[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD31313.1

[Show Plain Result]


## Summary of Sequence Search
    1::366
   73::371     7e-16  25%  380 aa  CAPM_STAAU RecName: Full=Capsular polysaccharide biosynthesis
  139::290     8e-09  30%  351 aa  LPSB_RHIME RecName: Full=Lipopolysaccharide core biosynthesis
  189::369     2e-07  29%  391 aa  CAPJ_STAAU RecName: Full=Protein capJ;
  401::505     3e-07  27%  578 aa  VIPC_SALTI RecName: Full=Vi polysaccharide biosynthesis protein
  193::362     6e-07  22%  456 aa  GPI3_SCHPO RecName: Full=Phosphatidylinositol
  204::341     1e-06  24%  452 aa  GPI3_YEAST RecName: Full=Phosphatidylinositol
  204::341     1e-06  24%  452 aa  GPI3_YEAS7 RecName: Full=Phosphatidylinositol
  204::341     1e-06  24%  452 aa  GPI3_YEAS6 RecName: Full=Phosphatidylinositol
  204::341     1e-06  24%  452 aa  GPI3_YEAS1 RecName: Full=Phosphatidylinositol
   74::309     1e-05  25%  406 aa  Y1059_METJA RecName: Full=Uncharacterized glycosyltransferase
  194::320     3e-05  30%  353 aa  Y1698_HAEIN RecName: Full=Uncharacterized glycosyltransferase
  211::396     2e-04  29%  576 aa  YL086_MIMIV RecName: Full=Putative ankyrin repeat protein L86;
  285::370     3e-04  28%  377 aa  YPJH_BACSU RecName: Full=Uncharacterized glycosyltransferase ypjH; 
  157::310     3e-04  26%  381 aa  EPSD_BACSU RecName: Full=Putative glycosyltransferase epsD;        
    6::34      4e-04  52%  384 aa  EPSF_BACSU RecName: Full=Putative glycosyltransferase epsF;      
  239::355     5e-04  23%  358 aa  YC07_KLEPN RecName: Full=Uncharacterized 41.2 kDa protein in cps
  280::378     5e-04  21%  389 aa  TUAC_BACSU RecName: Full=Putative teichuronic acid biosynthesis
  696::810     5e-04  31%  834 aa  RPOC1_HELSJ RecName: Full=DNA-directed RNA polymerase subunit
    1::366

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xKRFVHLIINLNQGGAETMLYKLCKSMDKSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CAPM_STAAU      ----------------------------------------------------------------------
LPSB_RHIME      ----------------------------------------------------------------------
CAPJ_STAAU      ----------------------------------------------------------------------
VIPC_SALTI      ----------------------------------------------------------------------
GPI3_SCHPO      ----------------------------------------------------------------------
GPI3_YEAST      ----------------------------------------------------------------------
GPI3_YEAS7      ----------------------------------------------------------------------
GPI3_YEAS6      ----------------------------------------------------------------------
GPI3_YEAS1      ----------------------------------------------------------------------
Y1059_METJA     ----------------------------------------------------------------------
Y1698_HAEIN     ----------------------------------------------------------------------
YL086_MIMIV     ----------------------------------------------------------------------
YPJH_BACSU      ----------------------------------------------------------------------
EPSD_BACSU      ----------------------------------------------------------------------
EPSF_BACSU      -KRVLHVLSGMNRGGAETMVMNLYRKMDKS----------------------------------------
YC07_KLEPN      ----------------------------------------------------------------------
TUAC_BACSU      ----------------------------------------------------------------------
RPOC1_HELSJ     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKLNAKFSKFS
CAPM_STAAU      ---ILLFHKEKPFIVNSGTPKAGLIGTIAAFITQRPIRIYTVRLRLETVKGFKYFVLYLMEKIAMFCATD
LPSB_RHIME      ----------------------------------------------------------------------
CAPJ_STAAU      ----------------------------------------------------------------------
VIPC_SALTI      ----------------------------------------------------------------------
GPI3_SCHPO      ----------------------------------------------------------------------
GPI3_YEAST      ----------------------------------------------------------------------
GPI3_YEAS7      ----------------------------------------------------------------------
GPI3_YEAS6      ----------------------------------------------------------------------
GPI3_YEAS1      ----------------------------------------------------------------------
Y1059_METJA     ---LKIIREFKPDLVITHHDDANVVILLNKIFKNNTKFILWVRNNIESYK-EGLYSKIIILAYKYFYKYA
Y1698_HAEIN     ----------------------------------------------------------------------
YL086_MIMIV     ---IKLLLNYNVDLNSINLKRKTVLMYLCK-FYNKTNNVNSIKLLLKNIQNTKGNTAMMYLFNKFYHEYG
YPJH_BACSU      ----------------------------------------------------------------------
EPSD_BACSU      ----------------------------------------------------------------------
EPSF_BACSU      ----------------------------------------------------------------------
YC07_KLEPN      ----------------------------------------------------------------------
TUAC_BACSU      ----------------------------------------------------------------------
RPOC1_HELSJ     ---------------------------------------------------------------------N


