[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD31283.1

[Show Plain Result]


## Summary of Sequence Search
    1::365
    1::365       0.0 100%  365 aa  MRAY_FRATM RecName:
    1::365       0.0 100%  365 aa  MRAY_FRATN RecName:
    1::365       0.0  99%  365 aa  MRAY_FRATW RecName:
    1::365       0.0  99%  365 aa  MRAY_FRATO RecName:
    1::365       0.0  99%  365 aa  MRAY_FRATH RecName:
    1::365       0.0  99%  365 aa  MRAY_FRATF RecName:
    1::365       0.0  99%  365 aa  MRAY_FRATT RecName:
    1::365       0.0  99%  365 aa  MRAY_FRAT1 RecName:
    1::365     e-159  88%  365 aa  MRAY_FRAP2 RecName:
    1::360     e-104  56%  360 aa  MRAY_SHEAM RecName:
    1::360     e-100  52%  360 aa  MRAY_SHEHH RecName:
    1::360     2e-99  51%  360 aa  MRAY_SHELP RecName:
    1::360     3e-99  51%  360 aa  MRAY_ALCBS RecName:
    1::360     1e-98  55%  360 aa  MRAY_ALISL RecName:
    1::360     2e-98  55%  360 aa  MRAY_VIBFM RecName:
    1::360     2e-98  55%  360 aa  MRAY_VIBF1 RecName:
    1::360     2e-98  50%  360 aa  MRAY_ERWCT RecName:
    1::360     3e-98  50%  360 aa  MRAY_YERPY RecName:
    1::360     3e-98  50%  360 aa  MRAY_YERPS RecName:
    1::360     3e-98  50%  360 aa  MRAY_YERPP RecName:
    1::360     3e-98  50%  360 aa  MRAY_YERPN RecName:
    1::360     3e-98  50%  360 aa  MRAY_YERPE RecName:
    1::360     3e-98  50%  360 aa  MRAY_YERPB RecName:
    1::360     3e-98  50%  360 aa  MRAY_YERPA RecName:
    1::360     3e-98  50%  360 aa  MRAY_YERP3 RecName:
    1::360     3e-98  55%  360 aa  MRAY_PHOLL RecName:
    1::360     3e-98  50%  360 aa  MRAY_EDWI9 RecName:
    3::358     4e-98  60%  358 aa  MRAY_PSEA6 RecName:
    1::360     4e-98  50%  360 aa  MRAY_PECCP RecName:
    1::360     7e-98  50%  360 aa  MRAY_YERPG RecName:
    1::360     2e-97  51%  360 aa  MRAY_SHEB9 RecName:
    1::360     2e-97  51%  360 aa  MRAY_SHEB5 RecName:
    1::360     2e-97  51%  360 aa  MRAY_SHEB2 RecName:
    1::360     4e-97  50%  360 aa  MRAY_SODGM RecName:
    1::360     5e-97  51%  360 aa  MRAY_SHEB8 RecName:
    1::360     6e-97  51%  360 aa  MRAY_VIBHB RecName:
    1::360     1e-96  51%  360 aa  MRAY_VIBPA RecName:
    1::360     2e-96  50%  360 aa  MRAY_PSEPK RecName:
    1::360     2e-96  50%  360 aa  MRAY_PSEPG RecName:
    1::360     2e-96  50%  360 aa  MRAY_PSEPF RecName:
    1::360     2e-96  50%  360 aa  MRAY_PSEP1 RecName:
    1::360     2e-96  50%  360 aa  MRAY_IDILO RecName:
    1::360     2e-96  51%  360 aa  MRAY_VIBVY RecName:
    1::360     3e-96  50%  360 aa  MRAY_YERE8 RecName:
    1::361     3e-96  52%  361 aa  MRAY_XANAC RecName:
    1::360     3e-96  50%  360 aa  MRAY_VIBVU RecName:
    1::360     3e-96  50%  360 aa  MRAY_SERP5 RecName:
    1::360     4e-96  50%  360 aa  MRAY_PSEPW RecName:
    1::361     5e-96  52%  361 aa  MRAY_XANCP RecName:
    1::361     5e-96  52%  361 aa  MRAY_XANCB RecName:
    1::361     5e-96  52%  361 aa  MRAY_XANC8 RecName:
    1::361     7e-96  52%  361 aa  MRAY_XANC5 RecName:
    1::361     9e-96  52%  361 aa  MRAY_XANOP RecName:
    1::360     1e-95  49%  360 aa  MRAY_PSEU5 RecName:
    1::360     1e-95  49%  360 aa  MRAY_PSEMY RecName:
    1::361     2e-95  52%  361 aa  MRAY_XANOR RecName:
    1::361     2e-95  52%  361 aa  MRAY_XANOM RecName:
    1::360     2e-95  49%  360 aa  MRAY_PSEF5 RecName:
    1::360     2e-95  52%  360 aa  MRAY_ERWT9 RecName:
    1::361     1e-94  48%  361 aa  MRAY_THICR RecName:
    1::360     1e-94  53%  360 aa  MRAY_METCA RecName:
    1::360     1e-94  53%  360 aa  MRAY_PSEE4 RecName:
    1::360     2e-94  49%  360 aa  MRAY_SHEWM RecName:
    1::360     2e-94  49%  360 aa  MRAY_SHEFN RecName:
    1::360     3e-94  49%  360 aa  MRAY_SHESH RecName:
    1::360     1e-93  52%  360 aa  MRAY_PSEFS RecName:
    1::360     1e-93  53%  360 aa  MRAY_PSEAE RecName:
    1::360     1e-93  53%  360 aa  MRAY_PSEAB RecName:
    1::360     1e-93  53%  360 aa  MRAY_PSEA8 RecName:
    1::360     1e-93  53%  360 aa  MRAY_PSEA7 RecName:
    1::360     7e-93  48%  360 aa  MRAY_SHESR RecName:
    1::360     7e-93  48%  360 aa  MRAY_SHESM RecName:
    1::360     7e-93  48%  360 aa  MRAY_SHESA RecName:
    1::360     7e-93  52%  360 aa  MRAY_PSE14 RecName:
    1::360     1e-92  52%  360 aa  MRAY_PSEU2 RecName:
    1::360     1e-92  52%  360 aa  MRAY_PSESM RecName:
    1::360     2e-92  48%  360 aa  MRAY_SHEON RecName:
    1::361     2e-92  47%  361 aa  MRAY_RUTMC RecName:
    1::360     5e-92  48%  360 aa  MRAY_CHRSD RecName:
    1::361     2e-91  49%  361 aa  MRAY_COXBR RecName:
    1::361     2e-91  49%  361 aa  MRAY_COXBU RecName:
    1::361     2e-91  49%  361 aa  MRAY_COXBN RecName:
    1::361     2e-91  49%  361 aa  MRAY_COXB2 RecName:
    1::361     2e-91  49%  361 aa  MRAY_COXB1 RecName:
    1::360     4e-91  49%  360 aa  MRAY_PROMH RecName:
    1::360     4e-91  48%  360 aa  MRAY_ACTP2 RecName:
    1::360     5e-91  48%  360 aa  MRAY_ACTPJ RecName:
    1::360     7e-91  51%  360 aa  MRAY_PHOPR RecName:
    1::360     9e-91  51%  360 aa  MRAY_AZOVD RecName:
    1::360     1e-90  51%  360 aa  MRAY_MANSM RecName:
    1::360     4e-90  48%  360 aa  MRAY_ACTP7 RecName:
    1::360     6e-90  48%  360 aa  MRAY_SHEPW RecName:
    1::360     7e-90  48%  360 aa  MRAY_SHEPA RecName:
    1::361     7e-90  53%  361 aa  MRAY_NITEU RecName:
    1::360     7e-90  48%  360 aa  MRAY_MARMS RecName:
    1::360     9e-90  47%  360 aa  MRAY_DESAA RecName:
    1::361     1e-89  50%  361 aa  MRAY_LARHH RecName:
    1::361     2e-89  48%  361 aa  MRAY_METFK RecName:
    1::361     2e-89  47%  361 aa  MRAY_MARAV RecName:
    1::360     4e-89  48%  360 aa  MRAY_SHEVI RecName:
    1::361     6e-89  50%  361 aa  MRAY_HAES2 RecName:
    1::361     6e-89  50%  361 aa  MRAY_HAES1 RecName:
    1::361     2e-88  45%  361 aa  MRAY_XYLFA RecName:
    1::361     2e-88  52%  361 aa  MRAY_CHRVO RecName:
    1::360     2e-88  51%  360 aa  MRAY_ALTMD RecName:
    1::361     5e-88  45%  361 aa  MRAY_XYLFT RecName:
    1::361     5e-88  45%  361 aa  MRAY_XYLFM RecName:
    1::361     5e-88  45%  361 aa  MRAY_XYLF2 RecName:
    1::360     1e-87  46%  360 aa  MRAY_THISH RecName:
    1::360     2e-87  48%  373 aa  MRAY_PSYWF RecName:
    1::362     3e-87  53%  362 aa  MRAY_AZOSB RecName:
    1::360     7e-87  51%  360 aa  MRAY_ALHEH RecName:
    1::389     1e-86  46%  389 aa  MRAY_BURP8 RecName:
    1::360     2e-86  46%  360 aa  MRAY_SHESW RecName:
    1::360     2e-86  46%  360 aa  MRAY_SHEPC RecName:
    1::360     5e-86  49%  360 aa  MRAY_COLP3 RecName:
    1::372     5e-86  49%  372 aa  MRAY_ACIAD RecName:
    1::360     8e-86  47%  360 aa  MRAY_SALTY RecName:
    1::360     8e-86  47%  360 aa  MRAY_SALTI RecName:
    1::360     8e-86  47%  360 aa  MRAY_SALSV RecName:
    1::360     8e-86  47%  360 aa  MRAY_SALPB RecName:
    1::360     8e-86  47%  360 aa  MRAY_SALNS RecName:
    1::360     8e-86  47%  360 aa  MRAY_SALHS RecName:
    1::360     8e-86  47%  360 aa  MRAY_SALG2 RecName:
    1::360     8e-86  47%  360 aa  MRAY_SALEP RecName:
    1::360     8e-86  47%  360 aa  MRAY_SALDC RecName:
    1::360     8e-86  47%  360 aa  MRAY_SALCH RecName:
    1::360     8e-86  47%  360 aa  MRAY_SALAR RecName:
    1::360     8e-86  47%  360 aa  MRAY_SALA4 RecName:
    1::360     8e-86  46%  360 aa  MRAY_PSEHT RecName:
    1::360     1e-85  47%  360 aa  MRAY_VIBCM RecName:
    1::360     1e-85  47%  360 aa  MRAY_VIBCH RecName:
    1::360     1e-85  47%  360 aa  MRAY_SALPC RecName:
    1::361     1e-85  45%  361 aa  MRAY_LEGPH RecName:
    1::361     1e-85  45%  361 aa  MRAY_LEGPC RecName:
    1::361     1e-85  45%  361 aa  MRAY_LEGPA RecName:
    1::360     1e-85  47%  360 aa  MRAY_VIBC3 RecName:
    1::389     1e-85  45%  389 aa  MRAY_RALPJ RecName:
    1::360     2e-85  46%  360 aa  MRAY_SHEDO RecName:
    1::360     2e-85  47%  360 aa  MRAY_SALPK RecName:
    1::360     2e-85  47%  360 aa  MRAY_SALPA RecName:
    1::360     2e-85  47%  360 aa  MRAY_KLEP3 RecName:
    1::379     2e-85  48%  392 aa  MRAY_DELAS RecName:
    1::361     3e-85  45%  361 aa  MRAY_LEGPL RecName:
    1::360     3e-85  47%  360 aa  MRAY_KLEP7 RecName:
    1::360     3e-85  46%  360 aa  MRAY_CELJU RecName:
    1::389     3e-85  47%  389 aa  MRAY_BORPD RecName:
    1::392     4e-85  46%  392 aa  MRAY_POLNA RecName:
    4::389     5e-85  46%  389 aa  MRAY_HERAR RecName:
    1::360     5e-85  46%  360 aa  MRAY_ENTS8 RecName:
    4::389     7e-85  46%  389 aa  MRAY_JANMA RecName:
    1::360     7e-85  46%  360 aa  MRAY_ENT38 RecName:
    1::360     3e-84  50%  360 aa  MRAY_PASMU RecName:
    1::346     3e-84  47%  360 aa  MRAY_TOLAT RecName:
    1::389     5e-84  45%  389 aa  MRAY_BURTA RecName:
    1::389     5e-84  45%  389 aa  MRAY_BURPS RecName:
    1::389     5e-84  45%  389 aa  MRAY_BURP6 RecName:
    1::389     5e-84  45%  389 aa  MRAY_BURP1 RecName:
    1::389     5e-84  45%  389 aa  MRAY_BURP0 RecName:
    1::389     5e-84  45%  389 aa  MRAY_BURMS RecName:
    1::389     5e-84  45%  389 aa  MRAY_BURMA RecName:
    1::389     5e-84  45%  389 aa  MRAY_BURM9 RecName:
    1::389     5e-84  45%  389 aa  MRAY_BURM7 RecName:
    1::389     5e-84  45%  389 aa  MRAY_BURM1 RecName:
    1::389     6e-84  45%  389 aa  MRAY_BURXL RecName:
    1::389     6e-84  45%  389 aa  MRAY_BURPP RecName:
    1::360     6e-84  52%  360 aa  MRAY_ACIF5 RecName:
    1::360     6e-84  52%  360 aa  MRAY_ACIF2 RecName:
    1::389     8e-84  45%  389 aa  MRAY_BURVG RecName:
   44::372     8e-84  53%  372 aa  MRAY_ACIBY RecName:
   44::372     8e-84  53%  372 aa  MRAY_ACIBS RecName:
   44::372     8e-84  53%  372 aa  MRAY_ACIBC RecName:
   44::372     8e-84  53%  372 aa  MRAY_ACIB5 RecName:
    1::389     1e-83  45%  389 aa  MRAY_BURCM RecName:
    1::389     1e-83  45%  389 aa  MRAY_BURA4 RecName:
    1::361     2e-83  47%  361 aa  MRAY_THIDA RecName:
    1::372     2e-83  46%  372 aa  MRAY_PSYA2 RecName:
    1::360     2e-83  46%  360 aa  MRAY_NEIMF RecName:
    1::360     2e-83  46%  360 aa  MRAY_NEIMB RecName:
    1::360     2e-83  46%  360 aa  MRAY_CITK8 RecName:
    1::392     3e-83  48%  392 aa  MRAY_POLSJ RecName:
    1::360     3e-83  46%  360 aa  MRAY_NEIMA RecName:
    1::360     4e-83  45%  360 aa  MRAY_NEIM0 RecName:
    1::360     5e-83  45%  360 aa  MRAY_NEIG2 RecName:
    1::360     5e-83  45%  360 aa  MRAY_NEIG1 RecName:
    1::389     5e-83  44%  389 aa  MRAY_BURS3 RecName:
    1::389     5e-83  44%  389 aa  MRAY_BURCJ RecName:
    1::389     5e-83  44%  389 aa  MRAY_BURCH RecName:
    1::389     5e-83  44%  389 aa  MRAY_BURCC RecName:
    1::389     5e-83  44%  389 aa  MRAY_BURCA RecName:
    1::360     2e-82  46%  360 aa  MRAY_ECOSM RecName:
    1::360     2e-82  46%  360 aa  MRAY_ECOLU RecName:
    1::360     2e-82  46%  360 aa  MRAY_ECO7I RecName:
    1::389     2e-82  44%  389 aa  MRAY_RALSO RecName:
    1::360     2e-82  45%  360 aa  MRAY_HALHL RecName:
   44::392     4e-82  51%  392 aa  MRAY_VEREI RecName:
    1::360     6e-82  45%  360 aa  MRAY_TERTT RecName:
    1::372     6e-82  48%  372 aa  MRAY_PSYCK RecName:
    1::372     9e-82  47%  389 aa  MRAY_POLNS RecName:
    1::393     9e-82  45%  393 aa  MRAY_LEPCP RecName:
    1::392     1e-81  49%  392 aa  MRAY_VARPS RecName:
    1::389     1e-81  43%  389 aa  MRAY_RALEJ RecName:
    1::372     2e-81  46%  389 aa  MRAY_POLSQ RecName:
    1::360     2e-81  45%  360 aa  MRAY_HAEI8 RecName:
    1::360     3e-81  45%  360 aa  MRAY_HAEIN RecName:
    1::360     3e-81  45%  360 aa  MRAY_HAEIG RecName:
    1::360     3e-81  45%  360 aa  MRAY_HAEIE RecName:
    2::342     3e-81  45%  359 aa  MRAY_DESAH RecName:
    9::377     8e-81  51%  377 aa  MRAY_BORPE RecName:
    9::377     8e-81  51%  377 aa  MRAY_BORBR RecName:
    1::392     3e-80  49%  392 aa  MRAY_RHOFD RecName:
    9::377     4e-80  50%  377 aa  MRAY_BORPA RecName:
    1::360     5e-80  45%  360 aa  MRAY_VIBSL RecName:
    1::358     2e-79  47%  358 aa  MRAY_GEOSL RecName:
    1::377     2e-79  50%  392 aa  MRAY_DIAST RecName:
    1::377     2e-79  50%  392 aa  MRAY_ACISJ RecName:
    1::343     1e-78  45%  360 aa  MRAY_PSYIN RecName:
    1::361     1e-78  44%  361 aa  MRAY_RHOCS RecName:
    1::358     2e-78  47%  358 aa  MRAY_NITOC RecName:
    1::366     4e-78  48%  366 aa  MRAY_RHISN RecName:
    1::361     4e-78  45%  361 aa  MRAY_NITEC RecName:
    1::346     5e-78  46%  360 aa  MRAY_DICNV RecName:
    1::360     8e-78  44%  360 aa  MRAY_SHIDS RecName:
    1::360     8e-78  44%  360 aa  MRAY_ECOL6 RecName:
    1::360     8e-78  44%  360 aa  MRAY_ECO81 RecName:
    1::360     8e-78  44%  360 aa  MRAY_ECO5E RecName:
    1::360     8e-78  44%  360 aa  MRAY_ECO57 RecName:
    1::360     1e-77  46%  360 aa  MRAY_WIGBR RecName:
    1::360     1e-77  44%  360 aa  MRAY_SHISS RecName:
    1::360     1e-77  44%  360 aa  MRAY_SHIFL RecName:
    1::360     1e-77  44%  360 aa  MRAY_SHIF8 RecName:
    1::360     1e-77  44%  360 aa  MRAY_SHIBS RecName:
    1::360     1e-77  44%  360 aa  MRAY_SHIB3 RecName:
    1::360     1e-77  44%  360 aa  MRAY_ESCF3 RecName:
    1::360     1e-77  44%  360 aa  MRAY_ECOUT RecName:
    1::360     1e-77  44%  360 aa  MRAY_ECOSE RecName:
    1::360     1e-77  44%  360 aa  MRAY_ECOLI RecName:
    1::360     1e-77  44%  360 aa  MRAY_ECOLC RecName:
    1::360     1e-77  44%  360 aa  MRAY_ECOL5 RecName:
    1::360     1e-77  44%  360 aa  MRAY_ECOK1 RecName:
    1::360     1e-77  44%  360 aa  MRAY_ECOHS RecName:
    1::360     1e-77  44%  360 aa  MRAY_ECODH RecName:
    1::360     1e-77  44%  360 aa  MRAY_ECOBW RecName:
    1::360     1e-77  44%  360 aa  MRAY_ECO8A RecName:
    1::360     1e-77  44%  360 aa  MRAY_ECO55 RecName:
    1::360     1e-77  44%  360 aa  MRAY_ECO45 RecName:
    1::360     1e-77  44%  360 aa  MRAY_ECO27 RecName:
    1::360     1e-77  44%  360 aa  MRAY_ECO24 RecName:
    1::360     2e-77  42%  361 aa  MRAY_VESOH RecName:
    1::360     2e-77  42%  360 aa  MRAY_SACD2 RecName:
    1::358     3e-77  44%  358 aa  MRAY_PELPD RecName:
    1::359     4e-77  42%  359 aa  MRAY_DESOH RecName:
    1::344     5e-77  44%  361 aa  MRAY_THEYD RecName:
    1::366     5e-77  48%  366 aa  MRAY_SINMW RecName:
    1::360     5e-77  42%  360 aa  MRAY_HAEPS RecName:
    1::375     5e-77  45%  392 aa  MRAY_ACIAC RecName:
    1::341     9e-77  49%  358 aa  MRAY_PELCD RecName:
    1::380     9e-77  48%  393 aa  MRAY_METPP RecName:
    1::346     1e-76  47%  360 aa  MRAY_ACTSZ RecName:
    1::362     2e-76  44%  362 aa  MRAY_AZOSE RecName:
    1::359     3e-76  50%  359 aa  MRAY_DESPS RecName:
   21::361     3e-76  44%  361 aa  MRAY_RICBR RecName:
    1::359     6e-76  46%  359 aa  MRAY_DESAD RecName:
    5::379     6e-76  44%  379 aa  MRAY_ACIBL RecName:
    1::360     1e-75  42%  360 aa  MRAY_RHORT RecName:
   21::361     2e-75  44%  361 aa  MRAY_RICB8 RecName:
    1::366     2e-75  47%  366 aa  MRAY_RHIME RecName:
    1::366     3e-75  47%  366 aa  MRAY_AGRVS RecName:
    1::362     4e-75  46%  362 aa  MRAY_PARL1 RecName:
    1::361     5e-75  43%  361 aa  MRAY_METRJ RecName:
    1::367     5e-75  48%  367 aa  MRAY_DECAR RecName:
   42::361     9e-75  50%  377 aa  MRAY_ACIC5 RecName:
    1::358     1e-74  46%  358 aa  MRAY_DESDG RecName:
    1::358     2e-74  46%  358 aa  MRAY_GEOLS RecName:
    6::378     6e-74  43%  378 aa  MRAY_SOLUE RecName:
   21::362     7e-74  43%  362 aa  MRAY_GRABC RecName:
    1::361     9e-74  44%  361 aa  MRAY_NITMU RecName:
    1::389     9e-74  40%  389 aa  MRAY_CUPTR RecName:
    1::373     1e-73  42%  373 aa  MRAY_AGRRK RecName:
    1::358     5e-73  44%  358 aa  MRAY_GEOMG RecName:
    1::358     6e-73  41%  358 aa  MRAY_GEOBB RecName:
    1::360     1e-72  45%  360 aa  MRAY_MESSB RecName:
    1::346     2e-72  42%  360 aa  MRAY_HAEDU RecName:
    1::354     2e-72  44%  354 aa  MRAY_NOVAD RecName:
    1::360     3e-72  44%  360 aa  MRAY_METC4 RecName:
    1::358     3e-72  41%  358 aa  MRAY_GEOSM RecName:
    1::356     5e-72  41%  356 aa  MRAY_BARQU RecName:
    1::360     7e-72  41%  360 aa  MRAY_OCHA4 RecName:
    1::360     7e-72  43%  360 aa  MRAY_METPB RecName:
    4::360     1e-71  43%  360 aa  MRAY_SILPO RecName:
    1::408     2e-71  53%  410 aa  MRAY_PARUW RecName:
    8::356     2e-71  42%  356 aa  MRAY_BARBK RecName:
    1::360     4e-71  42%  360 aa  MRAY_BEII9 RecName:
    1::370     8e-71  42%  370 aa  MRAY_CAUCN RecName:
    4::360     8e-71  41%  360 aa  MRAY_BRUSU RecName:
    4::360     8e-71  41%  360 aa  MRAY_BRUSI RecName:
    4::360     8e-71  41%  360 aa  MRAY_BRUO2 RecName:
    4::360     8e-71  41%  360 aa  MRAY_BRUME RecName:
    4::360     8e-71  41%  360 aa  MRAY_BRUMB RecName:
    4::360     8e-71  41%  360 aa  MRAY_BRUC2 RecName:
    4::360     8e-71  41%  360 aa  MRAY_BRUAB RecName:
    4::360     8e-71  41%  360 aa  MRAY_BRUA2 RecName:
    4::360     8e-71  41%  360 aa  MRAY_BRUA1 RecName:
   21::361     1e-70  46%  361 aa  MRAY_RICTY RecName:
    1::376     1e-70  41%  389 aa  MRAY_RALME RecName:
    1::361     1e-70  41%  361 aa  MRAY_OLICO RecName:
   21::361     1e-70  43%  361 aa  MRAY_RICCK RecName:
    1::389     2e-70  39%  389 aa  MRAY_RALEH RecName:
    1::356     2e-70  51%  356 aa  MRAY_SPHWW RecName:
    1::358     2e-70  43%  358 aa  MRAY_DESVV RecName:
    1::358     2e-70  43%  358 aa  MRAY_DESVH RecName:
   54::361     4e-70  44%  361 aa  MRAY_RHOPS RecName:
    1::358     4e-70  40%  358 aa  MRAY_DESMR RecName:
   18::368     6e-70  42%  368 aa  MRAY_BRASB RecName:
    1::356     1e-69  48%  356 aa  MRAY_ERYLH RecName:
   21::362     1e-69  41%  362 aa  MRAY_ACICJ RecName:
   21::359     1e-69  38%  359 aa  MRAY_SYNAS RecName:
    4::360     1e-69  41%  360 aa  MRAY_SILST RecName:
    1::361     1e-69  46%  361 aa  MRAY_PELUB RecName:
   21::361     2e-69  45%  361 aa  MRAY_RICFE RecName:
    1::361     2e-69  42%  361 aa  MRAY_RHOP2 RecName:
   21::361     2e-69  45%  361 aa  MRAY_RICPR RecName:
   54::360     2e-69  47%  360 aa  MRAY_RHOP5 RecName:
    1::366     2e-69  44%  366 aa  MRAY_RHIL3 RecName:
    1::366     3e-69  44%  366 aa  MRAY_RHILW RecName:
   21::358     9e-69  45%  358 aa  MRAY_DESDA RecName:
   20::342     2e-68  47%  356 aa  MRAY_ZYMMO RecName:
   21::361     2e-68  44%  361 aa  MRAY_RICRS RecName:
   21::361     2e-68  44%  361 aa  MRAY_RICRO RecName:
   21::361     2e-68  44%  361 aa  MRAY_RICRI RecName:
    5::343     2e-68  44%  360 aa  MRAY_RHOS5 RecName:
    1::360     2e-68  41%  360 aa  MRAY_HAHCH RecName:
   21::361     3e-68  44%  361 aa  MRAY_RICMO RecName:
    1::346     3e-68  42%  361 aa  MRAY_METS4 RecName:
   44::362     3e-68  47%  362 aa  MRAY_MAGSM RecName:
   21::361     3e-68  44%  361 aa  MRAY_RICCN RecName:
   21::361     3e-68  44%  361 aa  MRAY_RICAE RecName:
   21::361     6e-68  44%  361 aa  MRAY_RICM5 RecName:
   42::343     6e-68  50%  360 aa  MRAY_PARDP RecName:
    1::343     1e-67  41%  360 aa  MRAY_RHOS4 RecName:
    1::343     1e-67  41%  360 aa  MRAY_RHOS1 RecName:
    1::368     1e-67  42%  368 aa  MRAY_BRASO RecName:
   21::361     1e-67  44%  361 aa  MRAY_RICPU RecName:
   21::361     2e-67  45%  361 aa  MRAY_RICAH RecName:
    1::361     3e-67  40%  361 aa  MRAY_UNCTG RecName:
    1::353     7e-67  42%  353 aa  MRAY_ARCB4 RecName:
   56::359     1e-66  49%  359 aa  MRAY_HYDS0 RecName:
    1::346     1e-66  42%  361 aa  MRAY_AZOC5 RecName:
    1::360     2e-66  42%  360 aa  MRAY_RHILO RecName:
    1::353     2e-66  45%  366 aa  MRAY_RHIE6 RecName:
    1::350     2e-66  42%  367 aa  MRAY_MARMM RecName:
   22::363     2e-66  43%  363 aa  MRAY_GLUDA RecName:
    1::343     2e-66  40%  360 aa  MRAY_RHOSK RecName:
    1::353     2e-66  45%  366 aa  MRAY_RHIEC RecName:
    1::368     2e-66  41%  368 aa  MRAY_NITHX RecName:
   54::360     6e-66  43%  360 aa  MRAY_METSB RecName:
    1::346     6e-66  45%  361 aa  MRAY_METNO RecName:
    1::356     7e-66  44%  356 aa  MRAY_SPHAL RecName:
   37::358     7e-66  44%  361 aa  MRAY_FUSNN RecName:
    1::367     9e-66  43%  367 aa  MRAY_BRAJA RecName:
    1::361     2e-65  43%  361 aa  MRAY_RHOPT RecName:
    1::371     2e-65  41%  371 aa  MRAY_OPITP RecName:
    1::371     2e-65  40%  371 aa  MRAY_CAUSK RecName:
    1::352     5e-65  43%  352 aa  MRAY_WOLSU RecName:
    1::368     5e-65  41%  368 aa  MRAY_NITWN RecName:
   42::361     5e-65  44%  362 aa  MRAY_BLOPB RecName:
    2::341     5e-65  46%  358 aa  MRAY_BDEBA RecName:
    1::361     6e-65  43%  361 aa  MRAY_RHOPA RecName:
    1::345     1e-64  40%  361 aa  MRAY_XANP2 RecName:
   41::345     9e-64  43%  362 aa  MRAY_MAGSA RecName:
    1::368     9e-64  38%  368 aa  MRAY_CHLL2 RecName:
   40::353     3e-63  47%  353 aa  MRAY_SULDN RecName:
   43::369     3e-63  40%  369 aa  MRAY_PHEZH RecName:
   54::361     1e-62  50%  361 aa  MRAY_RHOPB RecName:
    1::353     1e-62  45%  366 aa  MRAY_AGRT5 RecName:
   42::363     2e-62  40%  363 aa  MRAY_GLUOX RecName:
    1::356     4e-62  38%  356 aa  MRAY_BARHE RecName:
    1::342     5e-62  44%  359 aa  MRAY_AQUAE RecName:
    1::356     8e-62  39%  356 aa  MRAY_BART1 RecName:
    1::392     2e-61  39%  392 aa  MRAY_MYXXD RecName:
    1::337     2e-61  40%  354 aa  MRAY_CAMC5 RecName:
    1::347     3e-61  39%  368 aa  MRAY_PROA2 RecName:
    4::351     2e-60  39%  351 aa  MRAY_BORRA RecName:
    4::351     2e-60  39%  351 aa  MRAY_BORDL RecName:
    1::419     2e-60  46%  419 aa  MRAY_PORG3 RecName:
    1::368     2e-60  43%  368 aa  MRAY_PELLD RecName:
    1::419     3e-60  47%  419 aa  MRAY_PORGI RecName:
    1::388     3e-60  39%  403 aa  MRAY_CYTH3 RecName:
   12::351     3e-60  38%  351 aa  MRAY_BORHD RecName:
    3::351     5e-60  37%  351 aa  MRAY_BORAP RecName:
    1::404     6e-60  41%  404 aa  MRAY_AMOA5 RecName:
    1::351     1e-59  44%  351 aa  MRAY_NAUPA RecName:
    1::368     2e-59  41%  368 aa  MRAY_PELPB RecName:
    4::342     2e-59  43%  359 aa  MRAY_JANSC RecName:
   41::353     3e-59  41%  353 aa  MRAY_HELPS RecName:
    1::346     4e-59  40%  365 aa  MRAY_BLOFL RecName:
   13::338     5e-59  40%  354 aa  MRAY_CAMFF RecName:
   12::351     5e-59  38%  351 aa  MRAY_BORT9 RecName:
    1::369     9e-59  39%  369 aa  MRAY_CHLPB RecName:
   74::368     1e-58  47%  368 aa  MRAY_CHLPD RecName:
    1::351     1e-58  44%  368 aa  MRAY_LEPIN RecName:
    1::351     1e-58  44%  368 aa  MRAY_LEPIC RecName:
    1::358     2e-58  42%  358 aa  MRAY_LAWIP RecName:
   41::353     2e-58  41%  353 aa  MRAY_HELAH RecName:
    1::337     6e-58  42%  354 aa  MRAY_NITSB RecName:
    4::344     1e-57  42%  361 aa  MRAY_DINSH RecName:
    1::353     1e-57  43%  368 aa  MRAY_CHLT3 RecName:
   20::327     1e-57  43%  340 aa  MRAY_BUCBP RecName:
    1::353     2e-57  44%  370 aa  MRAY_LEPBL RecName:
    1::353     2e-57  44%  370 aa  MRAY_LEPBJ RecName:
    1::368     2e-57  40%  368 aa  MRAY_CHLCH RecName:
   17::342     6e-57  43%  357 aa  MRAY_BUCA5 RecName:
   17::342     8e-57  43%  357 aa  MRAY_BUCAI RecName:
   41::352     1e-56  39%  353 aa  MRAY_HELPJ RecName:
   25::322     1e-56  45%  324 aa  MRAY_LISIN RecName:
   17::342     1e-56  43%  357 aa  MRAY_BUCAT RecName:
   58::352     2e-56  39%  352 aa  MRAY_SULNB RecName:
   31::319     4e-56  46%  320 aa  MRAY_ANATD RecName:
   20::350     5e-56  45%  366 aa  MRAY_METI4 RecName:
   23::323     9e-56  44%  326 aa  MRAY_WOLTR RecName:
    4::342     9e-56  42%  359 aa  MRAY_HELHP RecName:
    1::383     9e-56  34%  383 aa  MRAY_BRAHW RecName:
    3::351     2e-55  36%  351 aa  MRAY_BORGA RecName:
   41::353     3e-55  40%  353 aa  MRAY_HELPH RecName:
   41::353     3e-55  40%  353 aa  MRAY_HELP2 RecName:
    1::351     1e-54  40%  368 aa  MRAY_CHLP8 RecName:
    1::352     2e-54  43%  367 aa  MRAY_PROVI RecName:
   33::316     3e-54  48%  326 aa  MRAY_WOLWR RecName:
   33::316     4e-54  49%  326 aa  MRAY_WOLPM RecName:
   54::347     4e-54  41%  363 aa  MRAY_ORITI RecName:
   20::315     1e-53  42%  316 aa  MRAY_THETN RecName:
    1::349     1e-53  42%  370 aa  MRAY_LEPBP RecName:
    1::349     1e-53  42%  370 aa  MRAY_LEPBA RecName:
    1::351     1e-53  41%  368 aa  MRAY_CHLTE RecName:
    3::351     2e-53  35%  351 aa  MRAY_BORBZ RecName:
    3::351     2e-53  35%  351 aa  MRAY_BORBU RecName:
    1::409     3e-53  41%  409 aa  MRAY_FLAPJ RecName:
   22::352     5e-53  39%  365 aa  MRAY_BIFAA RecName:
   35::331     5e-53  47%  332 aa  MRAY_ALKOO RecName:
   32::344     9e-53  40%  348 aa  MRAY_CHLCV RecName:
   25::322     1e-52  39%  324 aa  MRAY_LISMO RecName:
   25::311     1e-52  40%  321 aa  MRAY_LACC3 RecName:
   25::322     2e-52  42%  324 aa  MRAY_LISMF RecName:
   25::322     2e-52  42%  324 aa  MRAY_LISMC RecName:
   25::322     4e-52  39%  324 aa  MRAY_LISW6 RecName:
   41::353     6e-52  38%  353 aa  MRAY_HELPY RecName:
   25::318     1e-51  48%  318 aa  MRAY_CALS8 RecName:
   31::344     2e-51  39%  348 aa  MRAY_CHLFF RecName:
   41::380     1e-50  41%  380 aa  MRAY_ANASK RecName:
   41::380     1e-50  41%  380 aa  MRAY_ANADE RecName:
   41::380     1e-50  41%  380 aa  MRAY_ANAD2 RecName:
   19::317     6e-50  50%  325 aa  MRAY_CLONN RecName:
   51::359     1e-49  42%  376 aa  MRAY_SORC5 RecName:
   20::307     6e-49  45%  321 aa  MRAY_STAAW RecName:
   20::307     6e-49  43%  321 aa  MRAY_STAAU RecName:
   20::307     6e-49  43%  321 aa  MRAY_STAAT RecName:
   20::307     6e-49  45%  321 aa  MRAY_STAAS RecName:
   20::307     6e-49  43%  321 aa  MRAY_STAAR RecName:
   20::307     6e-49  43%  321 aa  MRAY_STAAN RecName:
   20::307     6e-49  43%  321 aa  MRAY_STAAM RecName:
   20::307     6e-49  43%  321 aa  MRAY_STAAE RecName:
   20::307     6e-49  43%  321 aa  MRAY_STAAC RecName:
   20::307     6e-49  43%  321 aa  MRAY_STAAB RecName:
   20::307     6e-49  43%  321 aa  MRAY_STAA9 RecName:
   20::307     6e-49  43%  321 aa  MRAY_STAA8 RecName:
   20::307     6e-49  43%  321 aa  MRAY_STAA3 RecName:
   20::307     6e-49  43%  321 aa  MRAY_STAA2 RecName:
   20::307     6e-49  43%  321 aa  MRAY_STAA1 RecName:
   23::335     6e-49  44%  336 aa  MRAY_CHLTR RecName:
   23::335     6e-49  44%  336 aa  MRAY_CHLTB RecName:
   23::335     6e-49  44%  336 aa  MRAY_CHLTA RecName:
   23::335     6e-49  44%  336 aa  MRAY_CHLT2 RecName:
    1::337     6e-49  36%  354 aa  MRAY_CAMC1 RecName:
   44::380     6e-49  35%  380 aa  MRAY_ANADF RecName:
    1::353     8e-49  34%  353 aa  MRAY_CAMJJ RecName:
    1::353     1e-48  34%  353 aa  MRAY_CAMJR RecName:
    1::353     1e-48  35%  353 aa  MRAY_CAMJE RecName:
    1::353     1e-48  34%  353 aa  MRAY_CAMJ8 RecName:
   30::343     1e-48  42%  347 aa  MRAY_CHLAB RecName:
   22::352     1e-48  37%  368 aa  MRAY_BIFLO RecName:
   22::352     1e-48  37%  368 aa  MRAY_BIFLD RecName:
   27::328     4e-48  40%  330 aa  MRAY_CLOTH RecName:
   22::352     5e-48  41%  363 aa  MRAY_STRCO RecName:
   20::305     5e-48  46%  321 aa  MRAY_STAHJ RecName:
   23::332     7e-48  44%  335 aa  MRAY_CHLMU RecName:
   21::320     9e-48  43%  325 aa  MRAY_CARHZ RecName:
   23::323     2e-47  46%  326 aa  MRAY_STRZT RecName:
   22::345     3e-47  39%  356 aa  MRAY_STRGG RecName:
   20::304     4e-47  44%  321 aa  MRAY_STAES RecName:
   20::304     6e-47  46%  321 aa  MRAY_STAEQ RecName:
   18::357     6e-47  36%  375 aa  MRAY_MICLC RecName:
   34::339     6e-47  41%  367 aa  MRAY_CHLAD RecName:
   20::304     8e-47  44%  321 aa  MRAY_STAS1 RecName:
   23::309     1e-46  43%  326 aa  MRAY_STRPS RecName:
   23::309     1e-46  43%  326 aa  MRAY_STRPJ RecName:
   55::341     1e-46  44%  358 aa  MRAY_PROM2 RecName:
   30::321     1e-46  42%  322 aa  MRAY_CLOD6 RecName:
   41::397     2e-46  40%  397 aa  MRAY_HYPNA RecName:
   23::309     2e-46  47%  326 aa  MRAY_STRPI RecName:
   32::346     2e-46  36%  349 aa  MRAY_CHLPN RecName:
   40::337     2e-46  40%  354 aa  MRAY_CAMHC RecName:
   23::309     4e-46  47%  326 aa  MRAY_STRP4 RecName:
    1::380     8e-46  35%  380 aa  MRAY_GEMAT RecName:
   11::336     8e-46  36%  352 aa  MRAY_CAMLR RecName:
   23::358     8e-46  38%  369 aa  MRAY_ARTAT RecName:
   23::309     1e-45  44%  326 aa  MRAY_STRPN RecName:
   23::309     1e-45  44%  326 aa  MRAY_STRP7 RecName:
   23::309     1e-45  44%  326 aa  MRAY_STRZP RecName:
   24::300     2e-45  42%  306 aa  MRAY_FERNB RecName:
   23::309     2e-45  44%  326 aa  MRAY_STRR6 RecName:
   23::309     2e-45  44%  326 aa  MRAY_STRP2 RecName:
   56::342     2e-45  45%  359 aa  MRAY_PROMP RecName:
   19::317     2e-45  41%  317 aa  MRAY_CLOK5 RecName:
   19::317     2e-45  41%  317 aa  MRAY_CLOK1 RecName:
   28::326     2e-45  46%  326 aa  MRAY_CLOB8 RecName:
    1::385     4e-45  36%  385 aa  MRAY_SALRD RecName:
   20::315     5e-45  38%  316 aa  MRAY_THEPX RecName:
   20::315     5e-45  38%  316 aa  MRAY_THEP3 RecName:
   68::360     5e-45  41%  370 aa  MRAY_PROMA RecName:
   25::318     5e-45  36%  324 aa  MRAY_GEOSW RecName:
   20::319     5e-45  41%  319 aa  MRAY_CLOTE RecName:
   24::319     1e-44  37%  323 aa  MRAY_LACRJ RecName:
   24::319     1e-44  37%  323 aa  MRAY_LACRD RecName:
   18::358     2e-44  38%  369 aa  MRAY_ARTS2 RecName:
   31::337     2e-44  37%  342 aa  MRAY_ANAMM RecName:
   31::337     2e-44  37%  342 aa  MRAY_ANAMF RecName:
   22::353     2e-44  42%  366 aa  MRAY_CORGL RecName:
   22::353     2e-44  42%  366 aa  MRAY_CORGB RecName:
   25::304     3e-44  50%  321 aa  MRAY_STACT RecName:
   20::329     3e-44  39%  335 aa  MRAY_DESHD RecName:
   22::354     3e-44  40%  366 aa  MRAY_CORJK RecName:
   21::310     5e-44  42%  334 aa  MRAY_DESRM RecName:
   20::329     5e-44  39%  335 aa  MRAY_DESHY RecName:
   64::363     6e-44  41%  365 aa  MRAY_SYNY3 RecName:
   25::318     6e-44  40%  325 aa  MRAY_BACSK RecName:
    1::410     8e-44  36%  410 aa  MRAY_FLAJ1 RecName:
   24::320     2e-43  37%  321 aa  MRAY_LACPL RecName:
   18::342     2e-43  36%  354 aa  MRAY_ACIC1 RecName:
   23::346     4e-43  35%  357 aa  MRAY_STRAW RecName:
   26::321     4e-43  37%  322 aa  MRAY_LACS1 RecName:
   22::347     9e-43  35%  377 aa  MRAY_KOCRD RecName:
    1::134     1e-42  44%  419 aa  MRAY_PARD8 RecName:
   55::341     2e-42  43%  358 aa  MRAY_PROM0 RecName:
   22::342     3e-42  39%  355 aa  MRAY_FRAAA RecName:
   25::317     3e-42  38%  321 aa  MRAY_ENTHR RecName:
   26::313     3e-42  44%  314 aa  MRAY_PETMO RecName:
   22::309     3e-42  39%  319 aa  MRAY_LACDB RecName:
   22::309     3e-42  39%  319 aa  MRAY_LACDA RecName:
   33::325     6e-42  39%  327 aa  MRAY_STRSV RecName:
   69::357     1e-41  41%  373 aa  MRAY_PROMM RecName:
   65::341     1e-41  42%  358 aa  MRAY_PROM9 RecName:
   22::303     1e-41  40%  318 aa  MRAY_PEDPA RecName:
   18::342     1e-41  39%  355 aa  MRAY_FRASC RecName:
   23::330     2e-41  41%  332 aa  MRAY_STRSY RecName:
   23::330     2e-41  41%  332 aa  MRAY_STRS2 RecName:
   30::330     2e-41  45%  331 aa  MRAY_ALKMQ RecName:
   64::362     2e-41  41%  368 aa  MRAY_SYNPX RecName:
   25::319     4e-41  42%  322 aa  MRAY_LACAC RecName:
   31::352     4e-41  35%  366 aa  MRAY_CORU7 RecName:
   42::138     4e-41  45%  418 aa  MRAY_AZOPC RecName:
   18::352     6e-41  39%  363 aa  MRAY_KINRD RecName:
   34::339     8e-41  35%  367 aa  MRAY_CHLSY RecName:
   34::339     8e-41  35%  367 aa  MRAY_CHLAA RecName:
   25::318     8e-41  41%  325 aa  MRAY_BACHD RecName:
   23::334     1e-40  44%  336 aa  MRAY_STRA5 RecName:
   23::334     1e-40  44%  336 aa  MRAY_STRA3 RecName:
   23::334     1e-40  44%  336 aa  MRAY_STRA1 RecName:
   25::318     1e-40  36%  324 aa  MRAY_BACHK RecName:
   25::318     1e-40  36%  324 aa  MRAY_BACCZ RecName:
   25::318     1e-40  36%  324 aa  MRAY_BACCQ RecName:
   25::318     1e-40  36%  324 aa  MRAY_BACC7 RecName:
   25::318     1e-40  36%  324 aa  MRAY_BACC3 RecName:
   25::318     1e-40  36%  324 aa  MRAY_BACC2 RecName:
   25::318     1e-40  36%  324 aa  MRAY_BACC1 RecName:
   25::318     1e-40  36%  324 aa  MRAY_BACC0 RecName:
   25::318     1e-40  36%  324 aa  MRAY_BACAN RecName:
   25::318     1e-40  36%  324 aa  MRAY_BACAH RecName:
   25::318     1e-40  36%  324 aa  MRAY_BACAC RecName:
   25::318     1e-40  36%  324 aa  MRAY_BACAA RecName:
   19::318     2e-40  42%  330 aa  MRAY_RUBXD RecName:
   23::351     2e-40  35%  371 aa  MRAY_LEIXX RecName:
   22::352     2e-40  39%  368 aa  MRAY_BIFA0 RecName:
   22::347     2e-40  34%  359 aa  MRAY_MYCA9 RecName:
   28::309     2e-40  44%  324 aa  MRAY_CLOBA RecName:
   25::318     2e-40  36%  324 aa  MRAY_BACWK RecName:
   25::318     2e-40  36%  324 aa  MRAY_BACCR RecName:
   25::318     2e-40  36%  324 aa  MRAY_BACC4 RecName:
   25::317     5e-40  36%  320 aa  MRAY_LACSS RecName:
   67::354     5e-40  40%  371 aa  MRAY_ACAM1 RecName:
   60::346     7e-40  42%  363 aa  MRAY_PROM5 RecName:
   22::346     7e-40  40%  358 aa  MRAY_NOCFA RecName:
   25::319     9e-40  36%  322 aa  MRAY_LACH4 RecName:
   22::320     9e-40  38%  323 aa  MRAY_LACBA RecName:
   62::361     9e-40  36%  364 aa  MRAY_CYAP8 RecName:
   25::318     9e-40  34%  324 aa  MRAY_ANOFW RecName:
   33::331     3e-39  41%  340 aa  MRAY_STRTD RecName:
   33::331     3e-39  41%  340 aa  MRAY_STRT1 RecName:
   33::331     3e-39  41%  340 aa  MRAY_STRT2 RecName:
    1::135     4e-39  38%  410 aa  MRAY_GRAFK RecName:
   28::309     4e-39  44%  324 aa  MRAY_CLOBB RecName:
   65::363     4e-39  36%  367 aa  MRAY_ANAVT RecName:
   32::346     6e-39  35%  359 aa  MRAY_MYCLB RecName:
   32::346     8e-39  35%  359 aa  MRAY_MYCLE RecName:
   64::351     1e-38  44%  368 aa  MRAY_SYNS9 RecName:
   19::322     2e-38  36%  326 aa  MRAY_PELTS RecName:
   45::338     3e-38  41%  350 aa  MRAY_SYNSC RecName:
   32::348     3e-38  41%  369 aa  MRAY_RENSM RecName:
   27::305     3e-38  38%  311 aa  MRAY_KOSOT RecName:
   16::295     5e-38  37%  302 aa  MRAY_THEP1 RecName:
   16::295     6e-38  37%  302 aa  MRAY_THESQ RecName:
   23::333     6e-38  43%  335 aa  MRAY_STRU0 RecName:
   55::352     8e-38  34%  355 aa  MRAY_MICAN RecName:
   23::325     1e-37  39%  327 aa  MRAY_STRGC RecName:
    1::405     2e-37  44%  422 aa  MRAY_BACV8 RecName:
   16::295     5e-37  40%  302 aa  MRAY_THEMA RecName:
    1::405     5e-37  41%  422 aa  MRAY_BACFR RecName:
    1::405     5e-37  41%  422 aa  MRAY_BACFN RecName:
   22::345     7e-37  35%  360 aa  MRAY_SACEN RecName:
   18::358     7e-37  34%  369 aa  MRAY_ARTCA RecName:
   67::365     9e-37  37%  370 aa  MRAY_SYNS3 RecName:
   22::347     9e-37  33%  359 aa  MRAY_MYCUA RecName:
   22::347     9e-37  33%  359 aa  MRAY_MYCMM RecName:
    1::405     1e-36  37%  422 aa  MRAY_BACTN RecName:
   19::318     2e-36  40%  318 aa  MRAY_MOOTA RecName:
   68::361     2e-36  36%  365 aa  MRAY_CYAP7 RecName:
   29::318     2e-36  34%  324 aa  MRAY_BACA2 RecName:
   65::352     2e-36  36%  369 aa  MRAY_ANASP RecName:
   33::333     3e-36  41%  335 aa  MRAY_STRS7 RecName:
   33::333     3e-36  41%  335 aa  MRAY_STREM RecName:
   23::315     6e-36  39%  319 aa  MRAY_LACJO RecName:
   53::360     8e-36  39%  365 aa  MRAY_SYNPW RecName:
   33::333     8e-36  41%  335 aa  MRAY_STRE4 RecName:
   22::320     8e-36  44%  321 aa  MRAY_HELMI RecName:
   22::316     1e-35  44%  320 aa  MRAY_LEUCK RecName:
   23::315     1e-35  39%  319 aa  MRAY_LACGA RecName:
   64::360     1e-35  34%  365 aa  MRAY_SYNP2 RecName:
   34::323     3e-35  44%  329 aa  MRAY_LACLA RecName:
   31::355     4e-35  39%  365 aa  MRAY_CORK4 RecName:
   20::345     5e-35  34%  356 aa  MRAY_PROAC RecName:
   28::359     7e-35  33%  369 aa  MRAY_TROWT RecName:
   28::359     7e-35  33%  369 aa  MRAY_TROW8 RecName:
   23::359     3e-34  32%  369 aa  MRAY_CLAMS RecName:
   28::351     4e-34  32%  374 aa  MRAY_SALTO RecName:
   16::300     6e-34  42%  302 aa  MRAY_THENN RecName:
   30::342     6e-34  32%  351 aa  MRAY_THEFY RecName:
   23::292     6e-34  44%  336 aa  MRAY_STRPM RecName:
   23::292     6e-34  44%  336 aa  MRAY_STRPD RecName:
   23::292     6e-34  44%  336 aa  MRAY_STRPC RecName:
   23::292     6e-34  44%  336 aa  MRAY_STRPB RecName:
   23::292     6e-34  44%  336 aa  MRAY_STRP1 RecName:
   31::352     6e-34  40%  366 aa  MRAY_CORDI RecName:
   34::294     7e-34  40%  339 aa  MRAY_STRMU RecName:
   20::353     7e-34  39%  364 aa  MRAY_NOCSJ RecName:
   86::323     7e-34  40%  329 aa  MRAY_LACLM RecName:
   86::323     1e-33  40%  329 aa  MRAY_LACLS RecName:
   23::359     1e-33  32%  369 aa  MRAY_CLAM3 RecName:
   32::354     1e-33  33%  370 aa  MRAY_CORA7 RecName:
   65::352     2e-33  39%  363 aa  MRAY_NOSP7 RecName:
   22::347     2e-33  32%  359 aa  MRAY_MYCTU RecName:
   22::347     2e-33  32%  359 aa  MRAY_MYCTA RecName:
   22::347     2e-33  32%  359 aa  MRAY_MYCBT RecName:
   22::347     2e-33  32%  359 aa  MRAY_MYCBP RecName:
   22::347     2e-33  32%  359 aa  MRAY_MYCBO RecName:
   25::318     4e-33  32%  324 aa  MRAY_GEOTN RecName:
   18::350     6e-33  33%  360 aa  MRAY_BEUC1 RecName:
   28::351     2e-32  32%  374 aa  MRAY_SALAI RecName:
   24::315     3e-32  32%  319 aa  MRAY_LACF3 RecName:
   67::360     4e-32  37%  368 aa  MRAY_SYNP6 RecName:
   64::357     4e-32  37%  365 aa  MRAY_SYNE7 RecName:
   25::318     1e-31  34%  324 aa  MRAY_GEOKA RecName:
   25::311     2e-31  33%  321 aa  MRAY_ENTFA RecName:
   41::333     3e-31  33%  340 aa  MRAY_SYNJB RecName:
   22::343     6e-31  34%  366 aa  MRAY_COREF RecName:
   23::292     3e-30  42%  336 aa  MRAY_STRPF RecName:
   23::292     3e-30  42%  336 aa  MRAY_STRP6 RecName:
   23::292     4e-30  37%  336 aa  MRAY_STRPG RecName:
   22::347     5e-30  33%  359 aa  MRAY_MYCA1 RecName:
   25::320     6e-30  35%  326 aa  MRAY_OCEIH RecName:
   22::335     1e-29  36%  359 aa  MRAY_RHOSR RecName:
   22::335     1e-29  34%  359 aa  MRAY_RHOOB RecName:
   23::292     3e-29  41%  336 aa  MRAY_STRP8 RecName:
   19::316     5e-29  37%  334 aa  MRAY_DESAP RecName:
   25::116     9e-29  44%  324 aa  MRAY_BACCN RecName:
   27::309     2e-28  29%  334 aa  MRAY_SYMTH RecName:
   23::292     2e-28  41%  336 aa  MRAY_STRPZ RecName:
   23::289     8e-28  38%  306 aa  MRAY_DICT6 RecName:
   23::292     1e-27  41%  336 aa  MRAY_STRP3 RecName:
   29::318     1e-27  34%  324 aa  MRAY_BACSU RecName:
   23::290     2e-27  39%  307 aa  MRAY_DICTD RecName:
   26::113     4e-27  48%  305 aa  MRAY_DEIDV RecName:
   19::316     4e-27  39%  317 aa  MRAY_CLOAB RecName:
   22::347     5e-27  32%  359 aa  MRAY_MYCPA RecName:
   45::321     4e-26  35%  340 aa  MRAY_SYNJA RecName:
    1::303     2e-25  36%  323 aa  MRAY_CLOPS RecName:
    1::303     6e-25  36%  323 aa  MRAY_CLOP1 RecName:
   21::297     1e-24  39%  317 aa  MRAY_CLOPE RecName:
   22::308     4e-24  37%  320 aa  MRAY_LEUMM RecName:
   22::54      7e-24  45%  359 aa  MRAY_MYCS2 RecName:
   22::54      9e-24  43%  359 aa  MRAY_MYCSS RecName:
   22::54      9e-24  43%  359 aa  MRAY_MYCSK RecName:
   22::54      9e-24  43%  359 aa  MRAY_MYCSJ RecName:
   22::54      2e-23  45%  359 aa  MRAY_MYCVP RecName:
   32::119     2e-23  39%  359 aa  MRAY_MYCGI RecName:
   50::320     1e-22  30%  325 aa  MRAY_OENOB RecName:
   25::133     2e-22  40%  324 aa  MRAY_BACLD RecName:
   17::297     6e-22  38%  312 aa  MRAY_DEIRA RecName:
  205::354     2e-21  42%  371 aa  MRAY_PROMT RecName:
   70::172     1e-17  38%  378 aa  MRAY_THEEB RecName:
  197::318     4e-17  35%  324 aa  MRAY_BACP2 RecName:
  185::346     7e-16  31%  363 aa  MRAY_TREPS RecName:
  185::346     7e-16  31%  363 aa  MRAY_TREPA RecName:
  202::344     2e-14  34%  351 aa  MRAY_METTH RecName: Full=Putative
   47::338     5e-14  29%  350 aa  MRAY_GLOVI RecName:
   62::144     7e-13  45%  361 aa  MRAY_SYNR3 RecName:
  168::463     7e-13  28%  480 aa  MRAY_ARATH RecName:
  130::237     8e-12  35%  301 aa  Y1113_METJA RecName: Full=Putative glycosyltransferase MJ1113;     
  231::359     4e-05  29%  398 aa  RFE_MYCLE RecName: Full=Putative undecaprenyl-phosphate
  150::220     7e-05  37%  322 aa  GPT_SULSO RecName: Full=Putative
  181::280     9e-05  27%  408 aa  GPT_CRILO RecName: Full=UDP-N-acetylglucosamine--dolichyl-phosphate
  181::280     9e-05  27%  408 aa  GPT_CRIGR RecName: Full=UDP-N-acetylglucosamine--dolichyl-phosphate
  181::296     9e-05  24%  408 aa  GPT_BOVIN RecName: Full=UDP-N-acetylglucosamine--dolichyl-phosphate
  181::296     2e-04  24%  408 aa  GPT_HUMAN RecName: Full=UDP-N-acetylglucosamine--dolichyl-phosphate
  231::359     2e-04  29%  404 aa  RFE_MYCTU RecName: Full=Putative undecaprenyl-phosphate
  150::312     3e-04  25%  367 aa  WECA_SALTY RecName: Full=Undecaprenyl-phosphate
  150::312     3e-04  25%  367 aa  WECA_SALTI RecName: Full=Undecaprenyl-phosphate
  183::282     3e-04  26%  410 aa  GPT_MOUSE RecName: Full=UDP-N-acetylglucosamine--dolichyl-phosphate
  150::281     8e-04  29%  367 aa  WECA_SHIFL RecName: Full=Undecaprenyl-phosphate
  150::281     8e-04  29%  367 aa  WECA_ECOLI RecName: Full=Undecaprenyl-phosphate
  150::281     8e-04  29%  367 aa  WECA_ECOL6 RecName: Full=Undecaprenyl-phosphate
  150::281     8e-04  29%  367 aa  WECA_ECO57 RecName: Full=Undecaprenyl-phosphate
    1::365

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLIYLFEWLSHYFKGLEVFSSYISVRXXXXXXXXXXXXXXXGRPMISWLQKMQIGQIVRDDGPQSHFSKR
MRAY_FRATM      MLIYLFEWLSHYFKGLEVFSSYISVRXXXXXXXXXXXXXXXGRPMISWLQKMQIGQIVRDDGPQSHFSKR
MRAY_FRATN      MLIYLFEWLSHYFKGLEVFSSYISVRXXXXXXXXXXXXXXXGRPMISWLQRMQIGQIVRDDGPQSHFSKR
MRAY_FRATW      MLIYLFEWLSHYFKGLEVFSNYISVRXXXXXXXXXXXXXXXGRPMISWLQKMQIGQIVRDDGPQSHFSKR
MRAY_FRATO      MLIYLFEWLSHYFKGLEVFSSYISVRXXXXXXXXXXXXXXXGRPMISWLQKMQIGQIVRDDGPQSHFSKR
MRAY_FRATH      MLIYLFEWLSHYFKGLEVFSSYISVRXXXXXXXXXXXXXXXGRPMISWLQKMQIGQIVRDDGPQSHFSKR
MRAY_FRATF      MLIYLFEWLSHYFKGLEVFSSYISVRXXXXXXXXXXXXXXXGRPMISWLQKMQIGQIVRDDGPQSHFSKR
MRAY_FRATT      MLIYLFEWLSHYFKGLEVFSSYISVRXXXXXXXXXXXXXXXGRPMISWLQKMQIGQIVRDDGPQSHFSKR
MRAY_FRAT1      MLIYLFEWLSHYFKGLEVFSSYISVRXXXXXXXXXXXXXXXGRPMISWLQKMQIGQIVRDDGPQSHFSKR
MRAY_FRAP2      MLIYLFNWLSHYYKGLEVFSSYVSVRXXXXXXXXXXXXXXXGRPMIRWLQKMQIGQVVRDDGPQSHFSKR
MRAY_SHEAM      MLVYLAEYLTQFYTGFNVFS-YVTFRAILALLTALMFSLWWGPKLIERLQVLQIGQVVRNDGPESHFSKR
MRAY_SHEHH      MLVYLAEYLTQFYSGFNVFS-YVTFRAILGLMTALMFSLWWGPKMIARLQLMQIGQVVRNDGPESHFSKR
MRAY_SHELP      MLVYLAEYLTQFYTGFNVFS-YVTFRAILGLLTAMVFSLWWGPKMIERLQLLQIGQVVRNEGPESHFAKR
MRAY_ALCBS      MLLWLAEYLAQYHSGFLVVQ-YITLRGILSVLTALFIAFWVGPIMIRMLQEKQVGQAIRDDGPKSHLSKA
MRAY_ALISL      MIIWLSNFLEQYFPFFRLFE-YLSFRXXXXXXXXXXXXXWMGPKLIRWLQNLQIGQVVRDDGPESHFSKR
MRAY_VIBFM      MIIWLSNFLEQYFPFFRLFE-YLSFRXXXXXXXXXXXXXWMGPKLIAWLQNLQIGQVVRDDGPESHFSKR
MRAY_VIBF1      MIIWLSNFLEQYFPFFRLFE-YLSFRXXXXXXXXXXXXXWMGPKLIAWLQNLQIGQVVRDDGPESHFSKR
MRAY_ERWCT      MLVWLAEHLAKLYTGFNVFS-YLTFRAIVSLLTALVISLWMGPHMIAWLQRLQIGQVVRNEGPESHFSKR
MRAY_YERPY      MLVWLAEYLVKFYSGFNVFS-YLTFRAIVSLLTALFISLWMGPHLIAWLQKLQIGQVVRNDGPESHFSKR
MRAY_YERPS      MLVWLAEYLVKFYSGFNVFS-YLTFRAIVSLLTALFISLWMGPHLIAWLQKLQIGQVVRNDGPESHFSKR
MRAY_YERPP      MLVWLAEYLVKFYSGFNVFS-YLTFRAIVSLLTALFISLWMGPHLIAWLQKLQIGQVVRNDGPESHFSKR
MRAY_YERPN      MLVWLAEYLVKFYSGFNVFS-YLTFRAIVSLLTALFISLWMGPHLIAWLQKLQIGQVVRNDGPESHFSKR
MRAY_YERPE      MLVWLAEYLVKFYSGFNVFS-YLTFRAIVSLLTALFISLWMGPHLIAWLQKLQIGQVVRNDGPESHFSKR
MRAY_YERPB      MLVWLAEYLVKFYSGFNVFS-YLTFRAIVSLLTALFISLWMGPHLIAWLQKLQIGQVVRNDGPESHFSKR
MRAY_YERPA      MLVWLAEYLVKFYSGFNVFS-YLTFRAIVSLLTALFISLWMGPHLIAWLQKLQIGQVVRNDGPESHFSKR
MRAY_YERP3      MLVWLAEYLVKFYSGFNVFS-YLTFRAIVSLLTALFISLWMGPHLIAWLQKLQIGQVVRNDGPESHFSKR
MRAY_PHOLL      MLVWLAEYLVKYHSGFNVFS-YLTFRAIVSLLTALAIALWMGPRMIAFLQKLQIGQVVRNDGPESHFSKR
MRAY_EDWI9      MLVWLAEHLVKYFSGFNVFS-YLTFRAIVSLLTALFISLWMGPRLIGWLQKLQIGQVVRNDGPESHFSKR
MRAY_PSEA6      ----LADWLQQFEPSFRVFS-YXXXXXXXXXXXXXXXXXXXGPRMIRWLQTMQIGQTVRDDGPQSHLAKS
MRAY_PECCP      MLVWLAEHLAKLYTGFNVFS-YLTFRAIVSLLTALVISLWMGPHMIAWLQRLQIGQVVRNEGPESHFSKR
MRAY_YERPG      MLVWLAEYLVKFYSGFNVFS-YLTFRAIVSLLTALFISLWMGPHLIAWLQKLQIGQVVRNDGPESHFSKR
MRAY_SHEB9      MLVYLAEYLTRFHTGFNVFS-YVTFRAILGLLTALVFSLWFGPKLIERLQLLQIGQVVRNDGPESHFSKR
MRAY_SHEB5      MLVYLAEYLTRFHTGFNVFS-YVTFRAILGLLTALVFSLWFGPKLIERLQLLQIGQVVRNDGPESHFSKR
MRAY_SHEB2      MLVYLAEYLTRFHTGFNVFS-YVTFRAILGLLTALVFSLWFGPKLIERLQLLQIGQVVRNDGPESHFSKR
MRAY_SODGM      MLVWLAEHLVQFYSGFNVFS-YLTFRAIVSLLTALFLSLWMGPRLIAWLQKLQIAQVVRNDGPESHFSKR
MRAY_SHEB8      MLVYLAEYLTRFHTGFNVFS-YVTFRAILGLLTALVFSLWFGPKLIERLQLLQIGQVVRNDGPESHFSKR
MRAY_VIBHB      MIIWLAELLQPYLSFFRLFE-YLSFRAILSVLTALGLSLWMGPIMIKRLQMLQIGQVVRNEGPESHFSKR
MRAY_VIBPA      MIIWLAELLQPYLSFFRLFE-YLSFRAILSVLTALGLSLWMGPIMIKRLQMLQIGQVVRNEGPESHFSKR
MRAY_PSEPK      MLLLLAEYLQQFHKGFAVFQ-YLSLRGILGVLTALSLALWLGPWMIRTLQIRQIGQAVRNDGPQSHLSKS
MRAY_PSEPG      MLLLLAEYLQQFHKGFAVFQ-YLSLRGILGVLTALSLALWLGPWMIRTLQIRQIGQAVRNDGPQSHLSKS
MRAY_PSEPF      MLLLLAEYLQQFYKGFAVFQ-YLTLRGILGVLTALVLSLCYGPWMIRTLQNRQIGQSVRNDGPQSHLSKS
MRAY_PSEP1      MLLLLAEYLQQFHKGFAVFQ-YLSLRGILGVLTALSLALWLGPWMIRTLQIRQIGQAVRNDGPQSHLSKS
MRAY_IDILO      MLVWLAEYLTQFESAFNVFS-YLTLRAILSVLTALVLSLWLGPTLIRRLQRLQIGQTVRDDGPESHLVKS
MRAY_VIBVY      MIIWLAELLQPYFSFFRLFE-YLSFRAILSVLTALGLSLWMGPRLIKRLQLLQIGQVVRNEGPESHFSKR
MRAY_YERE8      MLVWLAEYLVKFYSGFNVFS-YLTFRAIVSLLTALIISLWMGPHLIAYLQKLQIGQVVRNDGPESHFSKR
MRAY_XANAC      MLLELARWLQQLESLFGLFN-YLTFRGILAALTALFLSLWMGPAVIRKLAQFKGGQPIRQDGPQTHFSKA
MRAY_VIBVU      MIIWLAELLQPYFSFFRLFE-YLSFRAILSVLTALGLSLWMGPRLIKRLQLLQIGQVVRNEGPESHFSKR
MRAY_SERP5      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFLSLWMGPRVIKRLQEMSFGQVVRNDGPESHFSKR
MRAY_PSEPW      MLLLLAEYLQQFHKGFAVFQ-YLSLRGILGVLTALSLALWLGPWMIRTLQIRQIGQAVRNDGPQSHLSKS
MRAY_XANCP      MLLELARWLQQLESLFGLFN-YLTFRGILAALTALFLSLWMGPAVIRKLAQFKGGQPIRQDGPQTHFSKA
MRAY_XANCB      MLLELARWLQQLESLFGLFN-YLTFRGILAALTALFLSLWMGPAVIRKLAQFKGGQPIRQDGPQTHFSKA
MRAY_XANC8      MLLELARWLQQLESLFGLFN-YLTFRGILAALTALFLSLWMGPAVIRKLAQFKGGQPIRQDGPQTHFSKA
MRAY_XANC5      MLLELARWLQQLESLFGLFN-YLTFRGILAALTALFLSLWMGPAVIRKLAQFKGGQPIRQDGPQTHFSKA
MRAY_XANOP      MLLELARWLQQLESLFGLFN-YLTFRGILAALTALFLSLWMGPAVIRKLAQFKGGQPIRQDGPQTHFSKA
MRAY_PSEU5      MLLLLAEYLQQFHKGFAVFQ-YLSLRGILGVLTALVLSLWMGPWLIRTLQLRQIGQAVRTDGPQSHLSKS
MRAY_PSEMY      MLLLLAEYLQQFHKGFAVFQ-YLTLRGILGVLTALALSLWLGPWMIRTLQVRQIGQAVRNDGPQSHLSKK
MRAY_XANOR      MLLELARWLQQLESLFGLFN-YLTFRGILAALTALFLSLWMGPAVIRKLAQFKGGQPIRQDGPQTHFSKA
MRAY_XANOM      MLLELARWLQQLESLFGLFN-YLTFRGILAALTALFLSLWMGPAVIRKLAQFKGGQPIRQDGPQTHFSKA
MRAY_PSEF5      MLLLLAEYLQQFYKGFAVFQ-YLTLRGILGVLTALSLALCLGPWMIRTLQNRQIGQSVRNDGPQSHLSKS
MRAY_ERWT9      MLVWLAEHLVTFYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIARLQEMSFGQVVRNDGPESHFSKR
MRAY_THICR      MLIYLTDYLSQYISGFSVFH-YITMRTIMSVLTALLISFVIGPRVIRWLIRLKVGQSIRLDGPETHLIKT
MRAY_METCA      MLLILANWLEHYFDVFRVFH-YLTLRGILGILTALVISFIVGPPMIRYLGSYKIGQTIRDDGPQSHLSKA
MRAY_PSEE4      MLLLLAEYLQQFHKGFAVFQ-YLTLRGILGVLTALSLALWLGPWMIRTLQIRQIGQAVRNDGPQSHLSKS
MRAY_SHEWM      MLVYLAEYLTQFYTGFNVFS-YVTFRAILGLMTALMFSLWWGPKMIERLQMLQIGQIVRNDGPESHFSKR
MRAY_SHEFN      MLVYLAEYLTQFYSGFNVFS-YVTFRAILGLLTALVFSLWWGPILIKHLQTLQIGQVVRDDGPESHFSKR
MRAY_SHESH      MLVYLAEYLTQFYSGFNVFS-YVTFRAILGLLTALIFSLWWGPKMIERLQMLQIGQVVRNDGPESHFSKR
MRAY_PSEFS      MLLLLAEYLQQFHKGFAVFQ-YLTLRGILGVLTALCLSLFLGPWMIRTLQNLQIGQSVRNDGPQSHLSKS
MRAY_PSEAE      MLLLLAEYLQQFYKGFGVFQ-YLTLRGILSVLTALSLSLWLGPWMIRTLQIRQIGQAVRNDGPQSHLSKK
MRAY_PSEAB      MLLLLAEYLQQFYKGFGVFQ-YLTLRGILSVLTALSLSLWLGPWMIRTLQIRQIGQAVRNDGPQSHLSKK
MRAY_PSEA8      MLLLLAEYLQQFYKGFGVFQ-YLTLRGILSVLTALSLSLWLGPWMIRTLQIRQIGQAVRNDGPQSHLSKK
MRAY_PSEA7      MLLLLAEYLQQFYKGFGVFQ-YLTLRGILSVLTALSLSLWLGPWMIRTLQIRQIGQAVRNDGPQSHLSKK
MRAY_SHESR      MLVYLAEYLTRFHTGFNVFS-YVTFRAILGLLTALMFSLWWGPKLIERLQLMQIGQVVRNDGPESHFSKR
MRAY_SHESM      MLVYLAEYLTRFHTGFNVFS-YVTFRAILGLLTALMFSLWWGPKLIERLQLMQIGQVVRNDGPESHFSKR
MRAY_SHESA      MLVYLAEYLTRFHTGFNVFS-YVTFRAILGLLTALMFSLWWGPKLIERLQLMQIGQVVRNDGPESHFSKR
MRAY_PSE14      MLLLLAEFLQQFYKGFAVFQ-YLSLRGILGVLTALTLSLCLGPWMIRTLQMRQIGQSVRNDGPQSHLSKS
MRAY_PSEU2      MLLLLAEFLQQFYKGFAVFQ-YLSLRGILGVLTALTLSLCLGPWMIRTLQMRQIGQSVRNDGPQSHLSKS
MRAY_PSESM      MLLLLAEFLQQFYKGFAVFQ-YLSLRGILGVLTALTLSLCLGPWMIRTLQMRQIGQSVRNDGPQSHLSKS
MRAY_SHEON      MLVYLAEYLTRFHTGFNVFS-YVTFRAILGLLTALMFSLWWGPKLIERLQLMQIGQVVRNDGPESHFSKR
MRAY_RUTMC      MFLELINFLAQFDAGFNVLN-YLTVRAILAMLSALFFSLMLGRVFINQLQQYQIGQIIRTDGPKSHLIKA
MRAY_CHRSD      MLLFLADLLAHFQSAFNVFN-YLTLRVILGTLTALMLCLWLGPQVIRRLVERQIGQAVRDDGPQSHLSKA
MRAY_COXBR      MLLWLTNFLSQHFHAFRVFN-YLTFRSIVSALTALILVLSLSPRLIKYLVSLQVGQMVRNDGPQTHLKKS
MRAY_COXBU      MLLWLTNFLSQHFHAFRVFN-YLTFRSIVSALTALILVLSLSPRLIKYLVSLQVGQMVRNDGPQTHLKKS
MRAY_COXBN      MLLWLTNFLSQHFHAFRVFN-YLTFRSIVSALTALILVLSLSPRLIKYLVSLQVGQMVRNDGPQTHLKKS
MRAY_COXB2      MLLWLTNFLSQHFHAFRVFN-YLTFRSIVSALTALILVLSLSPRLIKYLVSLQVGQMVRNDGPQTHLKKS
MRAY_COXB1      MLLWLTNFLSQHFHAFRVFN-YLTFRSIVSALTALILVLSLSPRLIKYLVSLQVGQMVRNDGPQTHLKKS
MRAY_PROMH      MLVWLAEYLVKYHTFFNVFS-YLTFRAIVGLLTALIIALWMGPHLIAWLQKMQIGQVVRNEGPESHFSKR
MRAY_ACTP2      MLVWLAEYLVQYNTAFNVVS-YITFRAIMALLTAMGIGLWIGPEVIRRLQLLKFGQEVRNDGPESHFKKR
