXXXXXXXXGCL
Y2680_YERPY     ISGVXXXXXXXXXXXXXXHKGMSDASVGGRMALLVSSGIIGQWPMGRMADRYGRLLVLRIQVFVVILGSV
Y2592_YERP3     ISGVXXXXXXXXXXXXXXHKGMSDASVGGWMALLVSSGIIGQWPMGRMADRYGRLLVLRIQVFVVILGSV
Y2315_YERPP     ISGVXXXXXXXXXXXXXXHKGMSDASVGGWMALLVSSGIIGQWPMGRMADRYGRLLVLRIQVFVVILGSV
Y1506_YERPB     ISGVXXXXXXXXXXXXXXHKGMSDASVGGWMALLVSSGIIGQWPMGRMADRYGRLLVLRIQVFVVILGSV
Y1405_YERPS     ISGVXXXXXXXXXXXXXXHKGMSDASVGGWMALLVSSGIIGQWPMGRMADRYGRLLVLRIQVFVVILGSV
Y1380_YERPE     ISGVXXXXXXXXXXXXXXHKGMSDASVGGWMALLVSSGIIGQWPMGRMADRYGRLLVLRIQVFVVILGSV
Y1530_YERE8     ISGVXXXXXXXXXXXXXXHQGMSDASVGWWMALLVSSGIIGQWPIGKMADRYGRLLVLRIQVFVVILGSI
YFKF_BACSU      GYGFLETALNGSFPVYALRLGISVDAVAIILPAFAIGSIIFQFPLGILSDKYGRRNVILLTGALCF----
Y466_BUCAI      --------MFMILPILMLLDGGNKFLIGLSMGIYGISQVIFQIPFGILSDKFNRKKIILLGLFMFFIGNI
YYAJ_BACSU      ----------------------------------------------------------------------
ITR2_SCHPO      ----------------------------------------------------------------------
TCR_STRAG       CGGIIFGTVAGFVSMVPYMMKDVHQLSTAEIGSVIIFPGTMSVIIGYIGGLVDRRGPLYVLNIGVFLSVS
TCR_STRPN       CGGIIFGTVAGFVSMVPYMMKDVHQLSTAEIGSVIIFPGTMSVIIGYIGGLVDRRGPLYVLNIGVFLTAS
TCR_BACSU       CGGIIFGTVAGFVSMVPYMMKDVHQLSTAEIGSVIIFPGTMSVIIGYIGGLVDRRGPLYVLNIGVFLTAS
TCR_BACCE       CGGIIFGTVAGFVSMVPYMMKDVHQLSTAEIGSVIIFPGTMSVIIGYIGGLVDRRGPLYVLNIGVFLTAS
TCR_BACST       CGGIIFGTVAGFVSMVPYMMKDVHQLSTAEIGSVIIFPGTMSVIIGYIGGLVDRRGPLYVLNIGVFLTAS
TCR_STAHY       CGGIIFGTVAGFVSMVPYMMKDVHQLSTAEIGSVIIFPGTMSVIIGYIGGLVDRRVPLYALNIGVFLTAS
STL1_YEAST      ----------------------------------------------------------------------
TH2A_TRYBB      ----------------------------------------------------------------------
TH23_TRYBB      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           FIFAFHTSYFLFAIIMFIFGGSAFVIYPLSISHASDFLNENEILGAIGVLTIAYGLXXXXXXXXXXXXXX
YCAD_ESCF3      AMLT-HTA---MAPALFILGAAGFTLYPVAMAWSCEKVSQDQLVAMNQALLLSY----------------
YCAD_ECOLU      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_ECO7I      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_SHIDS      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_ECOSM      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_ECOLI      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_ECOLC      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_ECOL5      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_ECOHS      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_ECODH      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_ECOBW      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_ECO5E      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_ECO57      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_ECO55      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_ECO27      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_SHISS      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_SHIFL      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_SHIF8      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_ECOSE      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_ECO8A      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_ECO24      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_SALTY      AML----TQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_SALTI      AML----TQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_SALSV      AML----TQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_SALPK      AML----TQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_SALPC      AML----TQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_SALPA      AML----TQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_SALNS      AML----TQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_SALHS      AML----TQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_SALCH      AML----TQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_SALA4      AML----TQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_ECOUT      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_ECOL6      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_ECOK1      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_ECO81      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_ECO45      AML----SQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_SALEP      AML----TQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_SALDC      AML----TQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_SALAR      VML----TQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_SALPB      AML----TQAAMAPALFILGAAGFTLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
YCAD_SALG2      AML----TQAAMAPALFILGAAGFKLYPVAMAWACEKVEHHQLVAMNQALLLSY----------------
Y2171_CITK8     AML----TQAAMAPALFILGAAGFTLYPVAMAWACEKVERHQLVAMNQALLLSY----------------
Y1421_ENT38     AML----GNAAMAPALFILGAAGFTLYPVAMAWACEKVENHQLVAMNQALLLSY----------------
Y2680_YERPY     AIL----GNYAMAPALFILGCAGFTLYPVAMAWACEKASADELVAMNQALLMSYTL--------------
Y2592_YERP3     AIL----GNYAMAPALFILGCAGFTLYPVAMAWACEKASADELVAMNQALLMSYTL--------------
Y2315_YERPP     AIL----GNYAMAPALFILGCAGFTLYPVAMAWACEKASADELVAMNQALLMSYTL--------------
Y1506_YERPB     AIL----GNYAMAPALFILGCAGFTLYPVAMAWACEKASADELVAMNQALLMSYTL--------------
Y1405_YERPS     AIL----GNYAMAPALFILGCAGFTLYPVAMAWACEKASADELVAMNQALLMSYTL--------------
Y1380_YERPE     AIL----GNYAMAPALFILGCAGFTLYPVAMAWACEKASADELVAMNQALLMSYTL--------------
Y1530_YERE8     AIL----GNYALAPALFILGCAGFTLYPVAMAWACEKVSADKLVAMNQALLMSY----------------
YFKF_BACSU      FIAGVFPSPYVIGGCFFIAGMAVGSTFTLGISYMTDLL--------------------------------
Y466_BUCAI      ISASIHSIWGL--IIGRFFQGSG-AISGVCMAFLSDLIREENRVKSIAAIGVSFAISFLIAVVSGPIIVH
YYAJ_BACSU      ----------------------------------------------------------------------
ITR2_SCHPO      ----------------------------------------------------------------------
