[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD31359.1

[Show Plain Result]


## Summary of Sequence Search
    1::249
    1::249     e-131 100%  249 aa  PYRH_FRATW RecName: Full=Uridylate kinase;         Short=UK;       
    1::249     e-131 100%  249 aa  PYRH_FRATT RecName: Full=Uridylate kinase;         Short=UK;       
    1::249     e-131 100%  249 aa  PYRH_FRATN RecName: Full=Uridylate kinase;         Short=UK;       
    1::249     e-131 100%  249 aa  PYRH_FRAT1 RecName: Full=Uridylate kinase;         Short=UK;       
    1::249     e-130 100%  249 aa  PYRH_FRATO RecName: Full=Uridylate kinase;         Short=UK;       
    1::249     e-130 100%  249 aa  PYRH_FRATH RecName: Full=Uridylate kinase;         Short=UK;       
    1::249     e-130 100%  249 aa  PYRH_FRATF RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     2e-52  47%  238 aa  PYRH_HERAR RecName: Full=Uridylate kinase;         Short=UK;       
   14::235     2e-52  50%  236 aa  PYRH_CLOAB RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     5e-52  47%  238 aa  PYRH_JANMA RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     5e-52  47%  242 aa  PYRH_ALHEH RecName: Full=Uridylate kinase;         Short=UK;       
   15::228     9e-52  47%  240 aa  PYRH_MAGSA RecName: Full=Uridylate kinase;         Short=UK;       
   13::235     1e-51  47%  237 aa  PYRH_BURS3 RecName: Full=Uridylate kinase;         Short=UK;       
   12::234     2e-51  47%  236 aa  PYRH_RALEJ RecName: Full=Uridylate kinase;         Short=UK;       
   12::234     2e-51  47%  236 aa  PYRH_METPP RecName: Full=Uridylate kinase;         Short=UK;       
   12::234     3e-51  46%  236 aa  PYRH_RALSO RecName: Full=Uridylate kinase;         Short=UK;       
   13::235     3e-51  47%  237 aa  PYRH_BURCH RecName: Full=Uridylate kinase;         Short=UK;       
   13::235     3e-51  47%  237 aa  PYRH_BURCA RecName: Full=Uridylate kinase;         Short=UK;       
   12::234     6e-51  46%  236 aa  PYRH_RALEH RecName: Full=Uridylate kinase;         Short=UK;       
   11::234     8e-51  46%  237 aa  PYRH_PROM3 RecName: Full=Uridylate kinase;         Short=UK;       
   12::234     1e-50  46%  236 aa  PYRH_RALME RecName: Full=Uridylate kinase;         Short=UK;       
   13::236     1e-50  47%  246 aa  PYRH_LEPBL RecName: Full=Uridylate kinase;         Short=UK;       
   13::236     1e-50  47%  246 aa  PYRH_LEPBJ RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     1e-50  48%  238 aa  PYRH_BORPE RecName: Full=Uridylate kinase;         Short=UK;       
   12::234     2e-50  47%  236 aa  PYRH_POLNA RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     2e-50  46%  237 aa  PYRH_HAEIN RecName: Full=Uridylate kinase;         Short=UK;       
   16::238     2e-50  46%  240 aa  PYRH_ACISJ RecName: Full=Uridylate kinase;         Short=UK;       
   16::238     2e-50  46%  240 aa  PYRH_ACIAC RecName: Full=Uridylate kinase;         Short=UK;       
   14::237     2e-50  47%  237 aa  PYRH_MANSM RecName: Full=Uridylate kinase;         Short=UK;       
   11::234     3e-50  46%  237 aa  PYRH_PROMM RecName: Full=Uridylate kinase;         Short=UK;       
   13::235     3e-50  46%  237 aa  PYRH_BURVG RecName: Full=Uridylate kinase;         Short=UK;       
   13::235     4e-50  46%  237 aa  PYRH_BURCM RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     4e-50  47%  238 aa  PYRH_BORBR RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     7e-50  46%  240 aa  PYRH_XANCP RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     7e-50  46%  240 aa  PYRH_XANC8 RecName: Full=Uridylate kinase;         Short=UK;       
   13::235     7e-50  45%  237 aa  PYRH_BURTA RecName: Full=Uridylate kinase;         Short=UK;       
   13::235     7e-50  45%  237 aa  PYRH_BURPS RecName: Full=Uridylate kinase;         Short=UK;       
   13::235     7e-50  45%  237 aa  PYRH_BURP6 RecName: Full=Uridylate kinase;         Short=UK;       
   13::235     7e-50  45%  237 aa  PYRH_BURP1 RecName: Full=Uridylate kinase;         Short=UK;       
   13::235     7e-50  45%  237 aa  PYRH_BURP0 RecName: Full=Uridylate kinase;         Short=UK;       
   13::235     7e-50  45%  237 aa  PYRH_BURMS RecName: Full=Uridylate kinase;         Short=UK;       
   13::235     7e-50  45%  237 aa  PYRH_BURMA RecName: Full=Uridylate kinase;         Short=UK;       
   13::235     7e-50  45%  237 aa  PYRH_BURM9 RecName: Full=Uridylate kinase;         Short=UK;       
   13::235     7e-50  45%  237 aa  PYRH_BURM7 RecName: Full=Uridylate kinase;         Short=UK;       
   11::234     9e-50  45%  235 aa  PYRH_SYNS3 RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     9e-50  47%  239 aa  PYRH_GEOMG RecName: Full=Uridylate kinase;         Short=UK;       
   14::234     9e-50  47%  235 aa  PYRH_CLOTH RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     9e-50  47%  238 aa  PYRH_BORPA RecName: Full=Uridylate kinase;         Short=UK;       
   16::238     1e-49  46%  240 aa  PYRH_RHOFD RecName: Full=Uridylate kinase;         Short=UK;       
   13::235     1e-49  45%  237 aa  PYRH_BURXL RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     1e-49  45%  240 aa  PYRH_XANOR RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     1e-49  45%  240 aa  PYRH_XANOM RecName: Full=Uridylate kinase;         Short=UK;       
   11::234     1e-49  43%  237 aa  PYRH_PROMT RecName: Full=Uridylate kinase;         Short=UK;       
   11::234     1e-49  43%  237 aa  PYRH_PROM1 RecName: Full=Uridylate kinase;         Short=UK;       
   14::239     1e-49  44%  239 aa  PYRH_FUSNN RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     1e-49  45%  247 aa  PYRH_COLP3 RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     1e-49  47%  238 aa  PYRH_BORA1 RecName: Full=Uridylate kinase;         Short=UK;       
   11::234     2e-49  46%  235 aa  PYRH_SYNPW RecName: Full=Uridylate kinase;         Short=UK;       
   15::238     2e-49  47%  248 aa  PYRH_LEPIN RecName: Full=Uridylate kinase;         Short=UK;       
   15::238     2e-49  47%  248 aa  PYRH_LEPIC RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     2e-49  47%  239 aa  PYRH_GEOSL RecName: Full=Uridylate kinase;         Short=UK;       
   13::235     2e-49  46%  242 aa  PYRH_ANAVT RecName: Full=Uridylate kinase;         Short=UK;       
   12::234     3e-49  47%  236 aa  PYRH_POLSJ RecName: Full=Uridylate kinase;         Short=UK;       
   20::226     3e-49  46%  244 aa  PYRH_PARDP RecName: Full=Uridylate kinase;         Short=UK;       
   12::234     3e-49  47%  246 aa  PYRH_HALHL RecName: Full=Uridylate kinase;         Short=UK;       
   13::235     3e-49  46%  242 aa  PYRH_ANASP RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     6e-49  45%  240 aa  PYRH_XANC5 RecName: Full=Uridylate kinase;         Short=UK;       
   11::234     6e-49  46%  237 aa  PYRH_SYNR3 RecName: Full=Uridylate kinase;         Short=UK;       
   18::240     7e-49  45%  247 aa  PYRH_XYLFT RecName: Full=Uridylate kinase;         Short=UK;       
   11::232     7e-49  47%  233 aa  PYRH_THET8 RecName: Full=Uridylate kinase;         Short=UK;       
   11::232     7e-49  47%  233 aa  PYRH_THET2 RecName: Full=Uridylate kinase;         Short=UK;       
   11::234     7e-49  44%  237 aa  PYRH_PROMA RecName: Full=Uridylate kinase;         Short=UK;       
   18::240     9e-49  45%  247 aa  PYRH_XYLFA RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     9e-49  45%  240 aa  PYRH_XANAC RecName: Full=Uridylate kinase;         Short=UK;       