                         +         .         .         .         .         *         .:210
query           DLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDDNVKIIGIIARNHADKNIS
CAPM_STAAU      IIAISESLKHKIITSNLAKENKITVL-GFGSS----NGIQFEKFQLDNNLNDNF-VIGYVGRIVKDKGIH
LPSB_RHIME      ------------------------ILHGIDTKRFQPPFDKTEAKKALG-LDPAKKFVGCFGRVRHQKGTD
CAPJ_STAAU      -----------------------------------------EKFNKNLDIGNKIKI-GLIGSTFVDHNVA
VIPC_SALTI      --------------------------------------------------------IGGVFRFVGDKNPF
GPI3_SCHPO      --------------------------------------------------------IVVISRLYYNKGID
GPI3_YEAST      -------------------------------------------------------VIVVIGRLFPNKGSD
GPI3_YEAS7      -------------------------------------------------------VIVVIGRLFPNKGSD
GPI3_YEAS6      -------------------------------------------------------VIVVIGRLFPNKGSD
GPI3_YEAS1      -------------------------------------------------------VIVVIGRLFPNKGSD
Y1059_METJA     DIIIQENKKIIESHFKSLKNKTKIVPNVYEIDKLQQLSNEPLEKQYRNIFKDSFVFINI-GRLTEQKGQW
Y1698_HAEIN     ------------------------------------------------------------------KGFD
YL086_MIMIV     DNKYNIIKLLLQYGANPNIKNNSGIS-----VLLRASTIQNGWERKN--------IIKFLLKHGADPNIT
YPJH_BACSU      ----------------------------------------------------------------------
EPSD_BACSU      --------------QRPGGRTQKIHGIGVNTERFRPSPIEQQRLREKHGFREDDFILVYPAELNLNKNQK
EPSF_BACSU      ----------------------------------------------------------------------
YC07_KLEPN      ----------------------------------------------------------------------
TUAC_BACSU      ----------------------------------------------------------------------
RPOC1_HELSJ     DLLLKTSRKSIKQAMNQGFINECHIPYWIKINT-KDIFFKFLAYPLRNELQLNIKGFSKIIRLNTFKVTN


                         .         .         .         +         .         .         .:280
query           RFLQIANLLLKSNPSLRFLIAGRECSKIDIGSYLDNKSNVNKFFVFESVDSSEYLPVLDLYLSTSKVEGF
CAPM_STAAU      ELIQSFKIIVSKGYNVKLLVIGETENSIDESDYLFLTQNPNVVLIKHVSDPISFYNNMNVFVFPTHREGF
LPSB_RHIME      LFVDSMIALLPCRPDWGAIVAGRATGP-HLAFESELKERVAKLFVGEHTNIPDWYRALDLFVAPQRWEGF
CAPJ_STAAU      -IKSISNLVNEGNIELEFVGDGPSKKFMEMAKKYNVENNVIKGKIYDKTALNNWFRNLDLYIQPSLTEGH
VIPC_SALTI      AWIDFAARYLQHHPATRFVLVGDGDLRAEAQKRAEQLGILERIFVGASRDVGYWLQKMNVFILFSRYEGL
GPI3_SCHPO      LLIAVIPRICAQHPKVRFVIAGDGPKSIDLEQMREKYMLQDRVEMLGSVRHDQVRDVMHIYLHPSLTEAF
GPI3_YEAST      LLTRIIPKVCSSHEDVEFIVAGDGPKFIDFQQMIESHRLQKRVQLLGSVPHEKVRDVLDIYLHASLTEAF
GPI3_YEAS7      LLTRIIPKVCSSHEDVEFIVAGDGPKFIDFQQMIESHRLQKRVQLLGSVPHEKVRDVLDIYLHASLTEAF
GPI3_YEAS6      LLTRIIPKVCSSHEDVEFIVAGDGPKFIDFQQMIESHRLQKRVQLLGSVPHEKVRDVLDIYLHASLTEAF
GPI3_YEAS1      LLTRIIPKVCSSHEDVEFIVAGDGPKFIDFQQMIESHRLQKRVQLLGSVPHEKVRDVLDIYLHASLTEAF
Y1059_METJA     FLIRSFKRVTEKYPNAKLIILGDGELKNKLQELI-NKLNLNVYLLGMQKNPFKFLKHSNCFVFSSLWEGL
Y1698_HAEIN     YLLKVWQVLAKKYPDWNLKIVGEEENLKNLAKALDIEDSVN--FIPRTNDVSFYYESSSIYCLPSQTEGL
YL086_MIMIV     NNQGLTFLLLVKNPQLNFVL-----KYVDPNIKCNKGKNILHYIPSESIDSPDIL---------------
YPJH_BACSU      ---------------------------------------------------------------------F
EPSD_BACSU      QLIEAAALLKEKIPSLRLVFAGEEHTYQTLAEKLGASAHV-CFYGFCS-DIHELIQLADVSVASSIREGL
EPSF_BACSU      ----------------------------------------------------------------------
YC07_KLEPN      ------------------------------------KENVVYYGWVDNKELPAYFCENDVLLMPSRWESF
TUAC_BACSU      ----------------------------------------------------DYLLAADLFVLPSYSEGM
RPOC1_HELSJ     LVFDSLDLLIKKNYISNWLILNNTKFKYLLISFLQNKN--------------------------------