TCR_STRAG       FLTAFFTSWFMTIIIVFVLGGLSF----------------------------------------------
TCR_STRPN       FLLET-TSWFMTIIIVFVLGGLSF----------------------------------------------
TCR_BACSU       FLLET-TSWFMTIIIVFVLGGLSF----------------------------------------------
TCR_BACCE       FLLET-TSWFMTIIIVFVLGGLSF----------------------------------------------
TCR_BACST       FLLET-TSWFMTIIIVFVLGGLLF----------------------------------------------
TCR_STAHY       FLLET-TSWFMTIIIVFVLGGLSF----------------------------------------------
STL1_YEAST      ----------------------------------------------------------------------
TH2A_TRYBB      ----------------------------------------------------------------------
TH23_TRYBB      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           XFGPFGFFIITALLSIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YCAD_ESCF3      --------------------------------------------------------------
YCAD_ECOLU      --------------------------------------------------------------
YCAD_ECO7I      --------------------------------------------------------------
YCAD_SHIDS      --------------------------------------------------------------
YCAD_ECOSM      --------------------------------------------------------------
YCAD_ECOLI      --------------------------------------------------------------
YCAD_ECOLC      --------------------------------------------------------------
YCAD_ECOL5      --------------------------------------------------------------
YCAD_ECOHS      --------------------------------------------------------------
YCAD_ECODH      --------------------------------------------------------------
YCAD_ECOBW      --------------------------------------------------------------
YCAD_ECO5E      --------------------------------------------------------------
YCAD_ECO57      --------------------------------------------------------------
YCAD_ECO55      --------------------------------------------------------------
YCAD_ECO27      --------------------------------------------------------------
YCAD_SHISS      --------------------------------------------------------------
YCAD_SHIFL      --------------------------------------------------------------
YCAD_SHIF8      --------------------------------------------------------------
YCAD_ECOSE      --------------------------------------------------------------
YCAD_ECO8A      --------------------------------------------------------------
YCAD_ECO24      --------------------------------------------------------------
YCAD_SALTY      --------------------------------------------------------------
YCAD_SALTI      --------------------------------------------------------------
YCAD_SALSV      --------------------------------------------------------------
YCAD_SALPK      --------------------------------------------------------------
YCAD_SALPC      --------------------------------------------------------------
YCAD_SALPA      --------------------------------------------------------------
YCAD_SALNS      --------------------------------------------------------------
YCAD_SALHS      --------------------------------------------------------------
YCAD_SALCH      --------------------------------------------------------------
YCAD_SALA4      --------------------------------------------------------------
YCAD_ECOUT      --------------------------------------------------------------
YCAD_ECOL6      --------------------------------------------------------------
YCAD_ECOK1      --------------------------------------------------------------
YCAD_ECO81      --------------------------------------------------------------
YCAD_ECO45      --------------------------------------------------------------
YCAD_SALEP      --------------------------------------------------------------
YCAD_SALDC      --------------------------------------------------------------
YCAD_SALAR      --------------------------------------------------------------
YCAD_SALPB      --------------------------------------------------------------
YCAD_SALG2      --------------------------------------------------------------
Y2171_CITK8     --------------------------------------------------------------
Y1421_ENT38     --------------------------------------------------------------
Y2680_YERPY     --------------------------------------------------------------
Y2592_YERP3     --------------------------------------------------------------
Y2315_YERPP     --------------------------------------------------------------
Y1506_YERPB     --------------------------------------------------------------
Y1405_YERPS     --------------------------------------------------------------
Y1380_YERPE     --------------------------------------------------------------
Y1530_YERE8     --------------------------------------------------------------
YFKF_BACSU      --------------------------------------------------------------
Y466_BUCAI      YFGFFSIFWISAFLSI----------------------------------------------
YYAJ_BACSU      --------------------------------------------------------------
ITR2_SCHPO      --------------------------------------------------------------
TCR_STRAG       --------------------------------------------------------------
TCR_STRPN       --------------------------------------------------------------
TCR_BACSU       --------------------------------------------------------------
TCR_BACCE       --------------------------------------------------------------
TCR_BACST       --------------------------------------------------------------
TCR_STAHY       --------------------------------------------------------------
STL1_YEAST      --------------------------------------------------------------
TH2A_TRYBB      --------------------------------------------------------------
TH23_TRYBB      --------------------------------------------------------------