   31::253     9e-49  45%  260 aa  PYRH_SYNY3 RecName: Full=Uridylate kinase;         Short=UK;       
   21::237     9e-49  46%  250 aa  PYRH_RHORT RecName: Full=Uridylate kinase;         Short=UK;       
   19::233     2e-48  42%  244 aa  PYRH_EHRCR RecName: Full=Uridylate kinase;         Short=UK;       
   11::231     3e-48  45%  237 aa  PYRH_SYNS9 RecName: Full=Uridylate kinase;         Short=UK;       
   18::224     3e-48  45%  242 aa  PYRH_ROSDO RecName: Full=Uridylate kinase;         Short=UK;       
   11::234     4e-48  43%  234 aa  PYRH_PROMP RecName: Full=Uridylate kinase;         Short=UK;       
   11::234     5e-48  42%  234 aa  PYRH_PROM5 RecName: Full=Uridylate kinase;         Short=UK;       
   13::235     6e-48  44%  244 aa  PYRH_TRIEI RecName: Full=Uridylate kinase;         Short=UK;       
   22::228     6e-48  46%  246 aa  PYRH_RHOS4 RecName: Full=Uridylate kinase;         Short=UK;       
   14::234     6e-48  45%  239 aa  PYRH_METCA RecName: Full=Uridylate kinase;         Short=UK;       
   25::231     6e-48  46%  249 aa  PYRH_JANSC RecName: Full=Uridylate kinase;         Short=UK;       
   17::223     8e-48  46%  241 aa  PYRH_PARZE RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     8e-48  45%  242 aa  PYRH_DESRM RecName: Full=Uridylate kinase;         Short=UK;       
   22::228     1e-47  45%  246 aa  PYRH_RHOS1 RecName: Full=Uridylate kinase;         Short=UK;       
   22::228     2e-47  45%  246 aa  PYRH_RHOS5 RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     2e-47  45%  239 aa  PYRH_PELPD RecName: Full=Uridylate kinase;         Short=UK;       
   16::238     3e-47  44%  240 aa  PYRH_VEREI RecName: Full=Uridylate kinase;         Short=UK;       
   11::234     3e-47  45%  235 aa  PYRH_GLOVI RecName: Full=Uridylate kinase;         Short=UK;       
   14::238     3e-47  46%  241 aa  PYRH_DEHE1 RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     3e-47  42%  243 aa  PYRH_COXBU RecName: Full=Uridylate kinase;         Short=UK;       
   11::231     4e-47  45%  237 aa  PYRH_SYNPX RecName: Full=Uridylate kinase;         Short=UK;       
   14::223     4e-47  47%  241 aa  PYRH_MAGSM RecName: Full=Uridylate kinase;         Short=UK;       
   21::243     4e-47  46%  251 aa  PYRH_ANADE RecName: Full=Uridylate kinase;         Short=UK;       
   11::235     5e-47  42%  235 aa  PYRH_CYTH3 RecName: Full=Uridylate kinase;         Short=UK;       
   17::241     5e-47  40%  242 aa  PYRH_ACIAD RecName: Full=Uridylate kinase;         Short=UK;       
   14::237     7e-47  45%  242 aa  PYRH_CARHZ RecName: Full=Uridylate kinase;         Short=UK;       
   11::231     9e-47  44%  237 aa  PYRH_SYNSC RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     9e-47  43%  238 aa  PYRH_NITMU RecName: Full=Uridylate kinase;         Short=UK;       
   13::237     9e-47  44%  237 aa  PYRH_NITEC RecName: Full=Uridylate kinase;         Short=UK;       
   31::240     9e-47  45%  263 aa  PYRH_MARMM RecName: Full=Uridylate kinase;         Short=UK;       
   14::235     9e-47  45%  236 aa  PYRH_CLONN RecName: Full=Uridylate kinase;         Short=UK;       
   11::234     1e-46  42%  234 aa  PYRH_PROMS RecName: Full=Uridylate kinase;         Short=UK;       
   19::242     1e-46  46%  250 aa  PYRH_MYXXD RecName: Full=Uridylate kinase;         Short=UK;       
   14::235     1e-46  45%  238 aa  PYRH_CLOBL RecName: Full=Uridylate kinase;         Short=UK;       
   14::235     1e-46  45%  238 aa  PYRH_CLOBH RecName: Full=Uridylate kinase;         Short=UK;       
   14::235     1e-46  45%  238 aa  PYRH_CLOB1 RecName: Full=Uridylate kinase;         Short=UK;       
   12::234     1e-46  42%  236 aa  PYRH_CHLPD RecName: Full=Uridylate kinase;         Short=UK;       
   14::235     2e-46  45%  237 aa  PYRH_CLOPS RecName: Full=Uridylate kinase;         Short=UK;       
   19::233     2e-46  41%  244 aa  PYRH_EHRCJ RecName: Full=Uridylate kinase;         Short=UK;       
   14::238     2e-46  45%  241 aa  PYRH_DEHSC RecName: Full=Uridylate kinase;         Short=UK;       
   14::235     2e-46  45%  237 aa  PYRH_CLOPE RecName: Full=Uridylate kinase;         Short=UK;       
   14::235     2e-46  45%  237 aa  PYRH_CLOP1 RecName: Full=Uridylate kinase;         Short=UK;       
   24::248     3e-46  45%  259 aa  PYRH_RHOBA RecName: Full=Uridylate kinase;         Short=UK;       
   11::234     3e-46  42%  234 aa  PYRH_PROM9 RecName: Full=Uridylate kinase;         Short=UK;       
   11::235     3e-46  42%  235 aa  PYRH_GRAFK RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     3e-46  41%  240 aa  PYRH_BUCAP RecName: Full=Uridylate kinase;         Short=UK;       
   14::237     3e-46  43%  237 aa  PYRH_ACTP2 RecName: Full=Uridylate kinase;         Short=UK;       
   11::234     3e-46  42%  234 aa  PYRH_PROM2 RecName: Full=Uridylate kinase;         Short=UK;       
   11::234     3e-46  42%  234 aa  PYRH_PROM0 RecName: Full=Uridylate kinase;         Short=UK;       
   13::235     4e-46  42%  236 aa  PYRH_THICR RecName: Full=Uridylate kinase;         Short=UK;       
   15::224     4e-46  47%  239 aa  PYRH_BARBK RecName: Full=Uridylate kinase;         Short=UK;       
   15::228     6e-46  43%  241 aa  PYRH_PARL1 RecName: Full=Uridylate kinase;         Short=UK;       
   12::215     6e-46  45%  239 aa  PYRH_CHLTE RecName: Full=Uridylate kinase;         Short=UK;       
   18::241     7e-46  45%  245 aa  PYRH_DEIRA RecName: Full=Uridylate kinase;         Short=UK;       
   21::243     7e-46  45%  249 aa  PYRH_ANADF RecName: Full=Uridylate kinase;         Short=UK;       
   17::241     7e-46  40%  242 aa  PYRH_ACIBT RecName: Full=Uridylate kinase;         Short=UK;       
   15::238     2e-45  43%  239 aa  PYRH_RICB8 RecName: Full=Uridylate kinase;         Short=UK;       
   14::237     2e-45  45%  241 aa  PYRH_LACSS RecName: Full=Uridylate kinase;         Short=UK;       
   12::235     2e-45  45%  239 aa  PYRH_LACC3 RecName: Full=Uridylate kinase;         Short=UK;       
   18::221     2e-45  46%  246 aa  PYRH_CAUCR RecName: Full=Uridylate kinase;         Short=UK;       
   14::234     2e-45  44%  236 aa  PYRH_ALKOO RecName: Full=Uridylate kinase;         Short=UK;       
   13::235     3e-45  44%  237 aa  PYRH_NITEU RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     3e-45  42%  241 aa  PYRH_DESPS RecName: Full=Uridylate kinase;         Short=UK;       
   15::238     3e-45  45%  257 aa  PYRH_DEIGD RecName: Full=Uridylate kinase;         Short=UK;       
   11::233     5e-45  45%  240 aa  PYRH_SYNP6 RecName: Full=Uridylate kinase;         Short=UK;       
   11::233     5e-45  45%  240 aa  PYRH_SYNE7 RecName: Full=Uridylate kinase;         Short=UK;       
   18::241     5e-45  42%  242 aa  PYRH_RICM5 RecName: Full=Uridylate kinase;         Short=UK;       
   15::238     6e-45  42%  239 aa  PYRH_RICBR RecName: Full=Uridylate kinase;         Short=UK;       
   21::242     8e-45  42%  244 aa  PYRH_ANAPZ RecName: Full=Uridylate kinase;         Short=UK;       
   11::233     1e-44  41%  235 aa  PYRH_PELLD RecName: Full=Uridylate kinase;         Short=UK;       
   11::235     1e-44  40%  235 aa  PYRH_FLAPJ RecName: Full=Uridylate kinase;         Short=UK;       
   15::220     2e-44  45%  242 aa  PYRH_ZYMMO RecName: Full=Uridylate kinase;         Short=UK;       
   12::234     2e-44  41%  239 aa  PYRH_CHLCH RecName: Full=Uridylate kinase;         Short=UK;       
   10::233     2e-44  44%  236 aa  PYRH_BACSK RecName: Full=Uridylate kinase;         Short=UK;       