MRAY_ACTPJ      MLVWLAEYLVQYNTAFNVVS-YITFRAIMALLTAMGIGLWIGPEVIRRLQLLKFGQEVRNDGPESHFKKR
MRAY_PHOPR      MIYWLADLLEPSYPFFRLFE-YLTFRAIMSVLTALILSLWMGPRLIARLQMLQIGQVVRNDGPESHFSKR
MRAY_AZOVD      MLLLLAEYLQQFHTGFAVVQ-YLTLRGILGVLTALILALCLGPWMIRTLQIRQIGQAVRDDGPQSHLSKK
MRAY_MANSM      MLVWFAKFLEQYYSGFNVVS-YLTFRSVXXXXXXXXXXXWIGPKMIRRLQIFKFGQEVRNDGPESHFQKR
MRAY_ACTP7      MLVWLAEYLVQYNTAFNVVS-YITFRAIMALLTAMGIGLWIGPEVIRRLQLLKFGQEVRNDGPESHFKKR
MRAY_SHEPW      MLVYLAEYLTQFYSGFNVFS-YVTFRAILGLMTALMFSLWWGPKMIERLQLLQIGQVVRNDGPESHFSKR
MRAY_SHEPA      MLVYLAEYLTQFYTGFNVFS-YVTFRAILGLMTAMVFSLWWGPKMIARLQVMQIGQVVRNDGPESHFSKR
MRAY_NITEU      MLLALSQWIAEDIRAFNVFS-YIXXXXXXXXXXXXSISFLIGPAMIRSLTARKVGQSVRNDGPQSHLIKA
MRAY_MARMS      MLLLLTAYLSKYHTFFTVFN-YLSLRAILGVLTALAISLLVGNKVIVLLQRLQIGQAVRSDGPQTHLSKA
MRAY_DESAA      MLYHLLTPLAKYMTVFNVFR-YITFRTIYASLTALVISFVLGPWLIRKLGEMQVGQHIREDGPQTHLKKA
MRAY_LARHH      MLLWLADWLGEYVRAFNVFN-YVTLRAVLASLTALGIGLALGPWVIRKLAELKVGQAVRTDGPQTHLVKT
MRAY_METFK      MLLELARWLAQDIRGFNVFN-YIXXXXXXXXXXXXXISFLVGPKLIRKLTEYKVGQSVRDDGPQTHLVKA
MRAY_MARAV      MLLWLTEILSQYFSSLTVFQ-YLTLRAILGILTALLISLVIGPVMIRKLSQYQIGQAVRDDGPQTHLSKA
MRAY_SHEVI      MLVYLAEYLTQFYSGFNVFS-YVTFRAILGLMTALVFCLWWGPKMIRRLQTLQIGQVVRSDGPESHFSKS
MRAY_HAES2      MLVWLAEYLHQYQSVFNVFS-YLTVRXXXXXXXXXXXXXWIGPKVIRRLQILKFGQEIRNDGPDSHLSKK
MRAY_HAES1      MLVWLAEYLHQYQSVFNVFS-YLTVRXXXXXXXXXXXXXWIGPKVIRRLQILKFGQEIRNDGPDSHLSKK
MRAY_XYLFA      MLFELARWLQQ-FESLFGLFNYLTFRSILAALTALFLSLWIGPVLIQKLSQFKGGQPIRQDGPKMHFSKA
MRAY_CHRVO      MLLWLADLLGSHIRAFNVFN-YTTLRAVMXXXXXXXXXXXXGPWVIRKLTELKVGQAVRNDGPQTHLVKA
MRAY_ALTMD      MLIWLADWLTQFDSGFNVFS-YXXXXXXXXXXXXXXXXXXXGPKMIRYLQRMQIGQTVRDDGPQSHLSKS
MRAY_XYLFT      MLFEFARWLQQ-FESLFGLFNYLTFRSILAALTALFLSLWIGPVLIQKLSQFKGGQPIRQDGPKMHFSKA
MRAY_XYLFM      MLFEFARWLQQ-FESLFGLFNYLTFRSILAALTALFLSLWIGPVLIQKLSQFKGGQPIRQDGPKMHFSKA
MRAY_XYLF2      MLFEFARWLQQ-FESLFGLFNYLTFRSILAALTALFLSLWIGPVLIQKLSQFKGGQPIRQDGPKMHFSKA
MRAY_THISH      MLLSLFEFLSEYYRGFNVFQ-YLTLRAILGVLTALIIAFLVGPAMIRRLSLYKIGQQVRTDGPQTHLTKA
MRAY_PSYWF      MLYWLFDWLSQFYSPFSAVSS-VTLRTLLTVITSLAFSIILGPRTIAYLRSVKYDQAVRDDGPKTHLAKT
MRAY_AZOSB      MLLELALWLGQDIRGFNVFG-YIXXXXXXXXXXXXXXXXXXGPGVIRWLAAKKIGQAVRDDGPKSHLTKA
MRAY_ALHEH      MLYHLAMALEGVYSGFNVFQ-YLTFRTILGVLTALGIALLVGPAVIQRLVEHQIGQQVRDDGPQSHLSKA
MRAY_BURP8      MLLALAQWLQNDVGFLRVFS-YLTFRAVAATITALLIGLVCGPWVIRKLTQMKVGQAVRKDGPQTHLVKS
MRAY_SHESW      MLVYLAEYLTRFYTGFNVFS-YVTFRAILGLLTALIFSLWWGPKLIERLQLLQIGQVVRNDGPESHFSKR
MRAY_SHEPC      MLVYLAEYLTRFYTGFNVFS-YVTFRAILGLLTALIFSLWWGPKLIERLQLLQIGQVVRNDGPESHFSKR
MRAY_COLP3      MLLWLGEYLTQFYSAFNVFS-YLTFRAIISTLTALFISLYFGPKLIRYLQKMQIGQTVRDDGPESHLSKS
MRAY_ACIAD      MLLWLFEHLSGYNSSFQVXXXXXXXXXXXXXXXXAIGLML-GPVMIRKLQALKYGQAVSSFAPENHAKKM
MRAY_SALTY      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIARLQKLSFGQVVRNDGPESHFSKR
MRAY_SALTI      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIARLQKLSFGQVVRNDGPESHFSKR
MRAY_SALSV      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIARLQKLSFGQVVRNDGPESHFSKR
MRAY_SALPB      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIARLQKLSFGQVVRNDGPESHFSKR
MRAY_SALNS      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIARLQKLSFGQVVRNDGPESHFSKR
MRAY_SALHS      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIARLQKLSFGQVVRNDGPESHFSKR
MRAY_SALG2      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIARLQKLSFGQVVRNDGPESHFSKR
MRAY_SALEP      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIARLQKLSFGQVVRNDGPESHFSKR
MRAY_SALDC      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIARLQKLSFGQVVRNDGPESHFSKR
MRAY_SALCH      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIARLQKLSFGQVVRNDGPESHFSKR
MRAY_SALAR      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIARLQKLSFGQVVRNDGPESHFSKR
MRAY_SALA4      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIARLQKLSFGQVVRNDGPESHFSKR
MRAY_PSEHT      MLVWLAEYLTQYYTGFNVFS-YLTLRAILGILTALMMSLYLGPKLIRALQRMQIGQTVRDDGPQSHLSKS
MRAY_VIBCM      MIIWLAELLQPYFSFFRLFE-YLSFRAIVSILTALGISLWMGPRMIKRLQMLQIGQVVRNEGPESHFSKR
MRAY_VIBCH      MIIWLAELLQPYFSFFRLFE-YLSFRAIVSILTALGISLWMGPRMIKRLQMLQIGQVVRNEGPESHFSKR
MRAY_SALPC      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIARLQKLSFGQVVRNDGPESHFSKR
MRAY_LEGPH      MLYWLTQLLQGQYHAFRVFQ-YLTFRSILASLTALIVGLLCGPLMIRWLRGLQIGQMVRSDGPQTHLSKA
MRAY_LEGPC      MLYWLTQLLQGQYHAFRVFQ-YLTFRSILASLTALIVGLLCGPLMIRWLRGLQIGQMVRSDGPQTHLSKA
MRAY_LEGPA      MLYWLTQLLQGQYHAFRVFQ-YLTFRSILASLTALIVGLLCGPLMIRWLRGLQIGQMVRSDGPQTHLSKA
MRAY_VIBC3      MIIWLAELLQPYFSFFRLFE-YLSFRAIVSILTALGISLWMGPRMIKRLQMLQIGQVVRNEGPESHFSKR
MRAY_RALPJ      MLLALAQWLQNDYGFLRVFN-YLTFRAVMASLTALVIGLGFGPFVIRRLTELKVGQAVRSYGPQTHLVKA
MRAY_SHEDO      MLVYLAEYLTQFHTGFHVFS-YVTFRAILGLLTALVFSLWCGPKXXXXXXXXXXGQVVRNDGPESHFSKR
MRAY_SALPK      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIARLQKLSFGQVVRNDGPESHFSKR
MRAY_SALPA      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIARLQKLSFGQVVRNDGPESHFSKR
MRAY_KLEP3      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIARLQKLSFGQVVRNDGPESHFSKR
MRAY_DELAS      MLLMLSQWLSPEFGFLRVFQ-YLTMRAVMAALTALVIGLLAGPRLIRMLTSLKIGQPVRGYGMETHLAKS
MRAY_LEGPL      MLYWLTQLLQGQYHAFRVFQ-YLTFRSILASLTALIVGLLCGPLMIRWLRGLQIGQMVRSDGPQTHLSKA
MRAY_KLEP7      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIARLQKLAFGQVVRNDGPESHFSKR
MRAY_CELJU      MLYWLAEYLQEYMRGFAVFQ-YLTVRAILSVLTALGISLLLGPWVIRRLTEMRIGQAVRSDGPQTHLSKS
MRAY_BORPD      MLLEIARWLSDDVRAIGVLE-YITMRAVLACATALLIGLVAGPRVIRKLTEMKIGQAVRAYGPESHLVKT
MRAY_POLNA      MLLSLAQWLSPELGFLRVFQ-YLTFRALMAAMTALLIGLLAGPFVIRRLISLKIGQPIREYAMQTHLSKS
MRAY_HERAR      -------WLAQHFQDLRVFN-FITFRAVFATLTALAIGLFFGPMVIRMLQRLKVGQAVRTDGPQTHLIKS
MRAY_ENTS8      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRLIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_JANMA      -------WLAQYFQDLRVFN-FITFRAVFATLTALVIGLVTGPAVIRMLTRLKVGQAVRTDGPQTHLIKS
MRAY_ENT38      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIARLQKLSFGQVVRNDGPESHFSKR
MRAY_PASMU      MLVWLGEFLQQYYSGFNVIS-YITVRXXXXXXXXXXXXXWIGPKVIRRLQLLKFGQEVRHDGPESHFSKR
MRAY_TOLAT      MLVWLAEWLTPHLSFFHVVS-YLTFRAIMSILTGLGFALWXXXXXXXXXXXXXXXXXXXNDGPESHFSKA
MRAY_BURTA      MLLALAQWLQGDASFLRLFT-YLTFRAVMATITALVIGLVCGPWVIRKLTQMKVGQAVRKDGPQTHLVKS
MRAY_BURPS      MLLALAQWLQGDASFLRLFT-YLTFRAVMATITALVIGLVCGPWVIRKLTQMKVGQAVRKDGPQTHLVKS
MRAY_BURP6      MLLALAQWLQGDASFLRLFT-YLTFRAVMATITALVIGLVCGPWVIRKLTQMKVGQAVRKDGPQTHLVKS
MRAY_BURP1      MLLALAQWLQGDASFLRLFT-YLTFRAVMATITALVIGLVCGPWVIRKLTQMKVGQAVRKDGPQTHLVKS
MRAY_BURP0      MLLALAQWLQGDASFLRLFT-YLTFRAVMATITALVIGLVCGPWVIRKLTQMKVGQAVRKDGPQTHLVKS
MRAY_BURMS      MLLALAQWLQGDASFLRLFT-YLTFRAVMATITALVIGLVCGPWVIRKLTQMKVGQAVRKDGPQTHLVKS
MRAY_BURMA      MLLALAQWLQGDASFLRLFT-YLTFRAVMATITALVIGLVCGPWVIRKLTQMKVGQAVRKDGPQTHLVKS
MRAY_BURM9      MLLALAQWLQGDASFLRLFT-YLTFRAVMATITALVIGLVCGPWVIRKLTQMKVGQAVRKDGPQTHLVKS
MRAY_BURM7      MLLALAQWLQGDASFLRLFT-YLTFRAVMATITALVIGLVCGPWVIRKLTQMKVGQAVRKDGPQTHLVKS
MRAY_BURM1      MLLALAQWLQGDASFLRLFT-YLTFRAVMATITALGIGLVCGPWVIRKLTEMKVGQAVRKDGPQTHLVKS
MRAY_BURXL      MLLALAQWLQNDASFLRVFS-YLTFRAVMATITALLIGLVCGPAVIRKLTAMKVGQAVRKDGPQTHLVKS
MRAY_BURPP      MLLALAQWLQNDASFLRVFS-YLTFRAVMATITALLIGLVCGPAVIRKLTAMKVGQAVRKDGPQTHLVKS
MRAY_ACIF5      MLYALFMQLGSLYHGFYVFQ-YXXXXXXXXXXXXXXXXXFIGPFFIARLRRYKIGQMVRNDGPETHLIKQ
MRAY_ACIF2      MLYALFMQLGSLYHGFYVFQ-YXXXXXXXXXXXXXXXXXFIGPFFIARLRRYKIGQMVRNDGPETHLIKQ
MRAY_BURVG      MLLALAQWLQGDASFLRLFT-YLTFRAVMATITALGIGLVCGPWVIRKLTQMKVGQAVRKDGPQSHLVKS
MRAY_ACIBY      --------------------------------------------MIRKLQALKYGQAVSSFAPENHAKKM
MRAY_ACIBS      --------------------------------------------MIRKLQALKYGQAVSSFAPENHAKKM
MRAY_ACIBC      --------------------------------------------MIRKLQALKYGQAVSSFAPENHAKKM
MRAY_ACIB5      --------------------------------------------MIRKLQALKYGQAVSSFAPENHAKKM
MRAY_BURCM      MLLALAQWLQGDASFLRLFT-YLTFRAVMATITALGIGLVCGPWVIRKLTQMKVGQAVRKDGPQSHLVKS
MRAY_BURA4      MLLALAQWLQGDASFLRLFT-YLTFRAVMATITALGIGLVCGPWVIRKLTQMKVGQAVRKDGPQSHLVKS
MRAY_THIDA      MLLWLFQQLGEDIRAFNVFN-YXXXXXXXXXXXXXXISFIVGPAVIRKLTALKIGQSVRSDGPQTHLVKA
MRAY_PSYA2      MLVWLFGWLGQYYAPFSAVSS-LTLRALLAVITALAFSMIFGSRVIRRLRALKYGQAIRNDGPQSHLVKT
MRAY_NEIMF      ----MFLWLAHFLTGLNIFQ-YTTFRAVMAALTALAFSLMFGPWTIRRLTALKCGQAVRTDGPQTHLVKN
MRAY_NEIMB      ----MFLWLAHFLTGLNIFQ-YTTFRAVMAALTALAFSLMFGPWTIRRLTALKCGQAVRTDGPQTHLVKN
MRAY_CITK8      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIARLQKLSFGQVVRNDGPESHFSKR
MRAY_POLSJ      MLLSLAQWLSPEFGSFRVFQ-YLTFRAVMXXXXXXXXXXXXXPFVIRRLISLKIGQPIREYAMQTHLSKS
MRAY_NEIMA      ----MFLWLAHFLTGLNIFQ-YTTFRAVMAALTALAFSLMFGPWTIRRLTALKCGQAVRTDGPQTHLVKN
MRAY_NEIM0      ----MFLWLAHFLTGLNIFQ-YTTFRAVMAALTALAFSLMFGPWTIRRLTALKCGQAVRTDGPQTHLVKN
MRAY_NEIG2      ----MFLWLAHFLTGLNIFQ-YTTFRAVMAALTALAFSLMFGPWTIRRLTALKCGQAVRTDGPQTHLVKN
MRAY_NEIG1      ----MFLWLAHFLTGLNIFQ-YTTFRAVMAALTALAFSLMFGPWTIRRLTALKCGQAVRTDGPQTHLVKN
MRAY_BURS3      MLLALAQWLQGDASFLRLFT-YLTFRAVMATITALGIGLVCGPWVIRKLTQMKVGQAVRKDGPQTHLVKS
MRAY_BURCJ      MLLALAQWLQGDASFLRLFT-YLTFRAVMATITALGIGLVCGPWVIRKLTQMKVGQAVRKDGPQTHLVKS
MRAY_BURCH      MLLALAQWLQGDASFLRLFT-YLTFRAVMATITALGIGLVCGPWVIRKLTQMKVGQAVRKDGPQTHLVKS
MRAY_BURCC      MLLALAQWLQGDASFLRLFT-YLTFRAVMATITALGIGLVCGPWVIRKLTQMKVGQAVRKDGPQTHLVKS
MRAY_BURCA      MLLALAQWLQGDASFLRLFT-YLTFRAVMATITALGIGLVCGPWVIRKLTQMKVGQAVRKDGPQTHLVKS
MRAY_ECOSM      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_ECOLU      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_ECO7I      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_RALSO      MLLALAQWLQNDFGFLRVFN-YLTFRAVMASLTALVIGLGFGPWVIRRLTELKVGQAVRSYGPQTHLVKA
MRAY_HALHL      MLYHLAMVLETFYSGFNVFQ-YITFRTILGVLTALGIALMIGPAVIQRLVLHQVGQQVRDDGPETHLEKA
MRAY_VEREI      -----------------------------------------GSWVIGKLMALKIGQPIRGYAPQSHLSKS
MRAY_TERTT      MLVWLANFLESYVSGFGVFQ-YLTLRAILGVLTALGLSMVLGPWVIRKLNELQIGQAIRDDGPQSHLSKS
MRAY_PSYCK      MLVWLFSWLGHYYAPF-YXXXXXXXXXXXXXXXXXXFSMVFGNRVIRRLRALKYGQAIRNDGPQSHLVKT
MRAY_POLNS      MLLMLAQWLQDDFGFFRVFN-YITFRAVMATVTALLIGLAAGPWVIRKLAALKVGQAVRTDGPQTHLVKS
MRAY_LEPCP      MLVSLANWLQGHYPGFLRVVQYLTFRAVMSAMTALLLGLVFGPWVIRRLTELKIGQPVREYGVQSHLVKT
MRAY_VARPS      MLMSLAQWLSPEFGFLRVFQ-YLTFRXXXXXXXXXXXXXXXGPYVIRRLAALKIGQPVRGYGMETHLTKS
MRAY_RALEJ      MLLALAQWLQNDYSFLRVVN-YLTFRAVMANLTALVIGLAAGPWVIRKLTELKVGQAVRTIGPQTHLVKS
MRAY_POLSQ      MLLILAQWLQDDFGFFRVFN-YITFRAVMATVTALLIGLAAGPWVIRKLSELKMGQAVRTDGPLTHLVKS
MRAY_HAEI8      MLVWLAEYLVRYETAFNAIS-YITVRAILALLTALFISLWIGPKVIKRLQILKFGQEVRNDGPESHFAKK
MRAY_HAEIN      MLVWLAEYLVRYETAFNAIS-YITVRANLALLTALFISLWIGPKVIKRLQILKFGQEVRNDGPESHFAKK
MRAY_HAEIG      MLVWLAEYLVRYETAFNAIS-YITVRAILALLTALFISLWIGPKVIKRLQILKFGQEVRNDGPESHFAKK
MRAY_HAEIE      MLVWLAEYLVRYETAFNAIS-YITVRAILTLLTALFISLWIGPKVIKRLQILKFGQEVRNDGPESHFAKK
MRAY_DESAH      ----LFHYLYPLHTEISFFNRYITFRTIYGGLTAFLICFLLGPWVINRLSRMQIGQFIQNDGPETHFEKE
MRAY_BORPE      ---------------------YITLRAVLACATALLIGLVAGPRVIRRLTEMKIGQAVRAYGPESHLVKT
MRAY_BORBR      ---------------------YITLRAVLACATALLIGLVAGPRVIRRLTEMKIGQAVRAYGPESHLVKT
MRAY_RHOFD      MLPSLAQWLSPEFGFLRVFQ-YLTFRXXXXXXXXXXXXXXXXPFVIRRLTELKIGQPIRGYGMDSHLSKS
MRAY_BORPA      ---------------------YITLRAVLACATALLIGLVAGPRVIRRLTEMKIGQAVRAYGPESHLVKT
MRAY_VIBSL      MIIWLAELLQPHFSFFRLFE-YLSFRAIASILTALCLSLWMGPRLIERLQMLQIGQVVRNDGPESHFSKR
MRAY_GEOSL      MLYHLLYPLAADFRIFNVFK-YLTFRTIYAVITALVVSFILGPWVIRKLEALQARQVIRTDGPESHLKKS
MRAY_DIAST      MLLMLTQWLSPELSFLRVFQ-YLTLRAVMXXXXXXXXXXXXXPKVIRMLTSLKIGQPIRGYAMQTHLSKS
MRAY_ACISJ      MLLMLTQWLSPELSFLRVFQ-YLTLRAVMXXXXXXXXXXXXXPKVIRMLTSLKIGQPIRGYAMQTHLSKS
MRAY_PSYIN      MIVWLAELLSSQFTFLNVLT-YLSVRTVMAVLTALAFSLFFGPKLIRFLQKFQIGQIVRQDGPESHFSKA
MRAY_RHOCS      MLFNLLYPLADEFQIFNLFR-YITFRTGGAMVTALLISFVIGPRVIRWLKSVQEGQPIRTDGPETHLKKK
MRAY_NITOC      MLLYVTDYLARFDSGFHVFQ-YLTLRAILGVLTALVISFVVGPPMIRRLKF--VGQPVRSNGPTTHLCKA
MRAY_RHISN      MLIWLVE-LADHFQFFNLFR-YITFRTGAALFTSALIVFLFGPAIISSLRIRQKGQPIRADGPQTHFKKA
MRAY_NITEC      MLLALFQWIAEDIRAFNVFS-YIXXXXXXXXXXXXSISFLIGPAMIRSLTTRKVGQSVRSDGPQSHLTKA
MRAY_DICNV      MLYALATGLSAIFTPLNALT-YLTSRIILGALTALLLSIFCGGKMIRYLQKMQMGQFVRDDGPKTHLKKA
MRAY_SHIDS      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_ECOL6      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_ECO81      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_ECO5E      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_ECO57      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_WIGBR      MLVWLCEKLVYLYSGFNVFS-YXXXXXXXXXXXXXXXXXXXGPRVILFLKKFQIKQIIRLDGPKSHLYKC
MRAY_SHISS      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_SHIFL      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_SHIF8      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_SHIBS      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_SHIB3      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_ESCF3      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_ECOUT      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_ECOSE      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_ECOLI      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_ECOLC      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_ECOL5      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_ECOK1      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_ECOHS      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_ECODH      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_ECOBW      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_ECO8A      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_ECO55      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_ECO45      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_ECO27      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_ECO24      MLVWLAEHLVKYYSGFNVFS-YLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRNDGPESHFSKR
MRAY_VESOH      MFLELINFITQFDTKFNVLN-YLTIRALLAMLSALFIGLMLGRIFIKRLQQCHINQVIRTDGPKSHLIKV
MRAY_SACD2      MLLWLAEYLQQYISAFAVVK-YLTFRAILGVMTALGLSLLLGPWVINKLNKLQIGQSIRDDGPESHLVKS
MRAY_PELPD      MLYHLLYPLAGDVKLFNIFK-YLTFRTIYAMITALLVCFVLGPWVIRVLEGLQARQVIRTDGPESHLQKQ
MRAY_DESOH      MLYHLLYPLHTHISFFNVFQ-YITFRTIYASLTAFLICFLLGPFTIRTLARMQIGQYIRELGPQSHQGKA
MRAY_THEYD      MLYEILYSLSDYISGLNVFK-YITFRTMLAILTSFFFTFIIAPPCIRWLKKLSLTQHIRDDGPKTHLKKE
MRAY_SINMW      MLIWLVE-LADHFQFFNLFR-YITFRTGAALFTSALIVFLFGPAMIASLRIRQKGQPIRADGPQTHFKKA
MRAY_HAEPS      MLVWLAEYLVQYNTAFNVVS-YITFRSIMALLTALIIGLWIGSTVIRRLQILKFGQEVRHDGPESHYKKR
MRAY_ACIAC      MLLMLSQWLSPEFGFFRVFQ-YLTFRAVMAAMTALLIGLLAGPKVIRMLTALKIGQPIRGYAMESHLSKS
MRAY_PELCD      MLYHLLYPLHEQFSVLYIFR-YITFRAIYATITALMIAFILGPWLIDKLSRLQIGQSIRKDGPQSHFKKE
MRAY_METPP      MLISLSQWLQLLYPELRVFQ-YLTFRAVMAAMTALLIGLALGPIVIRRLTELKIGQPIREYGVAEHMVKQ
MRAY_ACTSZ      MLVWLASFLEQYFSSFHVIS-YXXXXXXXXXXXXXXXXXWIGPKMILRLQIFKFGQEVRNDGPESHFQKR
MRAY_AZOSE      MLLEFALWLGQDIRAFNVFG-YITLRTVMAAMTALLISFACGPAVIRWLAAKKIGQAVRDDGPKSHLTKA
MRAY_DESPS      MFYHLLYPLHTAFAGFNVFR-YITLRSIGXXXXXXXXXXXXGPLFIRTMQRLQIGQVVREDGPETHFKKK
MRAY_RICBR      ---------------------YITFRSGLAVLVTLSLSFLIGPRLIKFLQTLQYGQPIRLDGPESHQAKA
MRAY_DESAD      MIYHFLVPLSAQIGALNVFR-YITFRSIYALLTALVITIVLGPMMMRWLQKIKCGQYIQDEVGELHKCKA
MRAY_ACIBL      -LLYEKAFLLHNFTPFRIFR-YLTFRTAFASLTALFMGLIIGPAVVRRLREFQIGQYIREEGPKSHQKKS
MRAY_RHORT      -MLYFLSELTAQVSALNVFR-YLTFRTGGAVMTAMLVAFVFGPGIIEWLKRKQEGQPIRSDGPESHLTKK
MRAY_RICB8      ---------------------YITFRSGLAVLVTLSLSFLIGPRLIKFLQTLQYGQPIRLDGPESHQAKA
MRAY_RHIME      MLIWLVE-LADHFQFFNLFR-YITFRTGAALFTSALIVFLFGPAMIASLRIRQKGQPIRADGPQTHFKKA
MRAY_AGRVS      MLIWLVE-LANHVQFFNLFR-YITFRTGAAMFTAALIVFLFGPKIIASLKVRQKGQPIRADGPQTHFKKS
MRAY_PARL1      MLYDLLGGMAGDIQALNVFR-YITFRTGGATVTALLISFLFGPRIIALLKKQRRGQPIREDGPQTHIQKQ
MRAY_METRJ      -MLYLLSDLSSSFTPLNVFR-YITFRTGGALFTAGLFVFWFGPWIISLLRIRQKGQPIREDGPQTHLTKR
MRAY_DECAR      MLLALAQWLAQDVRFFNVFN-YITXXXXXXXXXXXXXXXXXGPAVIRWLAAKKIGQAVRNDGPQTHLVKS
MRAY_ACIC5      -----------------------------------------GPYVIEKLREFQIGQYIREEGPQAHQKKA
MRAY_DESDG      MLYHFLYPLSAELPLLNVFR-YITFRSVWXXXXXXXXXXFIGPRFIRWLKRVKCGQYIQEE-VSCHVQKA
MRAY_GEOLS      MLFHLFYPLASNLKILNIFK-YLTFRTIYAMITALIVCFVLGPWIIRKLEGLQARQVIRTDGPESHLEKQ
MRAY_SOLUE      ----LYEQLHRYISPFRVFS-YTTVRTAFASLTALFLCIALGPWLINKLREFQIGQYIREEGPKSHQKKA
MRAY_GRABC      ---------------------YITFRSGAACMTALIVSFLLGPALIRWLKSVQRGQPIREDGPERHLEKK