                         .         *         .         .         .         .         +:350
query           PNILAEAMLCEVPIVASNVGDCKDILNGYGEVFELSQGNKEIIEKIMKVLETTVVMKKRMREYIINNFSI
CAPM_STAAU      GNVSIEAQALEVPVITTNVTGAIDTVVNGETGFIVEKGDKAIAEKIEKLINDESLREHNGRKRVENKFSS
LPSB_RHIME      GLTPLEAMATGVPVVATDVGAFSELVTGGSE---------------------------------------
CAPJ_STAAU      CRAIVEAIGNGVPTLASNAGGNSDSVNK-----EYLFKPKDVV-KLTKLINRSILSKQYREENVLENYNL
VIPC_SALTI      PNVLIEAQMVGVPVISTPAG--------------------------------------------------
GPI3_SCHPO      GTVLVEAASCGLYVISTKVGGVPEVLPSHMTRFARPE-EDDLADTLSSVITDYLIKTETFHEEVKQMYSW
GPI3_YEAST      GTILVEAASCNLLIVTTQVGGIPEVLPNEMTVYAEQTSVSDLVQATNKAI--------------------
GPI3_YEAS7      GTILVEAASCNLLIVTTQVGGIPEVLPNEMTVYAEQTSVSDLVQATNKAI--------------------
GPI3_YEAS6      GTILVEAASCNLLIVTTQVGGIPEVLPNEMTVYAEQTSVSDLVQATNKAI--------------------
GPI3_YEAS1      GTILVEAASCNLLIVTTQVGGIPEVLPNEMTVYAEQTSVSDLVQATNKAI--------------------
Y1059_METJA     PNTVIEALSLNLPVIST---DCK-----------------------------------------------
Y1698_HAEIN     PLVVIEAMAFGLPIVAFNCSGVKQLVEHKENGFLCEQNN---IEEMVKGLDLLI----------------
YL086_MIMIV     ----------------------------------------------------------------------
YPJH_BACSU      GLVLLEAMACGVPCIGTNIGGIPEVIKNNVSGFLVDVGDTAATARAMSILEDEQLFTKAAIEMLENEFSS
EPSD_BACSU      GMNVLEGMAAEQPAIATDNRGHREII--------------------------------------------
EPSF_BACSU      ----------------------------------------------------------------------
YC07_KLEPN      GLVAVEAQLYGVPVIANNVASLPEVISDTGMLVNFEDANKVVEIMDSHTIHFWNEKKEACREFASNKFRK
TUAC_BACSU      PTVVIEALALRVPVICTDVGGVSSLFGKHQHLLIKPKSAQALAEAITR-YEHEQIWKPEVADDLYETVQA
RPOC1_HELSJ     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           EAILEKHEKLYHxxxx
CAPM_STAAU      QIIWEELESMYN----
LPSB_RHIME      ----------------
CAPJ_STAAU      ENIQIEREK-------
VIPC_SALTI      ----------------
GPI3_SCHPO      IDVAERTEKVY-----
GPI3_YEAST      ----------------
GPI3_YEAS7      ----------------
GPI3_YEAS6      ----------------
GPI3_YEAS1      ----------------
Y1059_METJA     ----------------
Y1698_HAEIN     ----------------
YL086_MIMIV     ----------------
YPJH_BACSU      KKIVSQYEQIY-----
EPSD_BACSU      ----------------
EPSF_BACSU      ----------------
YC07_KLEPN      SDMVNSYVQIY-----
TUAC_BACSU      QFDAGKNAKALH----
RPOC1_HELSJ     ----------------