   16::238     2e-44  42%  245 aa  PYRH_SYNFM RecName: Full=Uridylate kinase;         Short=UK;       
   14::237     2e-44  44%  240 aa  PYRH_GEOTN RecName: Full=Uridylate kinase;         Short=UK;       
   13::239     2e-44  41%  240 aa  PYRH_CHLFF RecName: Full=Uridylate kinase;         Short=UK;       
   15::224     2e-44  47%  239 aa  PYRH_BARQU RecName: Full=Uridylate kinase;         Short=UK;       
   16::239     3e-44  39%  241 aa  PYRH_PSYWF RecName: Full=Uridylate kinase;         Short=UK;       
   17::237     3e-44  45%  247 aa  PYRH_PSEA6 RecName: Full=Uridylate kinase;         Short=UK;       
   14::237     3e-44  43%  240 aa  PYRH_LACPL RecName: Full=Uridylate kinase;         Short=UK;       
   13::239     3e-44  41%  240 aa  PYRH_CHLCV RecName: Full=Uridylate kinase;         Short=UK;       
   14::240     4e-44  43%  240 aa  PYRH_LACRD RecName: Full=Uridylate kinase;         Short=UK;       
   14::237     4e-44  45%  240 aa  PYRH_ENTFA RecName: Full=Uridylate kinase;         Short=UK;       
   18::241     5e-44  42%  242 aa  PYRH_RICFE RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     5e-44  43%  238 aa  PYRH_AZOSB RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     7e-44  42%  245 aa  PYRH_SHEB8 RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     7e-44  42%  245 aa  PYRH_SHEB5 RecName: Full=Uridylate kinase;         Short=UK;       
   26::230     9e-44  45%  251 aa  PYRH_SILPO RecName: Full=Uridylate kinase;         Short=UK;       
   16::239     9e-44  40%  241 aa  PYRH_PSYCK RecName: Full=Uridylate kinase;         Short=UK;       
   16::239     9e-44  40%  241 aa  PYRH_PSYA2 RecName: Full=Uridylate kinase;         Short=UK;       
   14::235     9e-44  41%  238 aa  PYRH_LAWIP RecName: Full=Uridylate kinase;         Short=UK;       
   24::231     1e-43  43%  249 aa  PYRH_SILST RecName: Full=Uridylate kinase;         Short=UK;       
   14::227     1e-43  46%  238 aa  PYRH_RHOP5 RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     1e-43  43%  238 aa  PYRH_METFK RecName: Full=Uridylate kinase;         Short=UK;       
   14::237     1e-43  42%  237 aa  PYRH_HAEDU RecName: Full=Uridylate kinase;         Short=UK;       
   14::223     2e-43  43%  241 aa  PYRH_SPHAL RecName: Full=Uridylate kinase;         Short=UK;       
   20::228     2e-43  43%  246 aa  PYRH_GRABC RecName: Full=Uridylate kinase;         Short=UK;       
   25::247     2e-43  42%  252 aa  PYRH_THEFY RecName: Full=Uridylate kinase;         Short=UK;       
   21::226     3e-43  43%  246 aa  PYRH_WOLTR RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     3e-43  42%  243 aa  PYRH_VIBF1 RecName: Full=Uridylate kinase;         Short=UK;       
   18::241     3e-43  42%  242 aa  PYRH_RICCN RecName: Full=Uridylate kinase;         Short=UK;       
   14::237     3e-43  43%  240 aa  PYRH_LACBA RecName: Full=Uridylate kinase;         Short=UK;       
   17::241     3e-43  39%  242 aa  PYRH_BUCAI RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     3e-43  42%  245 aa  PYRH_SHESW RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     3e-43  42%  242 aa  PYRH_SHEON RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     3e-43  41%  238 aa  PYRH_NITWN RecName: Full=Uridylate kinase;         Short=UK;       
   14::223     3e-43  43%  238 aa  PYRH_ERYLH RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     5e-43  42%  241 aa  PYRH_SODGM RecName: Full=Uridylate kinase;         Short=UK;       
   14::237     5e-43  41%  238 aa  PYRH_LACLS RecName: Full=Uridylate kinase;         Short=UK;       
   14::237     5e-43  41%  238 aa  PYRH_LACLM RecName: Full=Uridylate kinase;         Short=UK;       
   14::237     5e-43  41%  238 aa  PYRH_LACLA RecName: Full=Uridylate kinase;         Short=UK;       
   10::230     5e-43  40%  234 aa  PYRH_FERNB RecName: Full=Uridylate kinase;         Short=UK;       
   13::236     5e-43  40%  246 aa  PYRH_CHLAB RecName: Full=Uridylate kinase;         Short=UK;       
   14::235     6e-43  44%  237 aa  PYRH_SPHWW RecName: Full=Uridylate kinase;         Short=UK;       
   18::223     6e-43  44%  244 aa  PYRH_NOVAD RecName: Full=Uridylate kinase;         Short=UK;       
   21::224     8e-43  44%  247 aa  PYRH_WOLPM RecName: Full=Uridylate kinase;         Short=UK;       
   13::235     8e-43  41%  242 aa  PYRH_THEEB RecName: Full=Uridylate kinase;         Short=UK;       
   20::243     8e-43  42%  244 aa  PYRH_RICTY RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     8e-43  40%  238 aa  PYRH_NITHX RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     8e-43  43%  237 aa  PYRH_HAEIG RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     8e-43  43%  237 aa  PYRH_HAEI8 RecName: Full=Uridylate kinase;         Short=UK;       
   12::226     8e-43  41%  238 aa  PYRH_CAMC5 RecName: Full=Uridylate kinase;         Short=UK;       
   12::235     1e-42  43%  237 aa  PYRH_VESOH RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     1e-42  42%  242 aa  PYRH_SHESR RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     1e-42  42%  242 aa  PYRH_SHESM RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     1e-42  41%  245 aa  PYRH_SHEPC RecName: Full=Uridylate kinase;         Short=UK;       
   21::244     1e-42  41%  251 aa  PYRH_HYPNA RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     1e-42  42%  242 aa  PYRH_SHESA RecName: Full=Uridylate kinase;         Short=UK;       
   15::237     1e-42  44%  239 aa  PYRH_CHRVO RecName: Full=Uridylate kinase;         Short=UK;       
   10::230     2e-42  40%  233 aa  PYRH_THEM4 RecName: Full=Uridylate kinase;         Short=UK;       
   18::240     2e-42  41%  242 aa  PYRH_RICPR RecName: Full=Uridylate kinase;         Short=UK;       
   19::241     2e-42  43%  247 aa  PYRH_LEGPA RecName: Full=Uridylate kinase;         Short=UK;       
   14::240     2e-42  42%  240 aa  PYRH_LACRE RecName: Full=Uridylate kinase;         Short=UK;       
   14::240     2e-42  42%  241 aa  PYRH_LACJO RecName: Full=Uridylate kinase;         Short=UK;       
   14::240     2e-42  42%  241 aa  PYRH_LACGA RecName: Full=Uridylate kinase;         Short=UK;       
   19::241     2e-42  43%  247 aa  PYRH_LEGPH RecName: Full=Uridylate kinase;         Short=UK;       
   18::240     2e-42  43%  246 aa  PYRH_LEGPC RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     2e-42  43%  241 aa  PYRH_KLEP7 RecName: Full=Uridylate kinase;         Short=UK;       
   14::237     2e-42  42%  240 aa  PYRH_BACA2 RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     3e-42  43%  241 aa  PYRH_SALTY RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     3e-42  43%  241 aa  PYRH_SALTI RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     3e-42  43%  241 aa  PYRH_SALPA RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     3e-42  43%  241 aa  PYRH_SALCH RecName: Full=Uridylate kinase;         Short=UK;       
   18::239     3e-42  41%  242 aa  PYRH_RICCK RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     3e-42  43%  249 aa  PYRH_PSYIN RecName: Full=Uridylate kinase;         Short=UK;       
   14::238     3e-42  42%  241 aa  PYRH_LEUMM RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     3e-42  42%  237 aa  PYRH_HAEIE RecName: Full=Uridylate kinase;         Short=UK;       
   14::234     3e-42  42%  237 aa  PYRH_CLOTE RecName: Full=Uridylate kinase;         Short=UK;       
   13::239     3e-42  40%  248 aa  PYRH_CHLPN RecName: Full=Uridylate kinase;         Short=UK;       