MRAY_NITMU      MLLELAQWFAGDIRLLNVFS-YXXXXXXXXXXXXXXXSFIVGPAMIRKLTAYKIGQAVRDDGPQTHLVKA
MRAY_CUPTR      MLLALAQWLQNDYSFLRVVN-YLTFRAVMANVTALVIGLAFGPWVIRKLTELKVGQAVRTIGPQTHLVKS
MRAY_AGRRK      MLIWLAELSDHHFRFLNLFR-YITFRTGGALFTSALIVFLFGPRIISSLRVRQRGQPIRADGPQTHFKKA
MRAY_GEOMG      MLYHLLYPLASDFRIFNVFK-YLTFRTIYAVITALLVSFILGPWVIRKLEALQARQVIRTDGPESHLKKS
MRAY_GEOBB      MLYHLLYPLASDYKLFNVFK-YLTFRSIYAMITALLLAFIVGPWVVRKLEALQARQVIRTDGPESHLKKQ
MRAY_MESSB      -MLMLLVALADEFSVLNVFR-YITFRTGGALITAAFIVFLFGPAIISSLRLRQKGQPIRADGPQTHFKKA
MRAY_HAEDU      MLVWFAEYLLKYNTAFNVVS-YISFRSIMALLTAMAIGLWIGPKVINRLQILKFGQEVRNDGPESHFKKR
MRAY_NOVAD      MLYLLAQWL--HFEGFSNLIRYQTFRAGATLLTALVIGLIIGPRFINMLRVRQKGQPIREDGPQSHLAKR
MRAY_METC4      -MLYLLSELSGTLTPLNVFR-YITFRTGGALFTAGFFVFWFGPWIISLLRLRQKGQPIREDGPASHLTKR
MRAY_GEOSM      MLYHLLYPLAADYKLFNVFK-YLTFRSIYAMITALLLAFIVGPWVVRKLEALQARQVIRTDGPESHLKKQ
MRAY_BARQU      -MMLFFSSLSDWFPGVSVFR-YITFRTVAAMLTSGLIVFLFGPSIIASLKLRQKGQPIRADGPQTHFKKA
MRAY_OCHA4      -MLMLLTFFAEHMTPLNVFR-YITFRTGGAMITSALIVFLFGPSIINSLRVRQKGQPIRADGPQTHFKKA
MRAY_METPB      -MLFLLSELSGTLTPLNVFR-YITFRTGGALFTAGFFVFWFGPWIISLLRLRQKGQPIREDGPATHLTKR
MRAY_SILPO      -------WLTALSDGGDVWNRYITFRAGGAFMTALIFGFLFGRPLINVLRRKQKGQPIRDDGPEGHFSKA
MRAY_PARUW      MILFAIDYLERVWKVPSVFS-YYSTRMXXXXXXXXXXXXXXGPYFIRKLYELKIGQSIREDCPQLHEKKQ
MRAY_BARBK      ----LYDWLP----GVNVFR-YITFRTVAAMLTSGLIVFLFGPSIISSLKVRQKGQPIRADGPQTHFKKA
MRAY_BEII9      MLTWLAEF-AVYFTPLNLFR-YITFRTGGAIATALFFVFFFGPNIIKSLRKQGKGQPIRSDGPQSHLTKK
MRAY_CAUCN      MLYLLYEWLARSQEHLPALNKYLTFRSGMAMLTAYIVAVAMGSRFIRWMKAKQKGQPIRTDGIARHVTKA
MRAY_BRUSU      -------FLTHFAEHVTPFNRYITFRTGGAMITSALIVFLFGPTIINSLRVRQKGQPIRADGPQTHFKKA
MRAY_BRUSI      -------FLTHFAEHVTPFNRYITFRTGGAMITSALIVFLFGPTIINSLRVRQKGQPIRADGPQTHFKKA
MRAY_BRUO2      -------FLTHFAEHVTPFNRYITFRTGGAMITSALIVFLFGPTIINSLRVRQKGQPIRADGPQTHFKKA
MRAY_BRUME      -------FLTHFAEHVTPFNRYITFRTGGAMITSALIVFLFGPTIINSLRVRQKGQPIRADGPQTHFKKA
MRAY_BRUMB      -------FLTHFAEHVTPFNRYITFRTGGAMITSALIVFLFGPTIINSLRVRQKGQPIRADGPQTHFKKA
MRAY_BRUC2      -------FLTHFAEHVTPFNRYITFRTGGAMITSALIVFLFGPTIINSLRVRQKGQPIRADGPQTHFKKA
MRAY_BRUAB      -------FLTHFAEHVTPFNRYITFRTGGAMITSALIVFLFGPTIINSLRVRQKGQPIRADGPQTHFKKA
MRAY_BRUA2      -------FLTHFAEHVTPFNRYITFRTGGAMITSALIVFLFGPTIINSLRVRQKGQPIRADGPQTHFKKA
MRAY_BRUA1      -------FLTHFAEHVTPFNRYITFRTGGAMITSALIVFLFGPTIINSLRVRQKGQPIRADGPQTHFKKA
MRAY_RICTY      ---------------------YITFRSGLAIIITLSLSFVTGPILIKFLRSLQYGQPIRSDGPESHQTKA
MRAY_RALME      MLLTLAQWLQNDYSFLRVVN-YLTFRAVMANVTALVIGLGFGPWVIRRLTELKIGQAVRTIGPQTHLVKA
MRAY_OLICO      ----MFYWLTELIPGINVFR-YITFRTGGAMVTGALFVFLFGPWIIDHLRLAQKGQPIRADGPPTHLTKK
MRAY_RICCK      ---------------------YITFRSGLAIIITLSLSFVTGPILIKFLRTLQKGQPIRLDGPESHQTKA
MRAY_RALEH      MLLALAQWLQNDYSFLRVVN-YLTFRAVMANLTALLIGLAFGPWVIRKLTELKVGQAVRTIGPQTHLVKA
MRAY_SPHWW      MLYLIAEQLG--FPGVLNLIRYITFRAGAAALTALFIGLIIGPRFIGWLRIRQKGQPIRADGPQTHLSKV
MRAY_DESVV      MLYNLLYPLSSDITVFNVFR-YITFRSAWALATALLVSIVVGPRFIAWLQRLKCRQFIHED-VTCHMSKA
MRAY_DESVH      MLYNLLYPLSSDITVFNVFR-YITFRSAWALATALLVSIVVGPRFIAWLQRLKCRQFIHED-VTCHMSKA
MRAY_RHOPS      ------------------------------------------------------GQPIRSDGPQSHLTKK
MRAY_DESMR      MIYYLLVPLVAHFSALNVFR-YITFRSIAALLTALVLSIVFGPKFIDWLRRLKFGQYIHED-VAAHKQKA
MRAY_BRASB      ------------FRGLLNVFRYITFRTGGAVVTGALFVFLFGPWIIDHLRLRQKGQPIRADGPQSHISKK
MRAY_ERYLH      MLYLIAEWLG--FEGALNLIRYQTFRTGATLMTALVIGLIIGPRFINMLRVRQKGQPIRDDGPQSHLAKR
MRAY_ACICJ      ---------------------YITFRAGGACLTALVVSFLLGPRLIRWLKSLQKGQPIRADGPERHLEKK
MRAY_SYNAS      ---------------------YITFRTIYAAITALIICFLLGPWLIRKLRELKMGQVIRDDGPEAHLSKQ
MRAY_SILST      -------WLTALSDGGDFFNRYITFRAGGAFLTALIFGFVFGKPLINVLRKRQKGQPIRDDGPEAHLAKV
MRAY_PELUB      MLYSLITQLIDQYSFLNVFK-YLTFRTGLSMFTSMFVVLLIGTPFIKFFSARKILNPIRDDGPTEHIVKK
MRAY_RICFE      ---------------------YITFRSGLAIIITLSLSFITGPILIKFLRSLQKGQPIRSDGPESHQTKA
MRAY_RHOP2      MLYWLIDFSSS-FPAFNVFR-YITFRTGGAVVTGALFVFLCGPWIIDNLRLRQKGQPIRADGPQSHLTKR
MRAY_RICPR      ---------------------YITFRSGLAIIITLSISFVTGPILIKFLRSLQYGQPIRSDGPESHKTKA
MRAY_RHOP5      ------------------------------------------------------GQPIRSDGPQSHLSKK
MRAY_RHIL3      MLIWLVE-LSEYFKFLNLFR-YITFRTGAALFTSALIVFLFGPTIINSLRIRQKGQPIRADGPQTHFKKA
MRAY_RHILW      MLIWLVE-LSEYFKFLNLFR-YITFRTGAALFTSALIVFLFGPTIINSLRIRQKGQPIRADGPQTHFKKA
MRAY_DESDA      ---------------------YITFRSMAALMTALLISIILGPRFITWLRRLKCGQYIHED-VAAHACKA
MRAY_ZYMMO      ---------------------YITFRXXXXXXXXXXXXXXFGPRFIGWMRIHQHGQPIRDDGPKTHLAKA
MRAY_RICRS      ---------------------YITFRSGLAIIITLSLSFITGPILIEFLRSIQKGQPIRSDGPESHQTKV
MRAY_RICRO      ---------------------YITFRSGLAIIITLSLSFITGPILIEFLRSIQKGQPIRSDGPESHQTKV
MRAY_RICRI      ---------------------YITFRSGLAIIITLSLSFITGPILIEFLRSIQKGQPIRSDGPESHQTKV
MRAY_RHOS5      --------LTAFSDGGDIFNRYLTFRAGAAFFTALIFGFLFGRPLIDFLRRKQKGQPIRDDGPATHFAKA
MRAY_HAHCH      MLVWVADFLAQYFSIFSVFQ-YLTLRAILGVLTALLISLLVGPVMIRKLSYYQIGQAVRDDGPESHFSKA
MRAY_RICMO      ---------------------YITFRSGLAIIITLSLSFITGPILIKFLRSLQKGQPIRSDGPESHQTKV
MRAY_METS4      -MLYLLSELSGVFSPFNVFR-YITFRTGGALFTAGLFVFWFGPWIISLLRLRQKGQPIREDGPQTHLTKR
MRAY_MAGSM      --------------------------------------------LIRKLQSLQSGQPIRKDGPERHIEKA
MRAY_RICCN      ---------------------YITFRSALAIIITLSLSFITGPILIEFLRSLQKGQPIRSDGPESHQTKV
MRAY_RICAE      ---------------------YITFRGGLAIIITLSLSFITGPILIEFLRSLQKGQPIRSDGPESHQTKV
MRAY_RICM5      ---------------------YITFRSGLAIIITLSLSFITGPILIKFLRSLQKGQPIRSDGPESHQTKV
MRAY_PARDP      -------------------------------------------PLIDLLRRKQKGQPIRDDGPENHFSKA
MRAY_RHOS4      -MLYL---LTAFSDGGDIFNRYLTFRAGAAFFTALIFGFLFGRPLIDFLRRKQKGQPIRDDGPTTHFAKA
MRAY_RHOS1      -MLYL---LTAFSDGGDIFNRYLTFRAGAAFFTALIFGFLFGRPLIDFLRRKQKGQPIRDDGPTTHFAKA
MRAY_BRASO      ----MFYWLTNTFPSLSVFRGYITFRTGGAVVTGALFVFLFGPWIIDHLRLRQKGQPIRTDGPQSHISKK
MRAY_RICPU      ---------------------YITFRSGLAIIITLSLSFITGPILIEFLRSLQKGQPIRSDGPESHQTKV
MRAY_RICAH      ---------------------YITFRSGLAIIITLSLSFIMGPILIKFLRSLQKGQPIRSDGPESHQTKA
MRAY_UNCTG      MLYHVFYCLSSIFTPFNIFQ-YITFRAGGAILTSLLICFVAGPCIIEKLENFKIKQIVRTDGPETHLSKN
MRAY_ARCB4      ----MFYWL---YRHLEIILQYISVRAGISFFIAFVLTMYLMPKFIRWARAKKASQPIYELAPENHKIKA
MRAY_HYDS0      ------------------------------------------------------GGYVREDTPETHSKKK
MRAY_AZOC5      ----MLQWLAQLHDTFPAFNRYITFRTGGAIVTAVLFVFLFGPGIISTLRKQGKGQPIRADGPQSHLTKK
MRAY_RHILO      ----MFTLLVDFADKISVFNRYITFRTGGALITSALIVFIFGPTIINSLRLRQKGQPIRADGPQTHFKKA
MRAY_RHIE6      MLIWLVE-LSEYFKFLNLFR-YITFRTGAALFTSALIVFLFGPTIINSLRIRQKGQPIRADGPQTHFKKA
MRAY_MARMM      MLYLLFAPLADDFQLANLFR-YITFRTGGALMTAMLIAFVFGKPMIGWLRRKQKGQPIRAEGIERHVEKA
MRAY_GLUDA      ---------------------YITFRAGAACLTALAISLLLGNPLIAQLRRIQRGQPIRALGPERHIEKA
MRAY_RHOSK      -MLYL---LTAFSDGGDIFNRYLTFRAGAAFFTALIFGFLFGRPLIDFLRRKQKGQPIRDDGPTTHFAKA
MRAY_RHIEC      MLIWLVE-LSEYFKFLNLFR-YITFRTGAALFTSALIVFLFGPTIINSLRIRQKGQPIRADGPQTHFKKA
MRAY_NITHX      ----MFYWLSNTVPGLSIFKPYITFRTGGAMVTGALFVFLFGPWIIDNLRLRQKGQPIRADGPQSHLSKK
MRAY_METSB      ------------------------------------------------------GQPIRLDGPQSHLTKK
MRAY_METNO      -MLYLLSELSGVFSPFNVFR-YITFRTGGALFTAGLFVFWFGPWIISLLRLRQKGQPIREDGPQTHLTKR
MRAY_SPHAL      MLYWLAEWLG--FPGALNLIRYLSFRSGAAVATAMILGLWIGPRFILMLRMRQKGQPIRDDGPQSHLAKK
MRAY_FUSNN      -----------------------------------------GRPFIKYLKIKKFGEEIRDDGPSSHFSKK
MRAY_BRAJA      ----MFYWLSNTFPGFGAFRTYITFRTGGAVVTGALFVFLFGPWIIDHLRIRQKGQPIRTDGPQSHLAKK
MRAY_RHOPT      MLYWLID-LSSSFPAFNVFR-YITFRTGGAMVTGALFVFMFGPWIIDNLRLRQKGQPIRTDGPQSHLTKK
MRAY_OPITP      MLSHLAD-LQDYFGPLRLLR-YITVRTLLAAVTSLTIGFVIAPWLIAKFRELKLGHGYIDDRTATYFDKK
MRAY_CAUSK      MLYFLYDWLSHEHVPVLNLLKYLTFRTGMSMLTAYVVAVAMGSRFIRWMKAKQKGQPIRADGIARHVEKA
MRAY_WOLSU      MMYYLY---SH--AGINIFQ-YITFRXXXXXXXXXXXXXXXMPRFIQWARNQKAAQPISEFAPQGHRGKA
MRAY_NITWN      ----MFYWLSNTVPGLGIFKPYITFRTGGAVVTGALFVFLFGPWIIDNLRLRQKGQPIRADGPQSHLSKK
MRAY_BLOPB      -----------------------------------------GHCVITWFHNLCFFQIVRCDGPKSHTQKQ
MRAY_BDEBA      ----LYQWLADEFSPLNVFR-YITVRTFIAFFTAFLLCWIWGPHFIKRLQLKHFGQAIRDDGPQTHKKKA
MRAY_RHOPA      MLYWLID-LSSSFPAFNVFR-YITFRTGGAMVTGALFVFMFGPWIIDNLRLRQKGQPIRTDGPQSHLTKK
MRAY_XANP2      ----MLQWLAEFHASFPAFNRYITFRTGGAVVTALLFVFLFGPGMISTLRKQGKGQPIRTDGPQSHLTKK
MRAY_MAGSA      -----------------------------------------GPRIIAWLRQWQKGQPIRADGPESHLTKK
MRAY_CHLL2      MLYYLLKYINDAFDGLGVIE-FLTFRASAAAVTSLLICLVAGPAFIKYL-KGRIIEPVKEEAPPEHRKKK
MRAY_SULDN      ---------------------------------------------IRWAQSTSSHQPINEWAPQRHQGKA
MRAY_PHEZH      -----------------------------------------GSRFIRWMQAKQKGQPIRAEGIERHIEKA
MRAY_RHOPB      ------------------------------------------------------GQPIRSDGPQSHLSKK
MRAY_AGRT5      MLIWLVE-LSDKVQLFNLFR-YITFRAGAAMFTSALIVFLFGPAIINSLRVRQKGQPIRADGPQTHFKKA
MRAY_GLUOX      -----------------------------------------GNPFIAQLKRIQRGQPIRTVGPERHIEKA
MRAY_BARHE      -MMLFFSSLSDWLPGVSVFR-YITFRTIAAMLTSGLIVFLFGPSIIISLKLRQKGQPIRADGPQTHFKKA
MRAY_AQUAE      MLYQLALLLKDYWFAFNVLK-YITFRSFTAVLIAFFLTLVLSPSFINRLRKIQFGGYVREYTPESHEVKK
MRAY_BART1      -MMLFFSSFSDWFPGVNVFR-YITFRTIAAMLTSGLIVFLFGPSIIASLKLRQKGQPIRADGPQTHFKKA
MRAY_MYXXD      MLYLLYEVIQNSEAGRVLFLRYPTFRIIAAGVFALLLGMLIGPKLIARLRLKQHGQSVREDTPDSHQKKK
MRAY_CAMC5      MFYYIYELLN-----FNIFQ-YITVRAGFSFFIAFCLTVYLMPKFIAWAKAKNAAQPIYELAPQTHQKKA
MRAY_PROA2      MLYYLLQYINDVFDGFGVVE-YITFRASAAAITSLLITIFVGPRLIAYLKRKYI-EPIKEEAPPEHRKKK
MRAY_BORRA      ------------FLGLRLLK-YITFRTAYATIFAFLLALIFGPFIISRLKKLKLDQILRKDGPKHHLSKM
MRAY_BORDL      ------------FLGLRLLK-YITFRTAYATIFAFLLALIFGPFIISRLKKLKLDQILRKDGPKRHLSKM
MRAY_PORG3      MLYYLFDYLEKLLPGARLFH-YVSFRSXXXXXXXXXXXXXXGNRIIERLRKAQIGETIRDLGLEGQLSKK
MRAY_PELLD      MLYYLLHYFNSTYNGLGVVE-YLTFRXXXXXXXXXXXXXXXGPGFIRYLRSRFI-EPVKEEAPAEHRKKK
MRAY_PORGI      MLYYLFDYLEKLLPGARLFH-YVSFRSXXXXXXXXXXXXXXGNRIIERLRKAQIGETIRDLGLEGQLSKK
MRAY_CYTH3      MLYYLFEWENKYLLGAGVFQ-YISFRAGMAAFVSLLIALVFGKKIITFIQNKQIGESIRDLGLAGQMEKK
MRAY_BORHD      ---------------------YITFRTAYATIFAFLLALIFGPFIILRLKKLKLDQILREDGPKRHLSKM
MRAY_BORAP      -----------YLLGLRLLK-YITFRMAYATIFAFLLSLIVGPHIILRLKKLRADQILREDGPKRHLSKT
MRAY_AMOA5      MLYYFFKYIDRFIPGIGVFK-YISFRXXXXXXXXXXXXXXXGKRLIIFFKTAQIKEGIRELDLAGQSEKA
MRAY_NAUPA      MLYYLYE---HFH--INIFH-YITFRAILAFFLSFFITIFIMPKFISWA-KAKATQPIFELAPDNHKTKN
MRAY_PELPB      MIYYLLRYINDLFDGLHVIE-YLTFRASXXXXXXXXXXXFVGPGFIKYL-KTRFIEPVKEEAPPEHKKKN
MRAY_JANSC      -------WLNELSDGGDVFNRYITFRAGGAFFTALIFGFIFGQPLINALRKYKDGQPIREVGP-AHETKA
MRAY_HELPS      ---------------------------------------------ILWAKAKKANQPISSFVP-SHQNKK
MRAY_BLOFL      MLFWIIKITSYFYSSFEVMNSVL-FRGVGGLFFSLFISIVIGNRIIVWLKKLRMLQTIRIDGPQSHKLKY
MRAY_CAMFF      ------------------FFSYITVRAGISFFLAFVLTVYFMPKFILWAKAKNANQPIYELAPQNHKKKN
MRAY_BORT9      ---------------------YITFRTAYATIFAFLLALIFGPFIILRLKKLKLDQILRKDGPKRHLSEK
MRAY_CHLPB      MLYYLLQYINELFDGFGVIE-YITFRASAAAITSLLITILAGPKLIGYLKSKYI-EPVKEEAPPEHRQKR
MRAY_CHLPD      ----------------------------------------------------------------------
MRAY_LEPIN      MFYYLYDLYFNHLDSLRIFS-YVTFRALMAGLTSMLVTFWFGHKIIDFLYGLKFRESVRDDGPKSHEIKK
MRAY_LEPIC      MFYYLYDLYFNHLDSLRIFS-YVTFRALMAGLTSMLVTFWFGHKIIDFLYGLKFRESVRDDGPKSHEIKK
MRAY_LAWIP      MLYNILFPLSSDYTILNVFK-YITFRSVWXXXXXXXXXXXXGPYFIRWLQRINFKQQIHED-VKIHKSKT
MRAY_HELAH      ---------------------------------------------ILWAKAKKANQPISSFVP-SHQNKK
MRAY_NITSB      -MLYYFYSIFH----INIFQ-YITVRAGIXXXXXXXLTLYLMPKFIRWAMKKSSYQPIYSLAPEHHKKKA
MRAY_DINSH      -------WLTSISDGGDAFNRYITFRAGGAFFTALIFGFIFGRPLINLLRKRQFGQPIREDGPESHLTKQ
MRAY_CHLT3      MLYYLLSYVREIYDGLGVIN-YITFRXXXXXXXXXXXXXXFGPKIIRFLRDKVI-EPIKEEAPEEHRKKV
MRAY_BUCBP      -----------------------------------------GPHLINWLNKYKIQQIIRNFGPKSHFNKK
MRAY_LEPBL      MFYYLYDLYFNHLDSLRIFS-YVTFRALMAGLTSMFVTFWLGHKVIDFLYGLKFRESVRDDGPKSHESKK
MRAY_LEPBJ      MFYYLYDLYFNHLDSLRIFS-YVTFRALMAGLTSMFVTFWLGHKVIDFLYGLKFRESVRDDGPKSHESKK
MRAY_CHLCH      MLYYFLKYINYHFPALRVID-YLTFRASXXXXXXXXXXXXXGPKLIAYL-KQRXXXXXXXXXXXXHRKKK
MRAY_BUCA5      --------------------SYIPYRAIFSLLTSFFINLYIGPYFIYYFKKLQTYQIIRNNGPKTHYSKK
MRAY_BUCAI      --------------------SYIPYRAIFSLLTSFFINLYIGPYFIYYFKKLQTYQIIRNNGPKTHYSKK
MRAY_HELPJ      ---------------------------------------------ILWAKAKKANQPISSFVP-SHQNKK
MRAY_LISIN      ---------------------------------------------IPFLVKLKFGQSIRDEGPKMHEKKS
MRAY_BUCAT      --------------------SYIPYRAIFSLLTSFFINLYIGPYFIYYFKKLQKYQIIRNNGPKTHYSKK
MRAY_SULNB      ----------------------------------------------------------------AHAGKS
MRAY_ANATD      ---------------------------------------------------LKFGQVVRDDGPKTHHKKS
MRAY_METI4      ---------------------YITFRAMGAAITSLVLCWLLGRPMISLLRKLKAGQPIRGDLAALHGSKS
MRAY_WOLTR      ---------------------------------------------IKFLKKIKNGQPIRLCSPENHLTKR
MRAY_HELHP      -------WLYQYY-GVNIFS-YITXXXXXXXXXXXXXXXXXMPYFIKWAKAKKANQPI-STYVAAHEGKK
MRAY_BRAHW      MLYQIFYPLRESFFGFNLFR-YITFRTAGAVATALILVILFAPGVIEKLKKLHFGQVVRDDGPETHLVKT
MRAY_BORGA      -----------YLLGLRLLK-YITFRMAYATIFAFLLSLIIGPHIILRLKKLRVDQVLREDGPKRHLSKA
MRAY_HELPH      ---------------------------------------------ILWAKAKKANQPISSFVP-SHQNKK
MRAY_HELP2      ---------------------------------------------ILWAKAKKANQPISSFVP-SHQNKK
MRAY_CHLP8      MLYYFLRYINEMFNGMRVIE-YLTFRASXXXXXXXXXXVFAGPSFIRFL-KSHFLEPVKEEAPEEHRKKK
MRAY_PROVI      MLYYLLKYINEVFDGLGVIE-YLTFRXXXXXXXXXXXXXXXGPGFIALLRARFI-EPVKEEAPPEH-RKK
MRAY_WOLWR      ------------------------------------------------------GQPIRSCGPESHLTKK
MRAY_WOLPM      ------------------------------------------------------GQPIRSCGPESHLTKK
MRAY_ORITI      -----------------------------------------------------LAQPIRNLGHKSHIAKA
MRAY_THETN      -----------------------------------------GRFFIPYLRKLKFGQKVREDGPKTHLKKS
MRAY_LEPBP      ----MFQWIYESFGNLRVFS-YVTLRAMMAGLTSMFITXXXXXXXXXXXXXXXXRESVRNDGPQSHANKS
MRAY_LEPBA      ----MFQWIYESFGNLRVFS-YVTLRAMMAGLTSMFITXXXXXXXXXXXXXXXXRESVRNDGPQSHANKS
MRAY_CHLTE      MLYYILRYINELYSGMGVIE-YLTFRXXXXXXXXXXXXXXXGQRFIRFL-KSKFVEPIKEEAPPEHRKKK
MRAY_BORBZ      -----------YLLGLRLLK-YITFRMAYATIFAFLLSLIVGPYIILKLKKLRADQILREDGPKRHLSKA
MRAY_BORBU      -----------YLLGLRLLK-YITFRMAYATIFAFLLSLIVGPYIILKLKKLRADQILREDGPKRHLSKA
MRAY_FLAPJ      MLYYLFQYLDKYFDGAGVFQ-YITFRSALAIIMSLLISTIFGKRVISYLSRLQVGETVRELGLEGQTQKA
MRAY_BIFAA      --------------------------------------------LIKLVHKLNYGQYIRQDGPKSHLVKR
MRAY_ALKOO      -----------------------------------------------------VGQTVREEGPRSHLQKX
MRAY_CHLCV      ------------------------------------------RPVISWLKKQNHYDQVHKEHCEKHQDKK
MRAY_LISMO      ---------------------------------------------IPFLVKLKFGQSIRDEGPKMHEKKS
MRAY_LACC3      ---------------------------------------------IGYMRYKKEGQVIREEGPSWHEKKS
MRAY_LISMF      ---------------------------------------------IPFLVKLKFGQSIRDEGPKMHEKKS
MRAY_LISMC      ---------------------------------------------IPFLVKLKFGQSIRDEGPKMHEKKS
MRAY_LISW6      ---------------------------------------------IPFLVKLKFGQSIRDEGPKMHEKKS
MRAY_HELPY      ---------------------------------------------ILWAKAKKANQPISSFVP-SHQNKK
MRAY_CALS8      ---------------------------------------------IPFLRYLKCGQVVRDDGPQTHHKKS
MRAY_CHLFF      -----------------------------------------GKPVIHWLKKQNYYDQVQKEHCAKHKDKK
MRAY_ANASK      -----------------------------------------GPIFIERMRVLQYGSTVREDTPDTHKKKA
MRAY_ANADE      -----------------------------------------GPIFIERMRVLQYGSTVREDTPDTHKKKA
MRAY_ANAD2      -----------------------------------------GPIFIERMRVLQYGSTVREDTPDTHKKKA
MRAY_CLONN      -----------------------------------------GPILIPLLHKFKFGQNIRSEGPESHKKKS
MRAY_SORC5      ------------------------------------------------LRRKQIGQVVRAEGPETHKIKA
MRAY_STAAW      --------------------------------------------LIPTLKRMKFGQSIREEGPQSHMKKT
MRAY_STAAU      --------------------------------------------LIPTLKRMKFGQSIREEGPQSHMKKT
MRAY_STAAT      --------------------------------------------LIPTLKRMKFGQSIREEGPQSHMKKT
MRAY_STAAS      --------------------------------------------LIPTLKRMKFGQSIREEGPQSHMKKT
MRAY_STAAR      --------------------------------------------LIPTLKRMKFGQSIREEGPQSHMKKT
MRAY_STAAN      --------------------------------------------LIPTLKRMKFGQSIREEGPQSHMKKT
MRAY_STAAM      --------------------------------------------LIPTLKRMKFGQSIREEGPQSHMKKT
MRAY_STAAE      --------------------------------------------LIPTLKRMKFGQSIREEGPQSHMKKT
MRAY_STAAC      --------------------------------------------LIPTLKRMKFGQSIREEGPQSHMKKT