   26::248     3e-42  40%  252 aa  PYRH_ALCBS RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     4e-42  42%  248 aa  PYRH_YERE8 RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     4e-42  43%  238 aa  PYRH_SYNWW RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     4e-42  41%  245 aa  PYRH_SHEFN RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     4e-42  42%  241 aa  PYRH_SERP5 RecName: Full=Uridylate kinase;         Short=UK;       
   14::237     4e-42  44%  239 aa  PYRH_RUTMC RecName: Full=Uridylate kinase;         Short=UK;       
   11::234     5e-42  38%  254 aa  PYRH_SYNJA RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     5e-42  43%  240 aa  PYRH_PHOPR RecName: Full=Uridylate kinase;         Short=UK;       
   14::237     5e-42  42%  240 aa  PYRH_OCEIH RecName: Full=Uridylate kinase;         Short=UK;       
   14::235     5e-42  40%  238 aa  PYRH_DESDG RecName: Full=Uridylate kinase;         Short=UK;       
   22::234     7e-42  40%  245 aa  PYRH_ANAMM RecName: Full=Uridylate kinase;         Short=UK;       
   14::237     7e-42  42%  237 aa  PYRH_ACTSZ RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     9e-42  43%  241 aa  PYRH_SHISS RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     9e-42  43%  241 aa  PYRH_SHIFL RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     9e-42  43%  241 aa  PYRH_SHIF8 RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     9e-42  43%  241 aa  PYRH_SHIBS RecName: Full=Uridylate kinase;         Short=UK;       
   19::241     9e-42  43%  247 aa  PYRH_LEGPL RecName: Full=Uridylate kinase;         Short=UK;       
   19::241     9e-42  39%  244 aa  PYRH_HAHCH RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     9e-42  41%  238 aa  PYRH_HAES1 RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     9e-42  43%  241 aa  PYRH_ENTS8 RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     9e-42  43%  241 aa  PYRH_ECOUT RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     9e-42  43%  241 aa  PYRH_ECOLI RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     9e-42  43%  241 aa  PYRH_ECOL6 RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     9e-42  43%  241 aa  PYRH_ECOL5 RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     9e-42  43%  241 aa  PYRH_ECOK1 RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     9e-42  43%  241 aa  PYRH_ECOHS RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     9e-42  43%  241 aa  PYRH_ECO57 RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     9e-42  43%  241 aa  PYRH_ECO24 RecName: Full=Uridylate kinase;         Short=UK;       
   17::237     1e-41  42%  241 aa  PYRH_SHEAM RecName: Full=Uridylate kinase;         Short=UK;       
   16::233     1e-41  43%  243 aa  PYRH_MYCPU RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     1e-41  41%  238 aa  PYRH_DECAR RecName: Full=Uridylate kinase;         Short=UK;       
   14::237     1e-41  42%  240 aa  PYRH_BACLD RecName: Full=Uridylate kinase;         Short=UK;       
   15::238     1e-41  43%  240 aa  PYRH_AQUAE RecName: Full=Uridylate kinase;         Short=UK;       
   14::234     1e-41  44%  237 aa  PYRH_THETN RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     1e-41  42%  241 aa  PYRH_SHIDS RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     1e-41  41%  243 aa  PYRH_SHEDO RecName: Full=Uridylate kinase;         Short=UK;       
   10::227     1e-41  40%  242 aa  PYRH_NITSB RecName: Full=Uridylate kinase;         Short=UK;       
   19::233     1e-41  39%  244 aa  PYRH_EHRRW RecName: Full=Uridylate kinase;         Short=UK;       
   19::233     1e-41  39%  244 aa  PYRH_EHRRG RecName: Full=Uridylate kinase;         Short=UK;       
   20::233     1e-41  42%  246 aa  PYRH_ACICJ RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     2e-41  42%  241 aa  PYRH_YERPS RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     2e-41  42%  241 aa  PYRH_YERPP RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     2e-41  42%  241 aa  PYRH_YERPN RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     2e-41  42%  241 aa  PYRH_YERPE RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     2e-41  42%  241 aa  PYRH_YERPA RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     2e-41  42%  241 aa  PYRH_YERP3 RecName: Full=Uridylate kinase;         Short=UK;       
   11::234     2e-41  38%  253 aa  PYRH_SYNJB RecName: Full=Uridylate kinase;         Short=UK;       
   14::238     2e-41  40%  241 aa  PYRH_STRSV RecName: Full=Uridylate kinase;         Short=UK;       
   14::237     2e-41  41%  241 aa  PYRH_PEDPA RecName: Full=Uridylate kinase;         Short=UK;       
   14::217     2e-41  42%  238 aa  PYRH_DESVV RecName: Full=Uridylate kinase;         Short=UK;       
   14::217     2e-41  42%  238 aa  PYRH_DESVH RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     2e-41  42%  241 aa  PYRH_CITK8 RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     2e-41  41%  237 aa  PYRH_BDEBA RecName: Full=Uridylate kinase;         Short=UK;       
   14::223     2e-41  40%  238 aa  PYRH_RHOPA RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     2e-41  41%  249 aa  PYRH_PSEHT RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     2e-41  41%  238 aa  PYRH_AZOSE RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     3e-41  42%  242 aa  PYRH_PHOLL RecName: Full=Uridylate kinase;         Short=UK;       
   14::240     3e-41  42%  241 aa  PYRH_LACAC RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     3e-41  39%  241 aa  PYRH_DICNV RecName: Full=Uridylate kinase;         Short=UK;       
   14::237     3e-41  43%  240 aa  PYRH_BACCR RecName: Full=Uridylate kinase;         Short=UK;       
   14::237     3e-41  43%  240 aa  PYRH_BACAN RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     4e-41  41%  247 aa  PYRH_SHELP RecName: Full=Uridylate kinase;         Short=UK;       
   11::223     4e-41  41%  236 aa  PYRH_HELHP RecName: Full=Uridylate kinase;         Short=UK;       
   14::238     6e-41  40%  245 aa  PYRH_STRMU RecName: Full=Uridylate kinase;         Short=UK;       
   28::250     6e-41  39%  253 aa  PYRH_CHRSD RecName: Full=Uridylate kinase;         Short=UK;       
   14::226     7e-41  40%  238 aa  PYRH_AZOC5 RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     7e-41  41%  244 aa  PYRH_AERS4 RecName: Full=Uridylate kinase;         Short=UK;       
   14::238     9e-41  39%  245 aa  PYRH_STRTD RecName: Full=Uridylate kinase;         Short=UK;       
   14::238     9e-41  39%  245 aa  PYRH_STRT1 RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     9e-41  41%  240 aa  PYRH_MOOTA RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     9e-41  41%  241 aa  PYRH_ERWCT RecName: Full=Uridylate kinase;         Short=UK;       
    9::231     1e-40  42%  233 aa  PYRH_NEOSM RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     2e-40  42%  243 aa  PYRH_VIBCH RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     2e-40  42%  243 aa  PYRH_VIBC3 RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     2e-40  41%  241 aa  PYRH_ENT38 RecName: Full=Uridylate kinase;         Short=UK;       
   13::227     2e-40  40%  241 aa  PYRH_WOLSU RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     2e-40  42%  241 aa  PYRH_VIBVY RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     2e-40  42%  241 aa  PYRH_VIBVU RecName: Full=Uridylate kinase;         Short=UK;       
   17::242     2e-40  41%  243 aa  PYRH_VIBHB RecName: Full=Uridylate kinase;         Short=UK;       
   23::238     2e-40  41%  247 aa  PYRH_RICRS RecName: Full=Uridylate kinase;         Short=UK;       
   20::245     2e-40  39%  247 aa  PYRH_PSEMY RecName: Full=Uridylate kinase;         Short=UK;       
   14::238     3e-40  39%  245 aa  PYRH_STRT2 RecName: Full=Uridylate kinase;         Short=UK;       
    1::246     3e-40  38%  253 aa  PYRH_STRCO RecName: Full=Uridylate kinase;         Short=UK;       
   18::241     3e-40  41%  243 aa  PYRH_NITOC RecName: Full=Uridylate kinase;         Short=UK;       
   16::238     4e-40  41%  241 aa  PYRH_PELCD RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     4e-40  41%  242 aa  PYRH_PASMU RecName: Full=Uridylate kinase;         Short=UK;       
   12::216     4e-40  41%  237 aa  PYRH_CAMHC RecName: Full=Uridylate kinase;         Short=UK;       
   17::242     5e-40  41%  243 aa  PYRH_VIBPA RecName: Full=Uridylate kinase;         Short=UK;       
   15::229     6e-40  39%  240 aa  PYRH_HELPY RecName: Full=Uridylate kinase;         Short=UK;       
   15::229     6e-40  39%  240 aa  PYRH_HELPH RecName: Full=Uridylate kinase;         Short=UK;       
   14::235     6e-40  41%  239 aa  PYRH_CALS8 RecName: Full=Uridylate kinase;         Short=UK;       
   22::245     1e-39  39%  252 aa  PYRH_STRAW RecName: Full=Uridylate kinase;         Short=UK;       
   12::232     1e-39  39%  235 aa  PYRH_SOLUE RecName: Full=Uridylate kinase;         Short=UK;       
   20::228     1e-39  42%  246 aa  PYRH_GLUOX RecName: Full=Uridylate kinase;         Short=UK;       
   47::250     1e-39  42%  266 aa  PYRH_ACIC1 RecName: Full=Uridylate kinase;         Short=UK;       
   15::239     1e-39  40%  240 aa  PYRH_STAS1 RecName: Full=Uridylate kinase;         Short=UK;       
   20::242     1e-39  39%  247 aa  PYRH_PSEU5 RecName: Full=Uridylate kinase;         Short=UK;       
   15::229     1e-39  38%  240 aa  PYRH_HELPJ RecName: Full=Uridylate kinase;         Short=UK;       
   15::229     1e-39  38%  240 aa  PYRH_HELAH RecName: Full=Uridylate kinase;         Short=UK;       
   10::221     2e-39  39%  235 aa  PYRH_SULNB RecName: Full=Uridylate kinase;         Short=UK;       
   14::232     2e-39  41%  245 aa  PYRH_CHLTR RecName: Full=Uridylate kinase;         Short=UK;       
   15::239     2e-39  39%  240 aa  PYRH_STAAW RecName: Full=Uridylate kinase;         Short=UK;       
   15::239     2e-39  39%  240 aa  PYRH_STAAS RecName: Full=Uridylate kinase;         Short=UK;       
   15::239     2e-39  39%  240 aa  PYRH_STAAR RecName: Full=Uridylate kinase;         Short=UK;       
   15::239     2e-39  39%  240 aa  PYRH_STAAN RecName: Full=Uridylate kinase;         Short=UK;       
   15::239     2e-39  39%  240 aa  PYRH_STAAM RecName: Full=Uridylate kinase;         Short=UK;       
   15::239     2e-39  39%  240 aa  PYRH_STAAC RecName: Full=Uridylate kinase;         Short=UK;       
   15::239     2e-39  39%  240 aa  PYRH_STAAB RecName: Full=Uridylate kinase;         Short=UK;       
   15::239     2e-39  39%  240 aa  PYRH_STAA8 RecName: Full=Uridylate kinase;         Short=UK;       
   15::239     2e-39  39%  240 aa  PYRH_STAA3 RecName: Full=Uridylate kinase;         Short=UK;       
   15::239     2e-39  39%  240 aa  PYRH_STAA1 RecName: Full=Uridylate kinase;         Short=UK;       
   14::232     2e-39  41%  245 aa  PYRH_CHLTA RecName: Full=Uridylate kinase;         Short=UK;       
   15::239     3e-39  38%  240 aa  PYRH_STAAE RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     4e-39  39%  238 aa  PYRH_RHOPB RecName: Full=Uridylate kinase;         Short=UK;       
   20::242     4e-39  38%  245 aa  PYRH_PSEAE RecName: Full=Uridylate kinase;         Short=UK;       
   20::242     4e-39  38%  245 aa  PYRH_PSEAB RecName: Full=Uridylate kinase;         Short=UK;       
   15::239     5e-39  39%  240 aa  PYRH_STAES RecName: Full=Uridylate kinase;         Short=UK;       
   15::239     5e-39  39%  240 aa  PYRH_STAEQ RecName: Full=Uridylate kinase;         Short=UK;       
   14::233     5e-39  42%  234 aa  PYRH_CLOD6 RecName: Full=Uridylate kinase;         Short=UK;       
   18::241     7e-39  41%  243 aa  PYRH_SYNAS RecName: Full=Uridylate kinase;         Short=UK;       
   15::239     7e-39  39%  240 aa  PYRH_STAHJ RecName: Full=Uridylate kinase;         Short=UK;       
   20::242     7e-39  38%  245 aa  PYRH_PSEA7 RecName: Full=Uridylate kinase;         Short=UK;       
   28::239     7e-39  41%  246 aa  PYRH_CORJK RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     7e-39  41%  244 aa  PYRH_AERHH RecName: Full=Uridylate kinase;         Short=UK;       
   20::242     9e-39  39%  246 aa  PYRH_PSEU2 RecName: Full=Uridylate kinase;         Short=UK;       
   20::242     9e-39  39%  247 aa  PYRH_PSEPK RecName: Full=Uridylate kinase;         Short=UK;       
   20::242     9e-39  39%  247 aa  PYRH_PSEP1 RecName: Full=Uridylate kinase;         Short=UK;       
   14::223     9e-39  40%  238 aa  PYRH_BRASO RecName: Full=Uridylate kinase;         Short=UK;       
   14::234     9e-39  39%  236 aa  PYRH_ALKMQ RecName: Full=Uridylate kinase;         Short=UK;       
   20::242     1e-38  39%  247 aa  PYRH_PSESM RecName: Full=Uridylate kinase;         Short=UK;       
   20::242     1e-38  39%  247 aa  PYRH_PSEE4 RecName: Full=Uridylate kinase;         Short=UK;       
   20::242     1e-38  39%  247 aa  PYRH_PSE14 RecName: Full=Uridylate kinase;         Short=UK;       
   39::251     1e-38  40%  252 aa  PYRH_MYCSS RecName: Full=Uridylate kinase;         Short=UK;       
   39::251     1e-38  40%  252 aa  PYRH_MYCSK RecName: Full=Uridylate kinase;         Short=UK;       
   39::251     1e-38  40%  252 aa  PYRH_MYCSJ RecName: Full=Uridylate kinase;         Short=UK;       
   12::226     1e-38  38%  238 aa  PYRH_CAMC1 RecName: Full=Uridylate kinase;         Short=UK;       
   12::234     2e-38  40%  256 aa  PYRH_FRAAA RecName: Full=Uridylate kinase;         Short=UK;       
   30::241     2e-38  40%  243 aa  PYRH_CORDI RecName: Full=Uridylate kinase;         Short=UK;       
   15::237     2e-38  38%  249 aa  PYRH_BAUCH RecName: Full=Uridylate kinase;         Short=UK;       
   20::242     2e-38  39%  247 aa  PYRH_PSEF5 RecName: Full=Uridylate kinase;         Short=UK;       
   13::237     2e-38  42%  251 aa  PYRH_PARUW RecName: Full=Uridylate kinase;         Short=UK;       
   15::237     2e-38  40%  239 aa  PYRH_NEIMF RecName: Full=Uridylate kinase;         Short=UK;       
   14::218     3e-38  42%  240 aa  PYRH_LACS1 RecName: Full=Uridylate kinase;         Short=UK;       
   30::241     3e-38  40%  243 aa  PYRH_COREF RecName: Full=Uridylate kinase;         Short=UK;       
   15::224     3e-38  43%  239 aa  PYRH_BARHE RecName: Full=Uridylate kinase;         Short=UK;       
   19::241     4e-38  38%  242 aa  PYRH_MARAV RecName: Full=Uridylate kinase;         Short=UK;       
   14::240     4e-38  40%  241 aa  PYRH_LACDB RecName: Full=Uridylate kinase;         Short=UK;       
   14::240     4e-38  40%  241 aa  PYRH_LACDA RecName: Full=Uridylate kinase;         Short=UK;       
   18::241     4e-38  39%  245 aa  PYRH_IDILO RecName: Full=Uridylate kinase;         Short=UK;       
   14::223     4e-38  39%  238 aa  PYRH_BRASB RecName: Full=Uridylate kinase;         Short=UK;       
   17::239     6e-38  37%  247 aa  PYRH_SACD2 RecName: Full=Uridylate kinase;         Short=UK;       
   15::237     6e-38  39%  239 aa  PYRH_NEIG1 RecName: Full=Uridylate kinase;         Short=UK;       