MRAY_STAAB      --------------------------------------------LIPTLKRMKFGQSIREEGPQSHMKKT
MRAY_STAA9      --------------------------------------------LIPTLKRMKFGQSIREEGPQSHMKKT
MRAY_STAA8      --------------------------------------------LIPTLKRMKFGQSIREEGPQSHMKKT
MRAY_STAA3      --------------------------------------------LIPTLKRMKFGQSIREEGPQSHMKKT
MRAY_STAA2      --------------------------------------------LIPTLKRMKFGQSIREEGPQSHMKKT
MRAY_STAA1      --------------------------------------------LIPTLKRMKFGQSIREEGPQSHMKKT
MRAY_CHLTR      ------------------------------------------KPLISWLKKQGFQDHIHKDHCEKHKDKA
MRAY_CHLTB      ------------------------------------------KPLISWLKKQGFQDHIHKDHCEKHKDKA
MRAY_CHLTA      ------------------------------------------KPLISWLKKQGFQDHIHKDHCEKHKDKA
MRAY_CHLT2      ------------------------------------------KPLISWLKKQGFQDHIHKDHCEKHKDKA
MRAY_CAMC1      MFYYIYEILN-----FNIFQ-YITVRAGIAFFIAFILTAYLMPKFIAWAKAKNAAQPIYELAPQTHQKKA
MRAY_ANADF      -----------------------------------------------FIERMRVLQYVREDTPERHKKKA
MRAY_CAMJJ      --MYYLSDLSHY-----AFFTYISVRAGFAFFIALCLSLFLMPKFITWAKNKNASQPIYEYAPETHKTKC
MRAY_CAMJR      --MYYLSDLSHY-----AFFTYISVRAGFAFFIALCLSLFLMPKFITWAKAKNASQPIYEYAPETHKTKC
MRAY_CAMJE      --MYYLSDLSHY-----AFFTYISVRAGFAFFIALCLSLFLMPKFITWAKAKNASQPIYEYAPETHKTKC
MRAY_CAMJ8      --MYYLSDLSHY-----AFFTYISVRAGFAFFIALCLSLFLMPKFITWAKAKNASQPIYEYAPETHKTKC
MRAY_CHLAB      -----------------------------------------GKPVIRWLKKRNHYDQVQKEYCEKHQDKK
MRAY_BIFLO      --------------------------------------------LIRLVHKLHYGQYIRQDGPQSHLVKR
MRAY_BIFLD      --------------------------------------------LIRLVHKLHYGQYIRQDGPQSHLVKR
MRAY_CLOTH      -----------------------------------------GPVLIPMLTRLKFGQTVRDDGPKTHYKKT
MRAY_STRCO      --------------------------------------------LIKLLARKGYGQYIRDDGPREHASKR
MRAY_STAHJ      --------------------------------------------LIPTLKRMKFGQSIREEGPQSHMKKT
MRAY_CHLMU      ------------------------------------------KPLI-WLKKQGLQDRIHKDHCEKHKNKA
MRAY_CARHZ      -----------------------------------------GRVLIPWLLKLKIGQTVRTEGPKRHLKKS
MRAY_STRZT      ---------------------------------------------IQFYRKAQIGQQMHEDVKQ-HQAKA
MRAY_STRGG      --------------------------------------------LIKLLARKGYGQFIRDDGPRTHGSKK
MRAY_STAES      --------------------------------------------LIPTLKRMKFGQSIREEGPQSHMKKT
MRAY_STAEQ      --------------------------------------------LIPTLKRMKFGQSIREEGPQSHMKKT
MRAY_MICLC      -----------------------------------------GTPLIRFLVKRGYGQFVRDDGPTTHKTKR
MRAY_CHLAD      ---------------------------------------------VHFARKHKLGKRIRPDGPQSHLVKV
MRAY_STAS1      --------------------------------------------LIPTLKRMKFGQSIREEGPQSHMKKT
MRAY_STRPS      ---------------------------------------------IQFYRKAQIGQQMHEDVKQ-HQAKA
MRAY_STRPJ      ---------------------------------------------IQFYRKAQIGQQMHEDVKQ-HQAKA
MRAY_PROM2      ------------------------------------------------IRKLNLLQNIRTEGPSNHFQKS
MRAY_CLOD6      ------------------------------------------------LRKFKFGQTVRDDGPQTHLAKN
MRAY_HYPNA      --------------------------------------------LINFLRARQKGQPIRDLSLEMQLSKQ
MRAY_STRPI      ---------------------------------------------IQFYRKAQIGQQMHEDVKQ-HQAKA
MRAY_CHLPN      -----------------------------------------GVPVMKWLKRKNYRDYIHKEYCEKHKDKA
MRAY_CAMHC      ---------------------------------------------IAWAKNKHANQPIYELAPQSHKAKN
MRAY_STRP4      ---------------------------------------------IQFYRKAQIGQQMHEDVKQ-HQAKA
MRAY_GEMAT      MLYFLLQPLARDVRLFNLLN-YITFRAAAAFVTALLVSFILGPAIIRRLRAMAVHQVVREGTPDTHAGKG
MRAY_CAMLR      -----------------MFFSYISVRAGFAFFIALFLSLYFMPKFIKWAQNKKANQPIYEYAPQSHQAKS
MRAY_ARTAT      ---------------------------------------------IRFLVAKSYGQFIRDDGPTSHHTKR
MRAY_STRPN      ---------------------------------------------IQFYRKAQIGQQMHEDVKQ-HQAKA
MRAY_STRP7      ---------------------------------------------IQFYRKAQIGQQMHEDVKQ-HQAKA
MRAY_STRZP      ---------------------------------------------IQFYRKAQIGQQMHEDVKQ-HQAKA
MRAY_FERNB      ---------------------------------------------IDYMKKLKLGQYIRQEGPDLHNYKE
MRAY_STRR6      ---------------------------------------------IQFYRKAQIGQQMHEDVKQ-HQAKA
MRAY_STRP2      ---------------------------------------------IQFYRKAQIGQQMHEDVKQ-HQAKA
MRAY_PROMP      ------------------------------------------------ISRLNLLQNIRSEGPSLHFNKT
MRAY_CLOK5      -----------------------------------------GPILIPLLHKFKFGQSIREDGPKTHLKKA
MRAY_CLOK1      -----------------------------------------GPILIPLLHKFKFGQSIREDGPKTHLKKA
MRAY_CLOB8      -----------------------------------------GPIFIPILHKLKFGQNIRKEGPKSHQKKS
MRAY_SALRD      MLYYLIDYIERLYHGFQVIR-FITVRXXXXXXXXXXXXXXXXXXXXRWLRQQQLGEQVREGGAISHAHKA
MRAY_THEPX      -----------------------------------------GPLFIPYLRKLKFGQKVREDGPKSHIKKS
MRAY_THEP3      -----------------------------------------GPLFIPYLRKLKFGQKVREDGPKSHIKKS
MRAY_PROMA      ------------------------------------------------LKKINCRQVVRKEGPSGHFQKS
MRAY_GEOSW      ---------------------------------------------IPFLRRLKFGQSIREEGPKSHQKKT
MRAY_CLOTE      -----------------------------------------GPILIPLLHKLKFGQNIREEGPKSHQKKA
MRAY_LACRJ      --------------------------------------------LIKYFRAKKEGQQIRKEGPTWHAKKA
MRAY_LACRD      --------------------------------------------LIKYFRAKKEGQQIRKEGPTWHAKKA
MRAY_ARTS2      -----------------------------------------GTPLIRLLVRKSYGQFIRDDGPTSHHTKR
MRAY_ANAMM      ---------------------------------------------IAALKNIQKGRNVRSCFPAAHLAKK
MRAY_ANAMF      ---------------------------------------------IAALKNIQKGRNVRSCFPAAHLAKK
MRAY_CORGL      --------------------------------------------LIRYFTNRQLGQEIREEGLQSHLRKR
MRAY_CORGB      --------------------------------------------LIRYFTNRQLGQEIREEGLQSHLRKR
MRAY_STACT      -------------------------------------------------KRMKFGQSIREEGPQSHMKKT
MRAY_DESHD      -----------------------------------------GPLMIPVLRVMKFGQTIREEGPKRHLAKA
MRAY_CORJK      --------------------------------------------LIRWFSAEGLGQEIREEGPKSHFKKR
MRAY_DESRM      -----------------------------------------GPVTIPLLQRLKFGQTIRAEGPAAHMAKT
MRAY_DESHY      -----------------------------------------GPLMIPVLRVMKFGQTIREEGPKRHLAKA
MRAY_SYNY3      -----------------------------------------GMAVVPMLVNLKASQVIQSDGPQSHLKKA
MRAY_BACSK      ---------------------------------------------IPFLRKLKFGQSIREEGPKSHQKKS
MRAY_FLAJ1      MLYYLFEYFDKTLDGTGVFQ-YITFRXXXXXXXXXXXXTIYGKRVINFLRRQQVGETVRELGLAGQNEKA
MRAY_LACPL      --------------------------------------------LIRYFRARKEGQMIREEGPKWHEKKS
MRAY_ACIC1      -----------------------------------------GTPIIRFFRERGYGQLIRDDGPTTHHTKR
MRAY_STRAW      --------------------------------------------LIKLLARKGYGQYIRDDGPREHHSKR
MRAY_LACS1      ---------------------------------------------ISYFRKRKEGQMIREEGPKWHQKKS
MRAY_KOCRD      --------------------------------------------LIKVLARHGYGQYIRDDGPTSHQTKR
MRAY_PARD8      MLYYLFNYLDQLFPGAGMFK-YVSFRSGLALILSLFISTAIGRRIIDKLQMLQIGETVRNLGLEGQMSKK
MRAY_PROM0      ------------------------------------------------IKKFNFLQNIRDEGPTNHFKKS
MRAY_FRAAA      --------------------------------------------VIRFFRRQGYGQEIREDGPSSHLTKR
MRAY_ENTHR      ---------------------------------------------IGYFQMKKQGQAIREEGPKWHNVKA
MRAY_PETMO      -----------------------------------------------WLKKRQFGQYIRKEGPDLHNYKQ
MRAY_LACDB      --------------------------------------------LIIWMRSHDEGQQIRDEGPKWHEKKS
MRAY_LACDA      --------------------------------------------LIIWMRSHDEGQQIRDEGPKWHEKKS
MRAY_STRSV      ------------------------------------------------------GQQMHEDVKQ-HQAKA
MRAY_PROMM      ------------------------------------------------LRALKMGQVIREDGPQTHQRKS
MRAY_PROM9      ----------------------------------------------------------RTEGPANHLKKS
MRAY_PEDPA      ---------------------------------------------INYFRVRNEGQMIREEGPKWHQKKS
MRAY_FRASC      -----------------------------------------GTPWVIRLFRRQYGQEIREDGPSSHLTKR
MRAY_STRSY      ---------------------------------------------ITFYQAKRIGQQMHEDVKQHQF-KA
MRAY_STRS2      ---------------------------------------------ITFYQAKRIGQQMHEDVKQHQF-KA
MRAY_ALKMQ      -------------------------------------------------RRLKVGQTIREEGPKTHMAKS
MRAY_SYNPX      ------------------------------------------------LKALKMGQVIRVEGPQAHQSKA
MRAY_LACAC      --------------------------------------------LINFMHSHHEGQEIRDEGPKWHQKKS
MRAY_CORU7      -----------------------------------------------------LGQEIREEGPKSHLKKR
MRAY_AZOPC      -----------------------------------------GERIIRFLQRHQAGETIRNLGLEGQIQKK
MRAY_KINRD      -----------------------------------------GTPLIRWLVRRGYGQFVRDDGPTSHHTKR
MRAY_CHLSY      ---------------------------------------------VRFARRHKLGKRIRPDGPQSHLVKV
MRAY_CHLAA      ---------------------------------------------VRFARRHKLGKRIRPDGPQSHLVKV
MRAY_BACHD      ---------------------------------------------IPFLRRLKFGQSIREEGPKSHQKKS
MRAY_STRA5      ---------------------------------------------IKFYQLKKIGGQQMHEDVKQHLAKA
MRAY_STRA3      ---------------------------------------------IKFYQLKKIGGQQMHEDVKQHLAKA
MRAY_STRA1      ---------------------------------------------IKFYQLKKIGGQQMHEDVKQHLAKA
MRAY_BACHK      ---------------------------------------------IPFLRKLKFGQSIRDEGPKSHQKKS
MRAY_BACCZ      ---------------------------------------------IPFLRKLKFGQSIRDEGPKSHQKKS
MRAY_BACCQ      ---------------------------------------------IPFLRKLKFGQSIRDEGPKSHQKKS
MRAY_BACC7      ---------------------------------------------IPFLRKLKFGQSIRDEGPKSHQKKS
MRAY_BACC3      ---------------------------------------------IPFLRKLKFGQSIRDEGPKSHQKKS
MRAY_BACC2      ---------------------------------------------IPFLRKLKFGQSIRDEGPKSHQKKS
MRAY_BACC1      ---------------------------------------------IPFLRKLKFGQSIRDEGPKSHQKKS
MRAY_BACC0      ---------------------------------------------IPFLRKLKFGQSIRDEGPKSHQKKS
MRAY_BACAN      ---------------------------------------------IPFLRKLKFGQSIRDEGPKSHQKKS
MRAY_BACAH      ---------------------------------------------IPFLRKLKFGQSIRDEGPKSHQKKS
MRAY_BACAC      ---------------------------------------------IPFLRKLKFGQSIRDEGPKSHQKKS
MRAY_BACAA      ---------------------------------------------IPFLRKLKFGQSIRDEGPKSHQKKS
MRAY_RUBXD      -----------------------------------------GSSFIRFLQTRKFGQYVREEGPETHLIKA
MRAY_LEIXX      ---------------------------------------------IRLFRRLQWGQFIRDDGPQSHHAKR
MRAY_BIFA0      --------------------------------------------LIRIVHKLNYGQYIRQDGPKSHQVKR
MRAY_MYCA9      --------------------------------------------LIRVFSRQGFGQEIRDDGPQHHQKKR
MRAY_CLOBA      -----------------------------------------GPIFIPMLHKLKFGQNIRKDGPQSHLKKS
MRAY_BACWK      ---------------------------------------------IPFLRKLKFGQSIRDEGPKSHQKKS
MRAY_BACCR      ---------------------------------------------IPFLRKLKFGQSIRDEGPKSHQKKS
MRAY_BACC4      ---------------------------------------------IPFLRKLKFGQSIRDEGPKSHQKKS
MRAY_LACSS      ---------------------------------------------IGYLRFKKEGQTIRDEGPKWHAKKN
MRAY_ACAM1      ---------------------------------------------VPMLRSLKASQVIQEDGPQSHLKKA
MRAY_PROM5      ------------------------------------------------IKQLNLLQNIRDTGPSFHFNKK
MRAY_NOCFA      --------------------------------------------LIKFFAKQGFGQEIRVDGPASHQSKR
MRAY_LACH4      --------------------------------------------LIKFMHSHHEGQEIRDEGPKWHQKKS
MRAY_LACBA      --------------------------------------------LIRYFRARHEGQMIREEGPTWHEKKS
MRAY_CYAP8      -----------------------------------------GYVVVPVLRRLKAGQVIQEDGPQTHLKKA
MRAY_ANOFW      ---------------------------------------------IPFLRRLKFGQSIREEGPKSHQKKS
MRAY_STRTD      ------------------------------------------------------GQQMHEDVKQ-HLAKA
MRAY_STRT1      ------------------------------------------------------GQQMHEDVKQ-HLAKA
MRAY_STRT2      ------------------------------------------------------GQQMHEDVKQ-HLAKA
MRAY_GRAFK      MLYYLFKFLEEQYQGAQLFD-FLSFRSAMAIILSLGISTIYGKRIINYLRAKQIGESVRDLGLKGQTEKA
MRAY_CLOBB      -----------------------------------------GPIFIPMLHKLKFGQNIRTDGPKSHLKKS
MRAY_ANAVT      --------------------------------------------VVPLLQALKTGQIIREDGPQAHLKKA
MRAY_MYCLB      ------------------------------------------------------GQEIREDGPPSHHNKR
MRAY_MYCLE      ------------------------------------------------------GQEIREDGPPSHHNKR
MRAY_SYNS9      ------------------------------------------------LKALKMGQVIREEGPSGHQSKS
MRAY_PELTS      -----------------------------------------GPLVIPVLRRLKFGQSIRSDGPSRHLQKA
MRAY_SYNSC      ---------------------------------------------IPLLRRLKMGQFIREEGPKTHQSKA
MRAY_RENSM      ------------------------------------------------------GQFIRDDGPTSHHTKR
MRAY_KOSOT      -------------------------------------------------KKLRIGQYIREEGPDLHNYKT
MRAY_THEP1      --------------------------------------------LIKLFRRRRIGQYIRKEGPDLHGYKE
MRAY_THESQ      --------------------------------------------LIKLFRRRRIGQYIRKEGPDLHGYKE
MRAY_STRU0      ---------------------------------------------IKFYQMKKIGGQQMHEDVKQHLAKA
MRAY_MICAN      -----------------------------------------GCQVVPMLRRLKMGQIMREDGPQAHLKKA
MRAY_STRGC      ---------------------------------------------IRFYQKARIGQQMHEDVKQ-HQAKA
MRAY_BACV8      MLYYLFQYLEKFFPGAGMFG-YVSFRXXXXXXXXXXXXXXFGEYFINLLKRKQITETQRDASIDPNVKKV
MRAY_THEMA      --------------------------------------------LIKLFRRRRIGQYIRKEGPDLHGYKE
MRAY_BACFR      MLYYLFEWLHKLFPGAGMFG-YTSFRXXXXXXXXXXXXXXWGDKFINLLKRKQITETQRDAKIDPFVNKV
MRAY_BACFN      MLYYLFEWLHKLFPGAGMFG-YTSFRXXXXXXXXXXXXXXWGDKFINLLKRKQITETQRDAKIDPFVNKV
MRAY_SACEN      --------------------------------------------LIRVFSRQGFGQEIREEVQQSHAAKR
MRAY_ARTCA      -----------------------------------------GTPLIRLLVRRGYGQFIRDDGPTSHHTKR
MRAY_SYNS3      ------------------------------------------------LRGLKLGQVIREEGPQAHLTKS
MRAY_MYCUA      --------------------------------------------LIRLFTKQGFGHQIREDGPPSHHSKR
MRAY_MYCMM      --------------------------------------------LIRLFTKQGFGHQIREDGPPSHHSKR
MRAY_BACTN      MLYYLFEWLHKLFPGAGMFG-YTSFRALMAVILALLISSIWGDKFINLLKKKQITETQRDAKTDPFVNKV
MRAY_MOOTA      -----------------------------------------GPPVLAFLRRLKAGQTVRSDGPRSHLAKA
MRAY_CYAP7      -------------------------------------------PLLRWLKT---GQFVREDGPQSHLKKA
MRAY_BACA2      -------------------------------------------------RRLKFGQSIREEGPKSHMKKS
MRAY_ANASP      --------------------------------------------VVPLLQALKTGQIIREDGPQAHLKKA
MRAY_STRS7      ------------------------------------------------------GQQMHEDVKQ-HLAKA
MRAY_STREM      ------------------------------------------------------GQQMHEDVKQ-HLAKA
MRAY_LACJO      ---------------------------------------------IGFMRMKHEGQVIRDEGPKWHEKKS
MRAY_SYNPW      --------------------------------------------LITWLRALKMGQVIRTEGPQGHLSKS
MRAY_STRE4      ------------------------------------------------------GQQMHEDVKQ-HLAKA
MRAY_HELMI      --------------------------------------------LIPYLRRLKFGQSIREEGPKGHQRKA
MRAY_LEUCK      --------------------------------------------LIKFLKQSKEQAVIRKLGPD-HQSKA
MRAY_LACGA      ---------------------------------------------IGFMRMKHEGQVIRDEGPKWHEKKS
MRAY_SYNP2      -----------------------------------------GMWIVPLLRRLKTGQIIREEGPQAHLKKA
MRAY_LACLA      ------------------------------------------------------GQPTLEDVKQ-HASKA
MRAY_CORK4      -----------------------------------------------------LGQEIREEGPRSHLRKR
MRAY_PROAC      ------------------------------------------RWFIHWLAAKGYGQFIRDDXXXXXXXXX
MRAY_TROWT      --------------------------------------------------KIGWGQFIRLDGPRQHAIKR
MRAY_TROW8      --------------------------------------------------KIGWGQFIRLDGPRQHAIKR
MRAY_CLAMS      ---------------------------------------------IKLFHRLQWGQFIRDDGPQSHHTKR
MRAY_SALTO      --------------------------------------------------RLKAGQPIRAEGPVMHQGKK
MRAY_THENN      --------------------------------------------LINLFRKKSVGQYIRKEGPDLHGYKE
MRAY_THEFY      ----------------------------------------------------KFGQEIRDDGPQGHKTKQ
MRAY_STRPM      ---------------------------------------------IKFYQLKKIGGQQMHEDVKQHLAKA
MRAY_STRPD      ---------------------------------------------IKFYQLKKIGGQQMHEDVKQHLAKA
MRAY_STRPC      ---------------------------------------------IKFYQLKKIGGQQMHEDVKQHLAKA