   18::241     7e-38  38%  245 aa  PYRH_RICAH RecName: Full=Uridylate kinase;         Short=UK;       
   20::242     7e-38  39%  247 aa  PYRH_PSEPF RecName: Full=Uridylate kinase;         Short=UK;       
   12::226     1e-37  38%  239 aa  PYRH_CAMJR RecName: Full=Uridylate kinase;         Short=UK;       
   12::226     1e-37  38%  239 aa  PYRH_CAMJJ RecName: Full=Uridylate kinase;         Short=UK;       
   12::226     1e-37  38%  239 aa  PYRH_CAMJE RecName: Full=Uridylate kinase;         Short=UK;       
   12::226     1e-37  38%  239 aa  PYRH_CAMJ8 RecName: Full=Uridylate kinase;         Short=UK;       
   15::237     1e-37  39%  239 aa  PYRH_NEIMB RecName: Full=Uridylate kinase;         Short=UK;       
   15::237     1e-37  39%  239 aa  PYRH_NEIMA RecName: Full=Uridylate kinase;         Short=UK;       
   29::250     2e-37  39%  251 aa  PYRH_MYCVP RecName: Full=Uridylate kinase;         Short=UK;       
   14::234     3e-37  40%  243 aa  PYRH_SYMTH RecName: Full=Uridylate kinase;         Short=UK;       
   26::247     3e-37  38%  248 aa  PYRH_MYCS2 RecName: Full=Uridylate kinase;         Short=UK;       
   14::237     4e-37  39%  243 aa  PYRH_OENOB RecName: Full=Uridylate kinase;         Short=UK;       
   14::237     4e-37  40%  240 aa  PYRH_GEOKA RecName: Full=Uridylate kinase;         Short=UK;       
   12::226     4e-37  38%  239 aa  PYRH_CAMJD RecName: Full=Uridylate kinase;         Short=UK;       
   29::240     5e-37  39%  242 aa  PYRH_RHOSR RecName: Full=Uridylate kinase;         Short=UK;       
   15::218     5e-37  43%  240 aa  PYRH_RHILO RecName: Full=Uridylate kinase;         Short=UK;       
   39::241     6e-37  40%  243 aa  PYRH_CORGL RecName: Full=Uridylate kinase;         Short=UK;       
   39::241     6e-37  40%  243 aa  PYRH_CORGB RecName: Full=Uridylate kinase;         Short=UK;       
   12::223     8e-37  38%  238 aa  PYRH_CAMFF RecName: Full=Uridylate kinase;         Short=UK;       
   11::223     1e-36  37%  237 aa  PYRH_SULDN RecName: Full=Uridylate kinase;         Short=UK;       
   10::222     1e-36  40%  236 aa  PYRH_MYCHJ RecName: Full=Uridylate kinase;         Short=UK;       
   10::222     1e-36  40%  236 aa  PYRH_MYCH7 RecName: Full=Uridylate kinase;         Short=UK;       
   10::222     1e-36  40%  236 aa  PYRH_MYCH2 RecName: Full=Uridylate kinase;         Short=UK;       
   19::241     2e-36  37%  242 aa  PYRH_BUCBP RecName: Full=Uridylate kinase;         Short=UK;       
   14::237     2e-36  39%  240 aa  PYRH_BACSU RecName: Full=Uridylate kinase;         Short=UK;       
   14::223     2e-36  39%  238 aa  PYRH_RHOPS RecName: Full=Uridylate kinase;         Short=UK;       
   24::248     3e-36  41%  255 aa  PYRH_RUBXD RecName: Full=Uridylate kinase;         Short=UK;       
   14::223     3e-36  39%  238 aa  PYRH_RHOP2 RecName: Full=Uridylate kinase;         Short=UK;       
   12::234     3e-36  37%  236 aa  PYRH_PARD8 RecName: Full=Uridylate kinase;         Short=UK;       
   12::237     3e-36  38%  259 aa  PYRH_FRASC RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     3e-36  35%  241 aa  PYRH_BLOPB RecName: Full=Uridylate kinase;         Short=UK;       
   14::238     3e-36  37%  239 aa  PYRH_ACIBL RecName: Full=Uridylate kinase;         Short=UK;       
   15::226     5e-36  41%  240 aa  PYRH_RHIEC RecName: Full=Uridylate kinase;         Short=UK;       
   14::232     5e-36  38%  245 aa  PYRH_CHLMU RecName: Full=Uridylate kinase;         Short=UK;       
   14::238     9e-36  38%  243 aa  PYRH_ROSS1 RecName: Full=Uridylate kinase;         Short=UK;       
   14::236     1e-35  37%  238 aa  PYRH_BRAJA RecName: Full=Uridylate kinase;         Short=UK;       
   12::235     1e-35  39%  239 aa  PYRH_BACHD RecName: Full=Uridylate kinase;         Short=UK;       
   29::242     2e-35  39%  249 aa  PYRH_SACEN RecName: Full=Uridylate kinase;         Short=UK;       
   10::224     2e-35  36%  235 aa  PYRH_ARCB4 RecName: Full=Uridylate kinase;         Short=UK;       
   13::230     3e-35  40%  237 aa  PYRH_MYCCT RecName: Full=Uridylate kinase;         Short=UK;       
   12::235     3e-35  38%  239 aa  PYRH_PORGI RecName: Full=Uridylate kinase;         Short=UK;       
   23::248     5e-35  36%  259 aa  PYRH_SALRD RecName: Full=Uridylate kinase;         Short=UK;       
   14::238     6e-35  36%  241 aa  PYRH_STRGC RecName: Full=Uridylate kinase;         Short=UK;       
   14::239     1e-34  37%  240 aa  PYRH_DESHY RecName: Full=Uridylate kinase;         Short=UK;       
   17::242     1e-34  35%  243 aa  PYRH_BLOFL RecName: Full=Uridylate kinase;         Short=UK;       
   69::216     2e-34  49%  247 aa  PYRH_MESSB RecName: Full=Uridylate kinase;         Short=UK;       
   14::240     2e-34  39%  241 aa  PYRH_LACH4 RecName: Full=Uridylate kinase;         Short=UK;       
   16::240     3e-34  35%  247 aa  PYRH_STRPN RecName: Full=Uridylate kinase;         Short=UK;       
   10::233     4e-34  36%  233 aa  PYRH_THELT RecName: Full=Uridylate kinase;         Short=UK;       
   14::240     4e-34  35%  249 aa  PYRH_ORITB RecName: Full=Uridylate kinase;         Short=UK;       
   16::219     5e-34  42%  241 aa  PYRH_AGRT5 RecName: Full=Uridylate kinase;         Short=UK;       
   15::232     7e-34  43%  245 aa  PYRH_MYCMO RecName: Full=Uridylate kinase;         Short=UK;       
   12::234     7e-34  37%  236 aa  PYRH_BACTN RecName: Full=Uridylate kinase;         Short=UK;       
    8::231     1e-33  35%  231 aa  PYRH_THEP1 RecName: Full=Uridylate kinase;         Short=UK;       
    8::231     2e-33  35%  231 aa  PYRH_THEMA RecName: Full=Uridylate kinase;         Short=UK;       
   14::238     2e-33  34%  244 aa  PYRH_STRSY RecName: Full=Uridylate kinase;         Short=UK;       
   14::238     2e-33  34%  244 aa  PYRH_STRS2 RecName: Full=Uridylate kinase;         Short=UK;       
   16::240     2e-33  35%  247 aa  PYRH_STRR6 RecName: Full=Uridylate kinase;         Short=UK;       
   14::238     2e-33  35%  245 aa  PYRH_STRP2 RecName: Full=Uridylate kinase;         Short=UK;       
   12::234     2e-33  36%  236 aa  PYRH_BACFR RecName: Full=Uridylate kinase;         Short=UK;       
   12::234     2e-33  36%  236 aa  PYRH_BACFN RecName: Full=Uridylate kinase;         Short=UK;       
   22::244     2e-33  36%  245 aa  PYRH_ARTS2 RecName: Full=Uridylate kinase;         Short=UK;       
   12::228     4e-33  40%  239 aa  PYRH_MYCS5 RecName: Full=Uridylate kinase;         Short=UK;       
   12::237     7e-33  35%  241 aa  PYRH_AYWBP RecName: Full=Uridylate kinase;         Short=UK;       
   15::234     9e-33  36%  237 aa  PYRH_LEIXX RecName: Full=Uridylate kinase;         Short=UK;       
   41::227     2e-32  42%  231 aa  PYRH_TROWT RecName: Full=Uridylate kinase;         Short=UK;       
   41::227     2e-32  42%  231 aa  PYRH_TROW8 RecName: Full=Uridylate kinase;         Short=UK;       
   13::237     2e-32  35%  242 aa  PYRH_STRA5 RecName: Full=Uridylate kinase;         Short=UK;       
   13::237     2e-32  35%  242 aa  PYRH_STRA1 RecName: Full=Uridylate kinase;         Short=UK;       
   13::237     2e-32  35%  242 aa  PYRH_STRA3 RecName: Full=Uridylate kinase;         Short=UK;       
   29::235     4e-32  36%  237 aa  PYRH_NOCSJ RecName: Full=Uridylate kinase;         Short=UK;       
   11::235     6e-32  36%  317 aa  PYRH_MYCPE RecName: Full=Uridylate kinase;         Short=UK;       
   72::240     8e-32  41%  242 aa  PYRH_NOCFA RecName: Full=Uridylate kinase;         Short=UK;       
   12::237     1e-31  34%  241 aa  PYRH_ONYPE RecName: Full=Uridylate kinase;         Short=UK;       
   12::234     1e-31  34%  236 aa  PYRH_BACV8 RecName: Full=Uridylate kinase;         Short=UK;       
   11::227     2e-31  37%  235 aa  PYRH_UREPA RecName: Full=Uridylate kinase;         Short=UK;       
   13::237     2e-31  34%  242 aa  PYRH_STRPM RecName: Full=Uridylate kinase;         Short=UK;       
   13::237     2e-31  34%  242 aa  PYRH_STRPG RecName: Full=Uridylate kinase;         Short=UK;       
   13::237     2e-31  34%  242 aa  PYRH_STRPF RecName: Full=Uridylate kinase;         Short=UK;       
   13::237     2e-31  34%  242 aa  PYRH_STRPC RecName: Full=Uridylate kinase;         Short=UK;       
   13::237     2e-31  34%  242 aa  PYRH_STRPB RecName: Full=Uridylate kinase;         Short=UK;       
   13::237     2e-31  34%  242 aa  PYRH_STRP8 RecName: Full=Uridylate kinase;         Short=UK;       
   13::237     2e-31  34%  242 aa  PYRH_STRP6 RecName: Full=Uridylate kinase;         Short=UK;       
   13::237     2e-31  34%  242 aa  PYRH_STRP3 RecName: Full=Uridylate kinase;         Short=UK;       
   13::237     2e-31  34%  242 aa  PYRH_STRP1 RecName: Full=Uridylate kinase;         Short=UK;       
   15::226     2e-31  38%  240 aa  PYRH_OCHA4 RecName: Full=Uridylate kinase;         Short=UK;       
   15::226     2e-31  38%  240 aa  PYRH_BRUAB RecName: Full=Uridylate kinase;         Short=UK;       
   13::237     3e-31  34%  242 aa  PYRH_STRPD RecName: Full=Uridylate kinase;         Short=UK;       
   83::264     7e-31  39%  265 aa  PYRH_MYCA1 RecName: Full=Uridylate kinase;         Short=UK;       
   13::234     9e-31  36%  238 aa  PYRH_MESFL RecName: Full=Uridylate kinase;         Short=UK;       
   15::226     9e-31  38%  240 aa  PYRH_BRUSU RecName: Full=Uridylate kinase;         Short=UK;       
   83::264     2e-30  39%  265 aa  PYRH_MYCPA RecName: Full=Uridylate kinase;         Short=UK;       
   14::238     2e-30  37%  242 aa  PYRH_LISW6 RecName: Full=Uridylate kinase;         Short=UK;       
   14::238     2e-30  37%  242 aa  PYRH_LISMO RecName: Full=Uridylate kinase;         Short=UK;       
   14::238     2e-30  37%  242 aa  PYRH_LISMF RecName: Full=Uridylate kinase;         Short=UK;       
   14::238     2e-30  37%  242 aa  PYRH_LISIN RecName: Full=Uridylate kinase;         Short=UK;       
   10::234     3e-30  32%  235 aa  PYRH_MYCPN RecName: Full=Uridylate kinase;         Short=UK;       
   15::238     6e-30  37%  240 aa  PYRH_SINMW RecName: Full=Uridylate kinase;         Short=UK;       
   73::254     6e-30  39%  255 aa  PYRH_MYCLE RecName: Full=Uridylate kinase;         Short=UK;       
   15::238     1e-29  36%  240 aa  PYRH_RHIME RecName: Full=Uridylate kinase;         Short=UK;       
   91::260     1e-29  41%  261 aa  PYRH_MYCTU RecName: Full=Uridylate kinase;         Short=UK;       
   91::260     1e-29  41%  261 aa  PYRH_MYCTA RecName: Full=Uridylate kinase;         Short=UK;       
   91::260     1e-29  41%  261 aa  PYRH_MYCBP RecName: Full=Uridylate kinase;         Short=UK;       
   91::260     1e-29  41%  261 aa  PYRH_MYCBO RecName: Full=Uridylate kinase;         Short=UK;       
   15::226     1e-29  37%  240 aa  PYRH_BRUME RecName: Full=Uridylate kinase;         Short=UK;       
   59::244     1e-29  37%  245 aa  PYRH_ARTAT RecName: Full=Uridylate kinase;         Short=UK;       
   38::241     1e-29  35%  242 aa  PYRH_MYCGA RecName: Full=Uridylate kinase;         Short=UK;       
   15::226     2e-29  36%  240 aa  PYRH_RHIL3 RecName: Full=Uridylate kinase;         Short=UK;       
   15::237     3e-29  35%  238 aa  PYRH_CLAM3 RecName: Full=Uridylate kinase;         Short=UK;       
   54::235     1e-28  38%  237 aa  PYRH_PROAC RecName: Full=Uridylate kinase;         Short=UK;       
   17::240     3e-28  30%  241 aa  PYRH_WIGBR RecName: Full=Uridylate kinase;         Short=UK;       
   12::235     7e-28  33%  237 aa  PYRH_THIDA RecName: Full=Uridylate kinase;         Short=UK;       
   15::238     3e-27  32%  239 aa  PYRH_BUCCC RecName: Full=Uridylate kinase;         Short=UK;       
   56::238     2e-24  36%  246 aa  PYRH_BIFLO RecName: Full=Uridylate kinase;         Short=UK;       
   18::241     2e-23  32%  249 aa  PYRH_BIFAA RecName: Full=Uridylate kinase;         Short=UK;       
   18::231     9e-23  31%  243 aa  PYRH_MYCGE RecName: Full=Uridylate kinase;         Short=UK;       
   17::170     5e-18  39%  226 aa  PYRH_METJA RecName: Full=Uridylate kinase;         Short=UK;       
   17::170     2e-15  32%  225 aa  PYRH_META3 RecName: Full=Uridylate kinase;         Short=UK;       
   17::169     3e-15  33%  225 aa  PYRH_METVS RecName: Full=Uridylate kinase;         Short=UK;       
   17::169     9e-15  33%  225 aa  PYRH_METM6 RecName: Full=Uridylate kinase;         Short=UK;       
   60::218     2e-14  33%  234 aa  PYRH_METB6 RecName: Full=Uridylate kinase;         Short=UK;       
   39::169     3e-14  38%  227 aa  PYRH_THEVO RecName: Full=Uridylate kinase;         Short=UK;       
   17::169     3e-14  33%  225 aa  PYRH_METM7 RecName: Full=Uridylate kinase;         Short=UK;       
   17::169     3e-14  33%  225 aa  PYRH_METM5 RecName: Full=Uridylate kinase;         Short=UK;       
   17::169     8e-14  32%  225 aa  PYRH_METMP RecName: Full=Uridylate kinase;         Short=UK;       
   36::167     1e-13  44%  225 aa  PYRH_METS3 RecName: Full=Uridylate kinase;         Short=UK;       
   22::167     5e-13  42%  223 aa  PYRH_METST RecName: Full=Uridylate kinase;         Short=UK;       
   16::170     2e-12  37%  226 aa  PYRH_SULTO RecName: Full=Uridylate kinase;         Short=UK;       
   26::225     5e-12  35%  236 aa  PYRH_METHJ RecName: Full=Uridylate kinase;         Short=UK;       
   67::203     2e-11  34%  225 aa  PYRH_PICTO RecName: Full=Uridylate kinase;         Short=UK;       
   36::221     2e-11  34%  224 aa  PYRH_METTH RecName: Full=Uridylate kinase;         Short=UK;       
   65::166     6e-11  40%  227 aa  PYRH_SULAC RecName: Full=Uridylate kinase;         Short=UK;       
   37::230     8e-11  34%  233 aa  PYRH_METMA RecName: Full=Uridylate kinase;         Short=UK;       
   67::169     1e-10  33%  229 aa  PYRH_THEAC RecName: Full=Uridylate kinase;         Short=UK;       
   91::214     1e-10  34%  234 aa  PYRH_METMJ RecName: Full=Uridylate kinase;         Short=UK;       
   37::168     1e-10  34%  233 aa  PYRH_METAC RecName: Full=Uridylate kinase;         Short=UK;       
  106::168     1e-10  46%  228 aa  PYRH_CENSY RecName: Full=Uridylate kinase;         Short=UK;       
   20::178     2e-10  34%  224 aa  PYRH_METS5 RecName: Full=Uridylate kinase;         Short=UK;       
   66::214     4e-10  34%  241 aa  PYRH_HALSA RecName: Full=Uridylate kinase;         Short=UK;       
   66::214     4e-10  34%  241 aa  PYRH_HALS3 RecName: Full=Uridylate kinase;         Short=UK;       
   24::220     5e-10  30%  235 aa  PYRH_METLZ RecName: Full=Uridylate kinase;         Short=UK;       
   36::220     9e-10  33%  234 aa  PYRH_METBU RecName: Full=Uridylate kinase;         Short=UK;       
   36::220     3e-09  29%  224 aa  PYRH_STAMF RecName: Full=Uridylate kinase;         Short=UK;       
   37::168     3e-09  34%  233 aa  PYRH_METBF RecName: Full=Uridylate kinase;         Short=UK;       
  112::168     3e-09  47%  225 aa  PYRH_THEON RecName: Full=Uridylate kinase;         Short=UK;       
  112::168     4e-09  47%  225 aa  PYRH_PYRKO RecName: Full=Uridylate kinase;         Short=UK;       
   63::216     4e-09  38%  219 aa  PYRH_ARCFU RecName: Full=Uridylate kinase;         Short=UK;       