MRAY_STRPB      ---------------------------------------------IKFYQLKKIGGQQMHEDVKQHLAKA
MRAY_STRP1      ---------------------------------------------IKFYQLKKIGGQQMHEDVKQHLAKA
MRAY_CORDI      -----------------------------------------------------LGQEIREDGPKSHLRKR
MRAY_STRMU      ------------------------------------------------------GQQMHEDVKQ-HLAKA
MRAY_NOCSJ      ------------------------------------------RVAINQFTRLGYGQEIRDDGPTSHHTKR
MRAY_LACLM      ----------------------------------------------------------------------
MRAY_LACLS      ----------------------------------------------------------------------
MRAY_CLAM3      ---------------------------------------------IKLFHRLQWGQFIRDDGPQTHHTKR
MRAY_CORA7      ------------------------------------------------------GQEIREDGPKSHLRKR
MRAY_NOSP7      --------------------------------------------VIPLLQALKTGQIIREDGPQAHLKKA
MRAY_MYCTU      --------------------------------------------LIRLFTKQGFGHQIREDGPPSHHTKR
MRAY_MYCTA      --------------------------------------------LIRLFTKQGFGHQIREDGPPSHHTKR
MRAY_MYCBT      --------------------------------------------LIRLFTKQGFGHQIREDGPPSHHTKR
MRAY_MYCBP      --------------------------------------------LIRLFTKQGFGHQIREDGPPSHHTKR
MRAY_MYCBO      --------------------------------------------LIRLFTKQGFGHQIREDGPPSHHTKR
MRAY_GEOTN      ---------------------------------------------IPFLRRLKFGQSIREEGPKSHQKKS
MRAY_BEUC1      -----------------------------------------GTPLIRFLVKRQYGQFIRQDGPTAHFTKR
MRAY_SALAI      --------------------------------------------------RLKAGQPIRAEGPVMHQGKK
MRAY_LACF3      --------------------------------------------LIRYFRAKKEGQQIREEGPTWHEKKA
MRAY_SYNP6      --------------------------------------------VVPLLRRIKAGQFIREDGPQSHLQKA
MRAY_SYNE7      --------------------------------------------VVPLLRRIKAGQFIREDGPQSHLQKA
MRAY_GEOKA      ---------------------------------------------IPFLRRLKFGQSIREEGPKSHQKKS
MRAY_ENTFA      ---------------------------------------------IGYFQMKKQGQVTREDGPTWHSVKT
MRAY_SYNJB      ---------------------------------------------IPGLRRWKAGQVIRQEGPQSHQKKA
MRAY_COREF      --------------------------------------------LIRYFTNRQMGQEIREEGLQSHLRKR
MRAY_STRPF      ---------------------------------------------IKFYQLKKIGGQQMHEDVKQHLAKA
MRAY_STRP6      ---------------------------------------------IKFYQLKKIGGQQMHEDVKQHLAKA
MRAY_STRPG      ---------------------------------------------IKFYQLKKIGGQQMHEDVKQHLAKA
MRAY_MYCA1      --------------------------------------------LIRLFTRQGFGHHTREDGPPTHHAKR
MRAY_OCEIH      ---------------------------------------------IPFLRRLNFGQSIREEGPQSHQKKT
MRAY_RHOSR      --------------------------------------------LIKAFSRQGFGQEIRVEGPASHQSKR
MRAY_RHOOB      --------------------------------------------LIKAFSRQGFGQEIRVEGPASHQSKR
MRAY_STRP8      ---------------------------------------------IKFYQLKKIGGQQMHEDVKQHLAKA
MRAY_DESAP      -----------------------------------------GPVVIPLLHRLRFGQRVRSDGPTRHLQKT
MRAY_BACCN      ---------------------------------------------IPFLRKLKFGQSIRDEGPKSHQKKS
MRAY_SYMTH      --------------------------------------------VIPLMRRLRAGQTIRAEMSARHQAKA
MRAY_STRPZ      ---------------------------------------------IKFYQLKKIGGQQMHEDVKQHLAKA
MRAY_DICT6      ---------------------------------------------INFQRNKGIGKYIRKEGPSSHFQKS
MRAY_STRP3      ---------------------------------------------IKFYQLKKIGGQQMHEDVKQHLAKA
MRAY_BACSU      -------------------------------------------------RRLKFGQSIREEGPKSHQKKS
MRAY_DICTD      ---------------------------------------------INFQKSKGIGKYIRKEGPSSHFQKS
MRAY_DEIDV      ------------------------------------------------------GQPVRKDGPQTHLVKE
MRAY_CLOAB      -----------------------------------------GPLFIPILHKLKFGQPIREDGPKNHMKKA
MRAY_MYCPA      --------------------------------------------LIRLFTRQGFGHHTREDGPPTHHAKR
MRAY_SYNJA      -------------------------------------------------RRWKAGQVIREEGPQSHHKKA
MRAY_CLOPS      ---------------MEILKSMIDPKIVMAIVISFIVASILGPIIIPLLHKLKFGQNIRQEGPKSHLKKA
MRAY_CLOP1      ---------------MEILKSMIDPKIVMAIVISFIVASILGPIIIPLLHKLKFGQNIRQEGPKSHLKKA
MRAY_CLOPE      -----------------------------------------GPIIIPLLHKLKFGQNIRQEGPKSHLKKA
MRAY_LEUMM      --------------------------------------------VIKFLKQSKEQAVIRKLGPD-HQSKA
MRAY_MYCS2      --------------------------------------------LIRLFTKQGLGHEIREDGPPSHAKKR
MRAY_MYCSS      --------------------------------------------LIRLFTRQGFGHEIREDGPPTHHKKR
MRAY_MYCSK      --------------------------------------------LIRLFTRQGFGHEIREDGPPTHHKKR
MRAY_MYCSJ      --------------------------------------------LIRLFTRQGFGHEIREDGPPTHHKKR
MRAY_MYCVP      --------------------------------------------LIRLFTRQGFGHEIREDGPPSHHKKR
MRAY_MYCGI      ------------------------------------------------------GHEIREDGPPSHHKKR
MRAY_OENOB      --------------------------------------------------------------------KN
MRAY_BACLD      ---------------------------------------------IPFLRRLKFGQSIREEGPKSHQKKS
MRAY_DEIRA      ---------------------------------------------IHYSKKFGWGQPIRQDGPQTHLAKE
MRAY_PROMT      ----------------------------------------------------------------------
MRAY_THEEB      -----------------------------------------GMAVVPLLRRLKTGQIIREDGPQSHLQKS
MRAY_BACP2      ----------------------------------------------------------------------
MRAY_TREPS      ----------------------------------------------------------------------
MRAY_TREPA      ----------------------------------------------------------------------
MRAY_METTH      ----------------------------------------------------------------------
MRAY_GLOVI      -----------------------------------------GFAAVPLLRRWKARQFIREDGPRSHLKKA
MRAY_SYNR3      ------------------------------------------------LRALKMGQVIRQEGPQSHQSKS
MRAY_ARATH      -----------------------------------------GYIFVPLLDRLRVHEPIRTLGPVPHNRRP
Y1113_METJA     ----------------------------------------------------------------------
RFE_MYCLE       ----------------------------------------------------------------------
GPT_SULSO       ----------------------------------------------------------------------
GPT_CRILO       ----------------------------------------------------------------------
GPT_CRIGR       ----------------------------------------------------------------------
GPT_BOVIN       ----------------------------------------------------------------------
GPT_HUMAN       ----------------------------------------------------------------------
RFE_MYCTU       ----------------------------------------------------------------------
WECA_SALTY      ----------------------------------------------------------------------
WECA_SALTI      ----------------------------------------------------------------------
GPT_MOUSE       ----------------------------------------------------------------------
WECA_SHIFL      ----------------------------------------------------------------------
WECA_ECOLI      ----------------------------------------------------------------------
WECA_ECOL6      ----------------------------------------------------------------------
WECA_ECO57      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NTPTMGGXXXXXXXXXXXXXWGDLTSIYLWILILVVIFFGAIGFFDDYLKLVLKHPKGLRAKHKFALQSI
MRAY_FRATM      NTPTMGGXXXXXXXXXXXXXWGDLTSIYLWILILVVIFFGAIGFFDDYLKLVLKHPKGLRAKHKFALQSI
MRAY_FRATN      NTPTMGGXXXXXXXXXXXXXWGDLTSIYLWILILVVIFFGAIGFFDDYLKLVLKHPKGLRAKHKFALQSI
MRAY_FRATW      NTPTMGGXXXXXXXXXXXXXWGDLTSIYLWILILVVIFFGAIGFFDDYLKLVLKHPKGLRAKYKFALQSI
MRAY_FRATO      NTPTMGGXXXXXXXXXXXXXWGNLTSIYLWILILVVIFFGAIGFFDDYLKLVLKHPKGLRAKHKFALQSI
MRAY_FRATH      NTPTMGGXXXXXXXXXXXXXWGNLTSIYLWILILVVIFFGAIGFFDDYLKLVLKHPKGLRAKHKFALQSI
MRAY_FRATF      NTPTMGGXXXXXXXXXXXXXWGNLTSIYLWILILVVIFFGAIGFFDDYLKLVLKHPKGLRAKHKFALQSI
MRAY_FRATT      NTPTMGGXXXXXXXXXXXXXWGDLTSIYLWILILVVIFFGAIGFFDDYLKLVLKHPKGLRAKYKFALQSI
MRAY_FRAT1      NTPTMGGXXXXXXXXXXXXXWGDLTSIYLWILILVVIFFGAIGFFDDYLKLVLKHPKGLRAKYKFALQSI
MRAY_FRAP2      NTPTMGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAIGFFDDYLKLVLKHPKGLRAKHKFALQSI
MRAY_SHEAM      GTPTMXXXXXXXXXXXXXXXWGDLGSRYVWVMLFVLGSFGLIGFIDDYRKVVRKDPKGLIARWKYIFQSL
MRAY_SHEHH      GTPTMGGLLILAGVFISVLLWGDLDSRYVWVVLFVLGSFGLIGFIDDYRKVVRKDTKGLIARWKYLLQXX
MRAY_SHELP      GTPTMGGLLILAGVFISVLLWGDLGSRYVWVMLFVLGAFGLIGFIDDYRKVVRKDTKGLIARWKYILQXX
MRAY_ALCBS      GTPTMGGALILVAIVISTLLWGDLENRFVWITLGVLFVFGAVGWVDDWRKVVEKNPRGLPARWKYLWLSV
MRAY_ALISL      GTPTMGGIMILTAITVTVFLWADLTNPYVWAVMFVLLGYGAVGFVDDYRKVVRKNTDGLIARWKYFWQSA
MRAY_VIBFM      GTPTMGGIMILTAISVTVFLWADLTNPYVWAVMFVLLGYGAVGFVDDYRKVVRKNTDGLIARWKYFWQSS
MRAY_VIBF1      GTPTMGGIMILTAITVTVFLWADLTNPYVWAVMFVLLGYGAVGFVDDYRKVVRKNTDGLIARWKYFWQSS
MRAY_ERWCT      GTPTMGGVMILVAIIVSVLMWANLSNPYVWCVLLVLAGYGAVGFVDDYRKVVRKDTKGLIARWKYFWQSV
MRAY_YERPY      GTPTMGGLMILFSITISVLMWAYPSNPYVWCVLFILIGYGIVGFIDDYRKVVRKNTKGLIARWKYFWQSI
MRAY_YERPS      GTPTMGGLMILFSITISVLMWAYPSNPYVWCVLFILIGYGIVGFIDDYRKVVRKNTKGLIARWKYFWQSI
MRAY_YERPP      GTPTMGGLMILFSITISVLMWAYPSNPYVWCVLFILIGYGIVGFIDDYRKVVRKNTKGLIARWKYFWQSI
MRAY_YERPN      GTPTMGGLMILFSITISVLMWAYPSNPYVWCVLFILIGYGIVGFIDDYRKVVRKNTKGLIARWKYFWQSI
MRAY_YERPE      GTPTMGGLMILFSITISVLMWAYPSNPYVWCVLFILIGYGIVGFIDDYRKVVRKNTKGLIARWKYFWQSI
MRAY_YERPB      GTPTMGGLMILFSITISVLMWAYPSNPYVWCVLFILIGYGIVGFIDDYRKVVRKNTKGLIARWKYFWQSI
MRAY_YERPA      GTPTMGGLMILFSITISVLMWAYPSNPYVWCVLFILIGYGIVGFIDDYRKVVRKNTKGLIARWKYFWQSI
MRAY_YERP3      GTPTMGGLMILFSITISVLMWAYPSNPYVWCVLFILIGYGIVGFIDDYRKVVRKNTKGLIARWKYFWQSI
MRAY_PHOLL      GTPTMGGXXXXXXXXXXXXXWVRLNNPYVWCVLIVLIGYGIVGFVDDYRKVVRKDTKGLIARWKYFWQSV
MRAY_EDWI9      GTPTMGGLMILTSITISVLMWAYPSNPYVWCVLFVLLGYGIVGFVDDYRKVVRKNTDGLIARWKYFWQSV
MRAY_PSEA6      GTPTMGGXXXXXXXXXXXXXWADLTNRYVWVTLSVVVGYGIIGFIDDYRKVVRKDPKGLIARWKYFWQSV
MRAY_PECCP      GTPTMGGVMILVAIIVSVLMWANLSNPYVWCVLLVLAGYGAVGFVDDYRKVVRKDTKGLIARWKYFWQSV
MRAY_YERPG      GTPTMGGLMILFSITISVLMWAYPSNPYVWCVLFILIGYGIVGFIDDYRKVVRKNTKGLIARWKYFWQSI
MRAY_SHEB9      GTPTMGGLLILAAIFISVLLWGDLGSRYVWVMLFVLGSFGLIGFIDDYRKVVRKDTKGLIARWKXXXXXX
MRAY_SHEB5      GTPTMGGLLILAAIFISVLLWGDLGSRYVWVMLFVLGSFGLIGFIDDYRKVVRKDTKGLIARWKXXXXXX
MRAY_SHEB2      GTPTMGGLLILAAIFISVLLWGDLGSRYVWVMLFVLGSFGLIGFIDDYRKVVRKDTKGLIARWKXXXXXX
MRAY_SODGM      GTPTMGGLMILTSITISVLMWAYPSNPYVWCVLFVLVGYGIVGFIDDYRKVVRKDTKGLIVRWKYFWQSV
MRAY_SHEB8      GTPTMGGLLILAAIFISVLLWGDLGSRYVWVMLFVLGSFGLIGFIDDYRKVVRKDTKGLIARWKXXXXXX
MRAY_VIBHB      GTPTMGGIMILAAISITILLWTDLSNPYVWAVLTVLLGYGAIGFVDDYRKVVRKNTDGLIARWKYFWQSL
MRAY_VIBPA      GTPTMGGIMILAAISITILLWTDLSNPYVWAVLTVLLGYGAVGFVDDYRKVVRKNTDGLIARWKYFWQSL
MRAY_PSEPK      GTPTMGGALILSAIAVSTLLWADLSNRYVWVVLIVTLAFGAIGWVDDYRKVIEKNSRGLPSRWKYFWQSV
MRAY_PSEPG      GTPTMGGALILSAIAVSTLLWADLSNRYVWVVLIVTLAFGAIGWVDDYRKVIEKNSRGLPSRWKYFWQSV
MRAY_PSEPF      GTPTMGGALILSSIGVSTLLWADLSNRYVWVVLLVTLLFGAIGWVDDYRKVIEKNSRGLPSRWKYFWQSV
MRAY_PSEP1      GTPTMGGALILSAIAVSTLLWADLSNRYVWVVLIVTLAFGAIGWVDDYRKVIEKNSRGLPSRWKYFWQSV
MRAY_IDILO      GTPTMGGVLILAAVLGSSLLWADLDNRYVWVVLLVTTGFGIVGFVDDYRKVVRKDPKGLIAKWKYFWQSV
MRAY_VIBVY      GTPTMGGVMILAAISITILLWANLSNPYVWAVLAVLMGYGAVGFVDDYRKVVRKNTDGLIARWKYFWQSA
MRAY_YERE8      GTPTMGGLMILFSITISVLMWAYPSNPYVWCVLFILIGYGIVGFIDDYRKVVRKDTKGLIARWKYFWQSI
MRAY_XANAC      GTPTMXXXXXXXXXXXXXXXWGDLRNRYVWLVLAVMICFGAIGWYDDWIKIVKRDPNGLKSRWKYLLQSI
MRAY_VIBVU      GTPTMGGVMILAAISITILLWANLSNPYVWAVLAVLMGYGAVGFVDDYRKVVRKNTDGLIARWKYFWQSA
MRAY_SERP5      GTPTMGGIMILTSITVSVLMWAYPSNPYVWCVLFVLVGYGIVGFVDDYRKVVRKDTKGLIARWKYFWQSV
MRAY_PSEPW      GTPTMGGALILSAIGISTLLWADLSNRYVWTVLIVTLLFGAIGWVDDYRKVIEKNSRGLPSRWKYFWQSV
MRAY_XANCP      GTPTMXXXXXXXXXXXXXXXWGDLRNRYVWLVLAVMICFGAIGWYDDWIKIVRRDPNGLKSRWKYLLQSI
MRAY_XANCB      GTPTMXXXXXXXXXXXXXXXWGDLRNRYVWLVLAVMICFGAIGWYDDWIKIVRRDPNGLKSRWKYLLQSI
MRAY_XANC8      GTPTMXXXXXXXXXXXXXXXWGDLRNRYVWLVLAVMICFGAIGWYDDWIKIVRRDPNGLKSRWKYLLQSI
MRAY_XANC5      GTPTMXXXXXXXXXXXXXXXWGDLRNRYVWLVLAVMICFGAIGWYDDWIKIVKRDPNGLKSRWKYLLQSI
MRAY_XANOP      GTPTMXXXXXXXXXXXXXXXWGDLRNRYVWLVLAVMICFGAIGWYDDWIKIVRRDPNGLKSRWKYLLQSI
MRAY_PSEU5      GTPTMGGALILSAIGISTLLWADLANRYVWVVLAVTLLFGAIGWVDDYRKVIEKNSRGLPSRWKYFWQSV
MRAY_PSEMY      GTPTMGGALILTAIAVSTLLWADLSNRYVWVVLAVTLLFGAIGWVDDYRKVIEKNSRGLPSRWKYFWQSV
MRAY_XANOR      GTPTMXXXXXXXXXXXXXXXWGDLRNRYVWLVLAVMICFGAIGWYDDWIKIVRRDPNGLKSRWKYLLQSI
MRAY_XANOM      GTPTMXXXXXXXXXXXXXXXWGDLRNRYVWLVLAVMICFGAIGWYDDWIKIVRRDPNGLKSRWKYLLQSI
MRAY_PSEF5      GTPTMGGALILSAIGISTLLWADLRNHYVWVVLLVTLAFGAIGWVDDYRKVIEKNSRGLPSRWKYFWQSV
MRAY_ERWT9      GTPTMGGIMILTSITVSVLLWAYPSNPYVWCVLFVLVGYGIVGFVDDYRKVVRKDTKGLIARWKYFWQSA
MRAY_THICR      GTPTMGGVMILFSVSSAILLWGNLTNHYLLIATLTMLGFGVIGFVDDYKKVVYKDPNGMRSRTKFFWQSV
MRAY_METCA      GTPTMGGAXXXXXXXXXXXXWSDLGNRYVWAVLLVTLAYGLIGFVDDYKKLVLKNSKGLAARYKYLWQSV
MRAY_PSEE4      GTPTMGGXXXXXXXXXXXXXXXDLTNRYVWVVLIVTLAFGAIGWVDDYRKVIEKNSRGLPSRWKYFWQSV
MRAY_SHEWM      GTPTMGGILILAGVFISVLLWGDLGSRYVWVVLFVLASFGLIGFIDDYRKVVRKDTKGLIAKWKYILQSL
MRAY_SHEFN      GTPTMGGILILAGIFISVLLWGDLSNRYVLVTLFVLASFGVIGFIDDYRKVVKKDSKGLIARWKYALQSI
MRAY_SHESH      GTPTMGGILILAGVFISVLLWGDLASRYVWVVLFVLASFGLIGFIDDYRKVVRKDTKGLIAKWKYILQSL
MRAY_PSEFS      GTPTMXXXXXXXXXXXXXXXWADLHNRYVWVVLLVTLLFGAIGWVDDYRKVIEKNSKGLPSRWKYFWQSV
MRAY_PSEAE      GTPTMGGXXXXXXXXXXXXXXXDLSNRYVWVVLVVTLLFGAIGWVDDYRKVIEKNSRGLPSRWKYFWQSV
MRAY_PSEAB      GTPTMGGXXXXXXXXXXXXXXXDLSNRYVWVVLVVTLLFGAIGWVDDYRKVIEKNSRGLPSRWKYFWQSV
MRAY_PSEA8      GTPTMGGXXXXXXXXXXXXXXXDLSNRYVWVVLVVTLLFGAIGWVDDYRKVIEKNSRGLPSRWKYFWQSV
MRAY_PSEA7      GTPTMGGXXXXXXXXXXXXXXXDLSNRYVWVVLVVTLLFGAIGWVDDYRKVIEKNSRGLPSRWKYFWQSV
MRAY_SHESR      GTPTMGGLMILGAIFISVLLWGDLGSRYVWVMLFVLGSFGMIGFIDDYRKVVRKDTKGLIARWKYILQSL
MRAY_SHESM      GTPTMGGLMILGAIFISVLLWGDLGSRYVWVMLFVLGSFGMIGFIDDYRKVVRKDTKGLIARWKYILQSL
MRAY_SHESA      GTPTMGGLMILGAIFISVLLWGDLGSRYVWVMLFVLGSFGMIGFIDDYRKVVRKDTKGLIARWKYILQSL
MRAY_PSE14      GTPTMXXXXXXXXXXXXXXXWADLSNRYVWVVLLVTLLFGAIGWVDDYRKVIEKNSRGLPSRWKYFWQSV
MRAY_PSEU2      GTPTMXXXXXXXXXXXXXXXWADLSNRYVWVVLLVTFLFGAIGWVDDYRKVIEKNSRGLPSRWKYFWQSV
MRAY_PSESM      GTPTMXXXXXXXXXXXXXXXWADLSNRYVWVVLLVTFLFGAIGWVDDYRKVIEKNSRGLPSRWKYFWQSV
MRAY_SHEON      GTPTMGGLLILGAIFLSVLLWGDLGSRYVWVMLFVLGSFGMIGFIDDYRKVVRKDTKGLIARWKYILQSL
MRAY_RUTMC      GTPTMGGILILFTFMISVLIWGDWSNIYLWIVIVTSIIFGTIGFTDDYIKIKHKSSNGLSFSIKFLTQSL
MRAY_CHRSD      GTPTMGGAMILIAIAVSTLLWGDLTNHYVWLVLAVTLGFGAIGWVDDYRKVVEKNPRGLPARWKYFWQSA
MRAY_COXBR      GTPTMGGXXXXXXXXXXXXXWGDLSNRFIWVILLVTVAFSAIGWMDDYRKIIRKNSKGLSARSKYLLQSI
MRAY_COXBU      GTPTMGGXXXXXXXXXXXXXWGDLSNRFIWVILLVTVAFSAIGWMDDYRKIIRKNSKGLSARSKYLLQSI
MRAY_COXBN      GTPTMGGXXXXXXXXXXXXXWGDLSNRFIWVILLVTVAFSAIGWMDDYRKIIRKNSKGLSARSKYLLQSI
MRAY_COXB2      GTPTMGGXXXXXXXXXXXXXWGDLSNRFIWVILLVTVAFSAIGWMDDYRKIIRKNSKGLSARSKYLLQSI
MRAY_COXB1      GTPTMGGXXXXXXXXXXXXXWGDLSNRFIWVILLVTVAFSAIGWMDDYRKIIRKNSKGLSARSKYLLQSI
MRAY_PROMH      GTPTMGGIMILFSIAVSTLLWARLDNPYVWCVLLVLXXXXXXXXXXXXRKVVRKDTRGLIARWKYFWQSV
MRAY_ACTP2      GTPTMGGIMILIAIGVSTLLWADLRNSYIWFVLFVLFGYGAVGFVDDYWKIKRKNTDGLIARWKYFWLSV
MRAY_ACTPJ      GTPTMGGIMILIAIGVSTLLWADLRNSYVWFVLFVLFGYGAVGFVDDYWKIKRKNTDGLIARWKYFWLSV
MRAY_PHOPR      GTPTMGGIMXXXXXXXXXXXXXDLSNPYIWAVLAVMLGYGVVGFVDDYRKVVHKNSDGLIARWKYFWQSV
MRAY_AZOVD      GTPTMGGXXXXXXXXXXXXXXXDLSNRYVWTVLAVTLLFGAIGWVDDYRKVIEKNSRGLPSRWKYFWQSV
MRAY_MANSM      GTPTMGGLMILATITVSTLLWGDLSNPYIWFSLFVLLGYGAIGFVDDYRKIKYKNTDGLIARWKYFWLSL
MRAY_ACTP7      GTPTMGGIMILIAIGVSTLLWADLRNSYVWFVLFVLFGYGAVGFVDDYWKIKRKNTDGLIARWKYFWLSV
MRAY_SHEPW      GTPTMGGLLILAGIFISVLLWGDLGSRYVWVVLFVLASFGTIGFIDDYRKVVRKDTKGLIARWKYLLQXX
MRAY_SHEPA      GTPTMGGILILAGVFISVLLWGDLGSRYVWVVLFVLATFGLIGFIDDYRKVVRKDTKGLIARWKYLLQXX
MRAY_NITEU      GTPTMGGXXXXXXXXXXXXXWADLSNRYIWVVSLTTLGFGAIGWVDDYRKVIQRNSKGLSASSKFFWQSI
MRAY_MARMS      GTPTMGGALIIFSISVSTLLWGDLRNQYVWVVLLVMLAFGVVGWVDDYRKVVEKNPRGLPGRWKYFWQSV
MRAY_DESAA      GTPTMGGVLIMSAVMFSTLLWADLTNAYVWIALGVTFGFGLIGFVDDYLMQVKKRSKGLSARGKFCLQVV
MRAY_LARHH      GTPTMXXXXXXXXXXXXXXXWADLTNKYVWLLLAVLFGTGAIGFYDDWRKVVYKDPKGISARAKMFWQSA
MRAY_METFK      GTPTMGGALILIAIVISTLLWADLSNRFVWVVLITTLGFGVIGWVDDWRKVVYRNPKGLSAKAKYFWQSL
MRAY_MARAV      GTPTMGGALILVAIAISTLLWADLTNRYVWVVLLVTLLFGAIGWVDDYRKVVERNPRGLPARWKYFWQSV
MRAY_SHEVI      GTPTMGGILILAGIFISVLLWGDLGSRYVWVVLFVLASFGLIGFIDDYRKVVRKDTKGLIARWKYILQXX
MRAY_HAES2      GTPTMGGIMILFAIGVSTLLWANLANPYVWFCLFVLFGYGAVGFVDDYRKITRKNTAGLVARWKYFWLSV
MRAY_HAES1      GTPTMGGIMILFAIGVSTLLWANLANPYVWFCLFVLFGYGAVGFVDDYRKITRKNTAGLVARWKYFWLSV
MRAY_XYLFA      GTPTMGGSLILMTVTLSVLLWGDLRNRYVWLVLVVMLAFGAIGWYDDWIKLARRDPNGLKSRWKYLLQSI
MRAY_CHRVO      GTPTMGGSXXXXXXXXXXXXWADLSNKYVWLLLAVMLGTGALGFYDDWRKVVYKDPKGVSAKFKMAWQSA
MRAY_ALTMD      GTPTMGGLLILAAIVVSGLLWADLTNRYXXXXXXXXXAYGIIGFVDDYRKVIRKDSKGLIARWKYFWQSV
MRAY_XYLFT      GTPTMGGSLILMTVTLSVLLWGDLRNRYVWLVLVVMLAFGAIGWYDDWIKLARRDPNGLKSRWKYLLQSI
MRAY_XYLFM      GTPTMGGSLILMTVTLSVLLWGDLRNRYVWLVLVVMLAFGAIGWYDDWIKLARRDPNGLKSRWKYLLQSI
MRAY_XYLF2      GTPTMGGSLILMTVTLSVLLWGDLRNRYVWLVLVVMLAFGAIGWYDDWIKLARRDPNGLKSRWKYLLQSI
MRAY_THISH      GTPTMGGALILVAVAVSTLLWSDLSNRFVWVVLMVTLLFGLIGGIDDYRKLRYGNSKGLSARTKFFWQSV
MRAY_PSYWF      GTPTMGGVLILTSIGFSTLCWANLANPYVWILMVVMVIFGAVGWADDWLKIKYKNPKGLIARKKYFWLSV
MRAY_AZOSB      GTPTMXXXXXXXXXXXXXXXXXDLRNAYVWVTLLVTLGFGAVGWVDDWRKVVHRDPKGLASRWKYFWTSA
MRAY_ALHEH      GTPTMGGXXXXXXXXXXXXXWSDLTNRYVWVVLLTTLAFGVIGGVDDYRKLALGNSKGLSARAKFFWQTV
MRAY_BURP8      GTPTMGGVLILIGIAVSTLLWADLTNRFIWIVMLVTFGFGVIGWVDDYRKVVYKDPRGMSSREKYFWQSL
MRAY_SHESW      GTPTMGGLLILAAIFISVLLWGDLGSRYVWVMLFVLGSFGLIGFIDDYRKVVRKDTKGLIARWKXXXXXX
MRAY_SHEPC      GTPTMGGLLILAAIFISVLLWGDLGSRYVWVMLFVLGSFGLIGFIDDYRKVVRKDTKGLIARWKXXXXXX
MRAY_COLP3      GTPTMGGXXXXXXXXXXXXXWADLSNIYVWXXXXXXXXXXXXXXXDDYRKVIRKDANGLIARWKYFWQTV
MRAY_ACIAD      GTPTMGGVLILMSIGISTLLWADLSNPYVWIVLGVMVVFGAVGWADDWIKIRYKDNAGLPARKKFFWTSV
MRAY_SALTY      GTPTMGGIMILTSIVISVLLWAYPSNPYVWCVLVVLIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_SALTI      GTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_SALSV      GTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_SALPB      GTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_SALNS      GTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_SALHS      GTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_SALG2      GTPTMGGIMILTSIVISVLLWAYPSNPYVWCVLVVLIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_SALEP      GTPTMGGIMILTSIVISVLLWAYPSNPYVWCVLVVLIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_SALDC      GTPTMGGIMILTSIVISVLLWAYPSNPYVWCVLVVLIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_SALCH      GTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_SALAR      GTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_SALA4      GTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_PSEHT      GTPTMGGLLILAAIFTSTLLWADLSNKYVWATLFVIGSLGVVGFVDDYRKVIRKDPKGLIAKWKYFWQSV
MRAY_VIBCM      GTPTMGGVMILAAITITVLLWADLTNPYVWAVLAVLLGYGAVGFVDDYRKVVRKNTDGLIARWKYFWQSA
MRAY_VIBCH      GTPTMGGVMILAAITITVLLWADLTNPYVWAVLAVLLGYGAVGFVDDYRKVVRKNTDGLIARWKYFWQSA
MRAY_SALPC      GTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_LEGPH      GTPTMGGVLILLAITVSCLLWCDLRQTSLWLVLLVTLANGLVGWVDDYRKLVLKNSKGLPGRWKYFWQSV
MRAY_LEGPC      GTPTMGGVLILLAITVSCLLWCDLRQTSLWLVLLVTLANGLVGWVDDYRKLVLKNSKGLPGRWKYFWQSV
MRAY_LEGPA      GTPTMGGVLILLAITVSCLLWCDLRQTSLWLVLLVTLANGLVGWVDDYRKLVLKNSKGLPGRWKYFWQSV
MRAY_VIBC3      GTPTMGGVMILAAITITVLLWADLTNPYVWAVLAVLLGYGAVGFVDDYRKVVRKNTDGLIARWKYFWQSA
MRAY_RALPJ      GTPTMGGVLVLIGIAVSTLLWADWGNRFIWIVLLVTLGYGAIGWVDDYRKVVHRDPKGMSSREKFFWQTV
MRAY_SHEDO      GTPTMGGLLILAGIFVSVLLWGDLESRYVLVMLFVLGSFGTIGFIDDYRKVVRKDTKGLIARWKYILQSL
MRAY_SALPK      GTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLIGYGIIGFVDDYHKVVRKDTKGLIARWKYFWMSV
MRAY_SALPA      GTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLIGYGIIGFVDDYHKVVRKDTKGLIARWKYFWMSV
MRAY_KLEP3      GTPTMGGIMILTAITVSVLLWAYPSNPYVWCVLTVLIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_DELAS      GTPTMGGALILLSIAVSTLLWFDLSNRFVWIVLLVTLGFGTIGWVDDWRKVVNKDPEGMRSGEKYFWQSV
MRAY_LEGPL      GTPTMGGVLILLAITVSCLLWCDLRQTSLWLVLLVTLANGLVGWVDDYRKLVLKNSKGLPGRWKYFWQSV
MRAY_KLEP7      GTPTMGGIMILTAITVSVLLWAYPSNPYVWCVLTVLIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_CELJU      GTPTMGGALILSAMFISTLLWSDFGNRYVWVVLIVTAIFGAVGWVDDYRKVAKRDPKGLPARWKYFWQSI
MRAY_BORPD      GTPTMGGALILIAVAISTLLWADWTNRFVWVVLLVTFGFGWIGWMDDYRKVVYRDPEGMPARQKFFWQAT
MRAY_POLNA      GTPTMGGVLILLAIGISTLLWFDLSNRFVWIVLLVTLGFGAIGWVDDWRKVVLKDPEGMRSREKYLWQSV
MRAY_HERAR      GTPTMGGALILLAIGVATLLWTDLSNRFVWVVLIVTLGFGAVGWVDDYRKVVYKDPKGMASREKYMWQSI
MRAY_ENTS8      GTPTMGGIMILTSIVVSVLLWAYPSNPYVWCVLFVLVGYGAVGFVDDYRKVVRKDTKGLIARWKYFWMSL
MRAY_JANMA      GTPTMGGVLILVSIGISTLLWTDLSNRFIWVVLIVTLGFGAVGWVDDYRKVVYKDPKGMASREKYMWQSI
MRAY_ENT38      GTPTMGGIMILTAIVVSVLLWAYPSNPYVWCVLTVLIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_PASMU      GTPTMGGVMILFAITVSTLLWANLANPYVWFSLFVLLGYGAIGFVDDYRKITRKNTDGLIARWKYFWLSV
MRAY_TOLAT      GTPTMGGIMILLSIFLSVILWARLSNPYVWVVLFVLVSFGTIGFIDDYRKVIRKNPDGLIARWKYFWQSX
MRAY_BURTA      GTPTMGGVLILIGIAVATLLWGDLTNRFIWIVMLVTFGFGVIGWVDDYRKVVYKDPRGMSSREKYFWQSV
MRAY_BURPS      GTPTMGGVLILIGIAVATLLWGDLTNRFIWIVMLVTFGFGVIGWVDDYRKVVYKDPRGMSSREKYFWQSV
MRAY_BURP6      GTPTMGGVLILIGIAVATLLWGDLTNRFIWIVMLVTFGFGVIGWVDDYRKVVYKDPRGMSSREKYFWQSV
MRAY_BURP1      GTPTMGGVLILIGIAVATLLWGDLTNRFIWIVMLVTFGFGVIGWVDDYRKVVYKDPRGMSSREKYFWQSV
MRAY_BURP0      GTPTMGGVLILIGIAVATLLWGDLTNRFIWIVMLVTFGFGVIGWVDDYRKVVYKDPRGMSSREKYFWQSV
MRAY_BURMS      GTPTMGGVLILIGIAVATLLWGDLTNRFIWIVMLVTFGFGVIGWVDDYRKVVYKDPRGMSSREKYFWQSV
MRAY_BURMA      GTPTMGGVLILIGIAVATLLWGDLTNRFIWIVMLVTFGFGVIGWVDDYRKVVYKDPRGMSSREKYFWQSV
MRAY_BURM9      GTPTMGGVLILIGIAVATLLWGDLTNRFIWIVMLVTFGFGVIGWVDDYRKVVYKDPRGMSSREKYFWQSV
MRAY_BURM7      GTPTMGGVLILIGIAVATLLWGDLTNRFIWIVMLVTFGFGVIGWVDDYRKVVYKDPRGMSSREKYFWQSV
MRAY_BURM1      GTPTMGGVLILIGIAVATLLWGDLTNRFIWIVMLVTFGFGVIGWVDDYRKVVYKDPRGMSSREKYFWQSV
MRAY_BURXL      GTPTMGGVLILLGIAVATLLWADLTNRFIWIVMLVTFGFGVIGWVDDYRKVVYKDPRGMSSREKYFWQSV
MRAY_BURPP      GTPTMGGVLILLGIAVATLLWADLTNRFIWIVMLVTFGFGVIGWVDDYRKVVYKDPRGMSSREKYFWQSV
MRAY_ACIF5      GTPTMGGAXXXXXXXXXXXXWSDLGNPLVWVAVLTTLAFGAIGFVDDWRKLRRQNSKGLSARAKYGLQSL
MRAY_ACIF2      GTPTMGGAXXXXXXXXXXXXWSDLGNPLVWVAVLTTLAFGAIGFVDDWRKLRRQNSKGLSARAKYGLQSL
MRAY_BURVG      GTPTMGGVLILIGIAVATLLWGDLTNRFIWIVMLVTFGFGVIGWVDDYRKVVHKDPRGMSSREKYFWQSV
MRAY_ACIBY      GTPTMXXXXXXXXXXXXXXXWADLSNPYVWIVLGVMVVFGAVGWADDWIKIRYKDNAGLPARKKFFWTSV
MRAY_ACIBS      GTPTMXXXXXXXXXXXXXXXWADLSNPYVWIVLGVMVVFGAVGWADDWIKIRYKDNAGLPARKKFFWTSV
MRAY_ACIBC      GTPTMXXXXXXXXXXXXXXXWADLSNPYVWIVLGVMVVFGAVGWADDWIKIRYKDNAGLPARKKFFWTSV
MRAY_ACIB5      GTPTMXXXXXXXXXXXXXXXWADLSNPYVWIVLGVMVVFGAVGWADDWIKIRYKDNAGLPARKKFFWTSV
MRAY_BURCM      GTPTMGGVLILIGIAVATLLWGDLTNRFIWIVMLVTFGFGVIGWVDDYRKVVYKDPRGMSSREKYFWQSV
MRAY_BURA4      GTPTMGGVLILIGIAVATLLWGDLTNRFIWIVMLVTFGFGVIGWVDDYRKVVYKDPRGMSSREKYFWQSV
MRAY_THIDA      GTPTMGGALILVSVAVTTLLWADLSNDYVWLALMTLLGFGVIGWVDDWRKVVEKNSRGLASRWKYFWQSA
MRAY_PSYA2      GTPTMGGVLILSAIGVSTLLWARLNNPYVWILLIVMIIFGAVGWADDWLKIKYKNPKGLIARKKYFWLSM
MRAY_NEIMF      GTPTMGGSLILTAITVSTLLWGNWANPYIWIXXXXXXXXXXXXFYDDWRKVVYKDPNGVSAKFKMVWQSS
MRAY_NEIMB      GTPTMGGSLILTAITVSTLLWGNWANPYIWIXXXXXXXXXXXXFYDDWRKVVYKDPNGVSAKFKMVWQSS
MRAY_CITK8      GTPTMGGIMILTAIVVSVLLWAYPSNPYVWCXXXXXXGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_POLSJ      GTPTMGGVLILMSIGISTLLWFDLSNRFVWIVLLVTLGFGAIGWADDWRKVVLKDPEGMRSREKYLWQSL
MRAY_NEIMA      GTPTMGGSLILTAITVSTLLWGNWANPYIWIXXXXXXXXXXXXFYDDWRKVVYKDPNGVSAKFKMVWQSS
MRAY_NEIM0      GTPTMGGSLILTAITVSTLLWGNWANPYIWIXXXXXXXXXXXXFYDDWRKVVYKDPNGVSAKFKMVWQSS
MRAY_NEIG2      GTPTMGGSLILTAITVSTLLWGNWANPYIWIXXXXXXXXXXXXFYDDWRKVVYKDPNGVSAKFKMVWQSS
MRAY_NEIG1      GTPTMGGSLILTAITVSTLLWGNWANPYIWIXXXXXXXXXXXXFYDDWRKVVYKDPNGVSAKFKMVWQSS
MRAY_BURS3      GTPTMGGVLILIGIAVATLLWGDLTNRFIWIVMLVTFGFGVIGWVDDYRKVVHKDPRGMSSREKYFWQSV
MRAY_BURCJ      GTPTMGGVLILIGIAVATLLWGDLTNRFIWIVMLVTFGFGVIGWVDDYRKVVHKDPRGMSSREKYFWQSV
MRAY_BURCH      GTPTMGGVLILIGIAVATLLWGDLTNRFIWIVMLVTFGFGVIGWVDDYRKVVHKDPRGMSSREKYFWQSV
MRAY_BURCC      GTPTMGGVLILIGIAVATLLWGDLTNRFIWIVMLVTFGFGVIGWVDDYRKVVHKDPRGMSSREKYFWQSV
MRAY_BURCA      GTPTMGGVLILIGIAVATLLWGDLTNRFIWIVMLVTFGFGVIGWVDDYRKVVHKDPRGMSSREKYFWQSV
MRAY_ECOSM      GTPTMGGIMILTAIVISVLLWAYPSNPYVWCXXXXXXGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_ECOLU      GTPTMGGIMILTAIVISVLLWAYPSNPYVWCXXXXXXGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_ECO7I      GTPTMGGIMILTAIVISVLLWAYPSNPYVWCXXXXXXGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_RALSO      GTPTMGGVLVLIGIAVSTLLWCDWGNRFIWIVLLVTLGYGTIGWVDDYRKVVHRDPKGMSSREKFFWQTV
MRAY_HALHL      GTPTMGGALILVAIAVSTLLWADLTNRYVWVVLLVTLAFGLIGGVDDALKLARQDSQGLRARTKFSLQVX
MRAY_VEREI      GTPTMGGVXXXXXXXXXXXXWFDLSNRFVWIVLLVTLGFGAIGWVDDWRKVVDKNPEGMRSREKYLWQSL
MRAY_TERTT      GTPTMGGTLILFSIVTATLLWADLSNRYVLAVLFVTITFGLIGWVDDYRKVVEKNSKGLPAKWKYFWQSA
MRAY_PSYCK      GTPTMGGVLILSAIGVSTLLWARLNNPYVWILLIVMIIFGAVGWADDWLKIKYKNPKGLIARKKYFWLSM
MRAY_POLNS      GTPTMGGVLILIGIFISCILWADLSNRFIWIVMIVTFGFGLVGWVDDYRKVVYKDPKGMASRGKFFWQTL
MRAY_LEPCP      GTPTMGGVLILLSIAVSTLLWFDWSNRFVWVVMLVTFGFGAIGWVDDWRKVVQKNPEGMASGEKYLWQSL
MRAY_VARPS      GTPTMGGVLVLFAIAFATLMWFDPSNRFVWIVLWVTLGFGAIGWVDDWRKVVRKDPEGMRSREKYFWQSV
MRAY_RALEJ      GTPTMGGVLVLVSIAISTVLWCDWGNRFIWVVMLVTLGYGAIGWVDDYRKVVYRDPRGMSSREKFFWQTL
MRAY_POLSQ      GTPTMGGVLILIGIFVSCMLWADLSNRFIWIVMIVTFGFGAVGWVDDYRKVVRKDPKGMASREKFFWQTL
MRAY_HAEI8      GTPTMGGVMILFSIGVSTLLWANLANSYIWVCLFVLFGYGAIGFVDDFRKITRKNTDGLIARWKYFWMSV
MRAY_HAEIN      GTPTMGGVMILFSIGVSTLLWANLANPYIWVCLFVLFGYGAIGFVDDFRKITRKNTDGLIARWKYFWMSV
MRAY_HAEIG      GTPTMGGVMILFSIGVSTLLWANLANPYIWVCLFVLFGYGAIGFVDDFRKITRKNTDGLIARWKYFWMSV
MRAY_HAEIE      GTPTMGGVMILFSIGVSTLLWANLANPYIWVCLFVLFGYGAIGFVDDFRKITRKNTDGLIARWKYFWMSV
MRAY_DESAH      GTPTMGGILILFSLGVSTLLWADLTNHYILITLLSMLLFGAIGFIDDYLMQVKKRNMGFTARGKFLVQIM
MRAY_BORPE      GTPTMGGXXXXXXXXXXXXXXXDWTNRFVWVVLLVTFGFGWIGWMDDYRKVVYRDPEGMPARQKFFWQAT
MRAY_BORBR      GTPTMGGXXXXXXXXXXXXXXXDWTNRFVWVVLLVTFGFGWIGWMDDYRKVVYRDPEGMPARQKFFWQAT
MRAY_RHOFD      GTPTMGGALILLCIVIATLLWVDLSNRFVWIVLLVTLGFGAIGWVDDWRKVVNKDPEGMRSHEKYFWQSF
MRAY_BORPA      GTPTMGGXXXXXXXXXXXXXXXDWINRFVWVVLLVTFGFGWIGWMDDYRKVVYRDPEGMPARQKFFWQAT
MRAY_VIBSL      GTPTMGGVMILAAIIITVLMWADLSNPXXXXXXXXXXXXXXXXXXDDYRKVVRKNTDGLIARWKYFWQSA
MRAY_GEOSL      GTPTMGGILILASIVIPTLLWADLTNRYVWTTLFVILGYGLIGFTDDYKKVVEKDTKGLSPRQKMFWQML
MRAY_DIAST      GTPTMGGVLILGSIAISTLLWFDLSNRFVWIVLAVTLGFGAIGWVDDWRKVVNKDPEGMRSREKYFWQSV
MRAY_ACISJ      GTPTMGGVLILGSIAISTLLWFDLSNRFVWIVLAVTLGFGAIGWVDDWRKVVNKDPEGMRSREKYFWQSV
MRAY_PSYIN      GTPTMGGILILGAITFSSLLWARLDNSYVWIVLFTTLAFGAIGFMDDYLKVVRKHPDGLIARWKYFWQXX
MRAY_RHOCS      GTPTMGGLMILIAVIVSTLLWVDLANVYTWIVLLVTVXXXXXXXXXXXXKLTKRNTKGLSGRLKLAWTIA
MRAY_NITOC      GTPTMGGXXXXXXXXXXXXXXXXXSNRYIWXXXXXXXXXXXXXXXDDYKKLLAKDSRGLTSRYKYFWQSV
MRAY_RHISN      GTPTMGGLMILAGIVGSALLWADLSSIYVVSTLLVTLGFGAIGFYDDYLKVTKQSDKGFSGKARLGIEFV
MRAY_NITEC      GTPTMGGALILMAVIITTLLWADLSNRYIWLVLLTTLGFGAIGWVDDYRKVVQHNSKGLPASAKFFWQSI
MRAY_DICNV      GTPTMGGALIIFSITVSMLCWADLRSVYTWLALFVLLGFGAVGWTDDYLKLVKKNTKGLAAKQKXXXXXX
MRAY_SHIDS      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_ECOL6      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_ECO81      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_ECO5E      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_ECO57      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_WIGBR      NTPTMGGVMILVSVIFSVLSWSHLSNSYIWYVLYVLTGYGIIGFFDDYKKIINKNSQGLKAKWKYIWQXX
MRAY_SHISS      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_SHIFL      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_SHIF8      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_SHIBS      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_SHIB3      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_ESCF3      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_ECOUT      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_ECOSE      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_ECOLI      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_ECOLC      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_ECOL5      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_ECOK1      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_ECOHS      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_ECODH      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_ECOBW      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_ECO8A      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_ECO55      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_ECO45      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_ECO27      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_ECO24      GTPTMGGIMILTAIVISVLLWAYPSNPYXXXXXXXXXXXXXXXXXDDYRKVVRKDTKGLIARWKYFWMSV
MRAY_VESOH      GTPTMGGILILFAFIVSILIWGDWSNIYLWXXXXXXXXXXXXGFTDDYLKIKHKSSNGLSSSIKFLTQSL
MRAY_SACD2      GTPTMGGTLILFAIVFATLLWSDLTNRYVLAVLFVTLSFGLVGWVDDYRKVVQKNSKGLPAKWKYFWQSL
MRAY_PELPD      GTPTMGGVMILAAIVIPTLLWADLSNQYIWTVLFITIGYGLIGFVDDYKKVVEKNPKGLSPRQKMFWQVL
MRAY_DESOH      GTPTMGGLLIVFSVLVACLLWADLTNRYIWVTLAALAGFTTIGFIDDYLMQIKKRNKGLSARAKFLAQTV
MRAY_THEYD      GTPTMGGIIITASVLVAVLMWGNLKNHYMWIMIISFLGFGLIGFIDDYLKITRKNYKGLPGRYKLFAQLL
MRAY_SINMW      GTPTMGGLMILAGIVVSSLLWADLSSIYVVSTLLVTLGFGAIGFYDDYLKVTKQSDKGFSGKARLGIEFV
MRAY_HAEPS      GTPTMGGIMILFAIGVSTLLWADLRNPYVWFVLFILFGYGVVGFVDDYWKIARKNTDGLIARWKYFWLSV
MRAY_ACIAC      GTPTMGGVLILGAIAISTLLWFDLSNRFVWVVLAVTLGFGAIGWVDDWRKVVRKDPEGMRSREKYFWQSV
MRAY_PELCD      GTPTMGGXXXXXXXXXXXXXWTDLTNVYVWVTLLVTVGFGAVGFVDDYRKVKLRNSAGLSARQKMLWLML
MRAY_METPP      GTPTMGGXXXXXXXXXSTLLWFDWSNRFVWIVMIVTFGFGAIGWVDDWRKVVDKNPEGMRSREKYFWQSL
MRAY_ACTSZ      GTPTMGGIMILATITASSLLWGDLSNPYIWCSLFVLLGYGAIGFVDDYRKIKYKNTDGLIARWKYFWLSV
MRAY_AZOSE      GTPTMGGXXXXXXXXXXXXXWGDLRNQYVWVTLLVTLGFGAVGWVDDWRKVVHRDPKGLASRWKYLWTSX
MRAY_DESPS      GVPTMXXXXXXXXXXXXXXXWARLDNPLIWLVLLVTLFFGMIGAYDDYKKISKKTSEGLSAKGKLLLQIA
MRAY_RICBR      GTPTMGGIMIILSSCFSTLLLADLTNKYIWITLFGFVSFGIIGFLDDYAKVTKNNHYGVKGKSKLLLQGI
MRAY_DESAD      GTPTMXXXXXXXXXXXXXXXWADLTNIYVWLTMLVFAGFGLVGFVDDYTKIRGKQNKGISPKAKLLGQLL
MRAY_ACIBL      GTPTMGGVLITIAIIVPTLLWADLSNKFVWIAMLATIAFGAIGFTDDYLKVANRRNLGLTARAKMGXXXX
MRAY_RHORT      GTPTMGGIMILLGVGVATLLWADLSKGYVWAVLLLTLGYGAIGFADDYLKLTKRNTKGLSGRLKLVAQVG
MRAY_RICB8      GTPTMGGIMIILSSCFSTLLLADLTNKYIWITLFGFVSFSIIGFLDDYAKVTKNNHYGVKGKSKLLLQGI
MRAY_RHIME      GTPTMGGLMILTGIVVSSLLWADLSSIYVVSTLLVTLGFGAIGFYDDYLKVTKQSEKGFSGKARLGIEXX
MRAY_AGRVS      GTPTMGGLMILAGIVGSSLLWADLSNVYVVATLLVTLGFGAIGFYDDYLKVTKQSDKGFSGKARLAIEFL
MRAY_PARL1      GTPTMGGFLILVGLVPSVLLWADWSNRYVWIVLFVTLGFGAVGFADDYLKVSKISPKGVPGRVKLFFEFV
MRAY_METRJ      GTPTMGGLMILAGAVVAILLWANPRNHYVWVTLTVTLGFGAIGFYDDYLKVTKQSHKGFSGKFRLALEAV
MRAY_DECAR      GTPTMXXXXXXXXXXXXXXXXXDLTNKYVWTVLVVTLGYGIVGWYDDWKKVVYRDPNGLASRWKFFWQSV
MRAY_ACIC5      GTPTMGGVLICIAILLPTLLWSDLSDPFVWIVMLSTLAFGAIGFADDYIKVVHRRNLGLTARAKMTYQIL
MRAY_DESDG      GTPTMGGLLIGFSLIISVLLWGDLTNVYLWLVMLVFTGFGLVGFLDDYTKLRRKTNQGLTARSKF----L
MRAY_GEOLS      GTPTMGGXXXXXXXXXXXXXWADLTNVYIWLTLFIIVGYGLIGFMDDYLKVVKKNTKGLSARQKMFWQVL
MRAY_SOLUE      GTPTMGGVLIVISIVIPTLLWADLRYPYVWIALAGLLGYGWIGFLDDYAKVTKQRNLGLSGKRKLVYQFI
MRAY_GRABC      GTPTMGGVLILAATGISTLLWTDLRNGYVWAVLLLTLGYGGIGFADDYLKLSKRNTKGLPGRVKLIGQAV
MRAY_NITMU      GTPTMGGALILVSIAITTLLWADLSNRYVWIVLITTLGFGMIGWVDDYRKVVYRNPKGLSARAKLFWQSX
MRAY_CUPTR      GTPTMGGVLVLVSIAVSTLLWCDWGNRFIWVVMLVTFGYGAIGWVDDYRKVVYRDPRGMSSREKFFWQTL
MRAY_AGRRK      GTPTMGGLMILAGIVVSSLLWADLANVYVVATLLVTLGFGAIGFYDDYLKVTKQSDKGFSGRARLGLEFI
MRAY_GEOMG      GTPTMGGILILASIVIPTLLWADLTNRYVWTTLFVIVGYGLIGFTDDYKKVVEKNPKGLSPRQKMAGQLL
MRAY_GEOBB      GTPTMGGVLILVCIVLPTLLWADLKNVFIWLTLLIIVGYGVLGFVDDYKKVVEKNPKGLSPRQKMFWQML
MRAY_MESSB      GTPTMGGLMIFSGILGSSILWGNXXXXXXXXXXXXXXGFGAIGFYDDYLKVTKQSHLGFSGKSRLALEFV
MRAY_HAEDU      GTPTMGGIMILVSIGVSSLLWADLRNPYVWFTLFVLFGYGIVGFVDDYWKIARKNTDGLVARWKYFWLSF
MRAY_NOVAD      GTPTMGGLMIVTALTLSLLLWMDVTSRLVWACAVVTLGFGLIGFLDDYDKVTKYAHKGVPAKVRLAGEXX
MRAY_METC4      GTPTMGGLMILAGAVVSILLWTNPHNHYVWVTLAVTLGFGAIGFYDDYLKVTKQSHKGFSGRFRLLLE--
MRAY_GEOSM      GTPTMGGVLILVCIVVPTLLWADLKNVFIWLTLLIIVGYGVLGFVDDYKKVVEKNPKGLSPRQKMFWQVL
MRAY_BARQU      GTPTMGGLMILTGIVVSAFLWCNLSNIYFWVSLFVMLSFGMIGFYDDYLKVTKQTEKGFSGKARLSLEFL
MRAY_OCHA4      GTPTMGGLMIMTGILVSCLLWANXXXXXXXXXXXXXXGFGAIGFYDDYLKVTKQSDKGFSGKARLGIEFL
MRAY_METPB      GTPTMGGLMILAGAVVSILLWTNPRNHYVWVTLAVTLGFGAIGFYDDYLKVTKQSHKGFSGRFRLLLE--
MRAY_SILPO      GTPTMGGLLIVGALLTSTLLWARWDNPFVWMVLFVTLAYALIGFADDYAKVSKQNTKGVSGKMRXXXXXX
MRAY_PARUW      NTPTMGGXXXXXXXXXXXXXWMDLTHIFTLILFVTTVFLGLIGGRDDYLKLKYKNTKGMSARGKLFFQFV
MRAY_BARBK      GTPTMGGLMILSGVVISALLWGNLFNIYLWVSLFVMLFFGAIGFYDDYLKVTKQTDKGFSGKARLSLE--
MRAY_BEII9      GTPTMGGLMILSGLFVSTLLWANLSNHYVWVVLWVMLGYGAIGFYDDYLKVTKQTHNGFSGRGRLACEAG
MRAY_CAUCN      GTPTMGGFMILAGLFVAALLWADLRNVHVWVVLLITGSYGLLGFMDDYAKVTKQTTAGLSSVQKLVAQXX
MRAY_BRUSU      G