   16::243     4e-09  30%  412 aa  AK_PSEAE RecName: Full=Aspartokinase;         EC=2.7.2.4;AltName:
  112::168     3e-08  46%  225 aa  PYRH_THESM RecName: Full=Uridylate kinase;         Short=UK;       
   37::223     3e-08  34%  225 aa  PYRH_PYRAB RecName: Full=Uridylate kinase;         Short=UK;       
  112::168     5e-08  44%  225 aa  PYRH_THEGJ RecName: Full=Uridylate kinase;         Short=UK;       
  103::215     2e-07  38%  241 aa  PYRH_HALLT RecName: Full=Uridylate kinase;         Short=UK;       
  109::225     2e-07  32%  226 aa  PYRH_HYPBU RecName: Full=Uridylate kinase;         Short=UK;       
  134::219     3e-07  40%  228 aa  PYRH_HALMA RecName: Full=Uridylate kinase;         Short=UK;       
   16::166     4e-07  29%  226 aa  PYRH_SULIY RecName: Full=Uridylate kinase;         Short=UK;       
   16::166     4e-07  29%  226 aa  PYRH_SULIN RecName: Full=Uridylate kinase;         Short=UK;       
   16::166     4e-07  29%  226 aa  PYRH_SULIM RecName: Full=Uridylate kinase;         Short=UK;       
   16::166     4e-07  29%  226 aa  PYRH_SULIL RecName: Full=Uridylate kinase;         Short=UK;       
   16::166     4e-07  29%  226 aa  PYRH_SULIK RecName: Full=Uridylate kinase;         Short=UK;       
   66::223     4e-07  31%  227 aa  PYRH_NATPD RecName: Full=Uridylate kinase;         Short=UK;       
   17::167     5e-07  29%  227 aa  PYRH_SULSO RecName: Full=Uridylate kinase;         Short=UK;       
  118::220     9e-07  35%  224 aa  PYRH_UNCMA RecName: Full=Uridylate kinase;         Short=UK;       
   16::166     9e-07  29%  226 aa  PYRH_SULIA RecName: Full=Uridylate kinase;         Short=UK;       
   35::176     1e-06  31%  223 aa  PYRH_METTP RecName: Full=Uridylate kinase;         Short=UK;       
  149::253     2e-06  33%  369 aa  PROB_NEIMA RecName: Full=Glutamate 5-kinase;       
  149::244     3e-06  36%  369 aa  PROB_NEIMF RecName: Full=Glutamate 5-kinase;       
  149::244     3e-06  36%  369 aa  PROB_NEIMB RecName: Full=Glutamate 5-kinase;       
   24::216     4e-06  28%  217 aa  PYRH_PYRCJ RecName: Full=Uridylate kinase;         Short=UK;       
  189::277     8e-06  37%  440 aa  AK_CHLPN RecName: Full=Aspartokinase;         EC=2.7.2.4;AltName:
   11::187     2e-05  27%  367 aa  PROB_BACCR RecName: Full=Glutamate 5-kinase;       
   11::187     2e-05  27%  367 aa  PROB_BACC4 RecName: Full=Glutamate 5-kinase;       
   11::187     2e-05  27%  367 aa  PROB_BACC2 RecName: Full=Glutamate 5-kinase;       
  149::253     2e-05  28%  369 aa  PROB_STRZT RecName: Full=Glutamate 5-kinase;       
  149::253     2e-05  28%  369 aa  PROB_STRZP RecName: Full=Glutamate 5-kinase;       
  149::253     2e-05  28%  369 aa  PROB_STRZJ RecName: Full=Glutamate 5-kinase;       
  149::253     2e-05  28%  369 aa  PROB_STRR6 RecName: Full=Glutamate 5-kinase;       
  149::253     2e-05  28%  369 aa  PROB_STRPN RecName: Full=Glutamate 5-kinase;       
  149::253     2e-05  28%  369 aa  PROB_STRP7 RecName: Full=Glutamate 5-kinase;       
  149::253     2e-05  28%  369 aa  PROB_STRP2 RecName: Full=Glutamate 5-kinase;       
  154::205     4e-05  40%  368 aa  PROB_SILST RecName: Full=Glutamate 5-kinase;       
  145::254     4e-05  29%  372 aa  PROB_OCEIH RecName: Full=Glutamate 5-kinase;       
  139::185     4e-05  36%  251 aa  PROB_CAMJE RecName: Full=Glutamate 5-kinase;       
  139::185     4e-05  36%  251 aa  PROB_CAMJ8 RecName: Full=Glutamate 5-kinase;       
  145::188     5e-05  43%  365 aa  PROB_BACSU RecName: Full=Glutamate 5-kinase 1;       
   11::187     5e-05  27%  367 aa  PROB_BACHK RecName: Full=Glutamate 5-kinase;       
   11::187     5e-05  27%  367 aa  PROB_BACCZ RecName: Full=Glutamate 5-kinase;       
   11::187     5e-05  27%  367 aa  PROB_BACCQ RecName: Full=Glutamate 5-kinase;       
   11::187     5e-05  27%  367 aa  PROB_BACC1 RecName: Full=Glutamate 5-kinase;       
   11::187     5e-05  27%  367 aa  PROB_BACAN RecName: Full=Glutamate 5-kinase;       
  110::230     6e-05  29%  232 aa  PYRH_THEPD RecName: Full=Uridylate kinase;         Short=UK;       
  145::190     6e-05  39%  365 aa  PROB1_BACLD RecName: Full=Glutamate 5-kinase 1;       
   27::193     8e-05  28%  267 aa  PROB_STRTR RecName: Full=Glutamate 5-kinase;       
  149::253     8e-05  28%  369 aa  PROB_STRPJ RecName: Full=Glutamate 5-kinase;       
  155::248     8e-05  29%  264 aa  PROB_ALKMQ RecName: Full=Glutamate 5-kinase;       
   11::187     1e-04  26%  367 aa  PROB_BACWK RecName: Full=Glutamate 5-kinase;       
   27::193     1e-04  28%  267 aa  PROB_STRTD RecName: Full=Glutamate 5-kinase;       
   27::193     1e-04  28%  267 aa  PROB_STRT2 RecName: Full=Glutamate 5-kinase;       
   27::193     1e-04  28%  267 aa  PROB_STRT1 RecName: Full=Glutamate 5-kinase;       
  154::200     1e-04  36%  368 aa  PROB_MYCUA RecName: Full=Glutamate 5-kinase;       
  153::202     1e-04  38%  367 aa  PROB_MYCPA RecName: Full=Glutamate 5-kinase;       
  154::200     1e-04  36%  368 aa  PROB_MYCMM RecName: Full=Glutamate 5-kinase;       
  153::202     1e-04  38%  367 aa  PROB_MYCA1 RecName: Full=Glutamate 5-kinase;       
  155::264     1e-04  30%  379 aa  PROB_DESDG RecName: Full=Glutamate 5-kinase;       
  125::229     1e-04  34%  421 aa  AK_MYCTU RecName: Full=Aspartokinase;         EC=2.7.2.4;AltName:
  125::229     1e-04  34%  421 aa  AK_MYCBO RecName: Full=Aspartokinase;         EC=2.7.2.4;AltName:
   28::192     2e-04  29%  377 aa  PROB_DESAD RecName: Full=Glutamate 5-kinase;       
  193::293     2e-04  30%  473 aa  AK_METJA RecName: Full=Probable aspartokinase;       
  139::219     3e-04  33%  241 aa  PYRH_HALWD RecName: Full=Uridylate kinase;         Short=UK;       
  153::201     3e-04  37%  367 aa  PROB_MYCLE RecName: Full=Glutamate 5-kinase;       
  153::201     3e-04  37%  367 aa  PROB_MYCLB RecName: Full=Glutamate 5-kinase;       
  233::279     3e-04  40%  527 aa  AK_YEAST RecName: Full=Aspartokinase;         EC=2.7.2.4;AltName:
  150::195     4e-04  39%  374 aa  PROB_ROSDO RecName: Full=Glutamate 5-kinase;       
  154::200     4e-04  38%  376 aa  PROB_MYCTU RecName: Full=Glutamate 5-kinase;       
  154::200     4e-04  38%  376 aa  PROB_MYCTA RecName: Full=Glutamate 5-kinase;       
  154::200     4e-04  38%  376 aa  PROB_MYCBT RecName: Full=Glutamate 5-kinase;       
  154::200     4e-04  38%  376 aa  PROB_MYCBP RecName: Full=Glutamate 5-kinase;       
  154::200     4e-04  38%  376 aa  PROB_MYCBO RecName: Full=Glutamate 5-kinase;       
  201::284     4e-04  31%  449 aa  AK3_ECOLI RecName: Full=Lysine-sensitive aspartokinase 3;       
  149::190     5e-04  38%  371 aa  PROB_IDILO RecName: Full=Glutamate 5-kinase;       
   20::128     7e-04  34%  176 aa  RL10_LEUCK RecName: Full=50S ribosomal protein L10;
  152::207     7e-04  38%  370 aa  PROB_RHOS4 RecName: Full=Glutamate 5-kinase;       
  155::201     7e-04  34%  267 aa  PROB_LACS1 RecName: Full=Glutamate 5-kinase;       
  157::202     7e-04  30%  270 aa  PROB_LACLA RecName: Full=Glutamate 5-kinase;       
    1::249

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSNDSSECSQXXXXXXXXXXXXSGESLSADQGFGINVESAQPIINQIKTLTNFGVELALVVGGGNILRGG
PYRH_FRATW      MSNDSSECSQXXXXXXXXXXXXSGESLSADQGFGINVESAQPIINQIKTLTNFGVELALVVGGGNILRGG
PYRH_FRATT      MSNDSSECSQXXXXXXXXXXXXSGESLSADQGFGINVESAQPIINQIKTLTNFGVELALVVGGGNILRGG
PYRH_FRATN      MSNDSSECSQXXXXXXXXXXXXSGESLSADQGFGINVESAQPIINQIKTLTNFGVELALVVGGGNILRGG
PYRH_FRAT1      MSNDSSECSQXXXXXXXXXXXXSGESLSADQGFGINVESAQPIINQIKTLTNFGVELALVVGGGNILRGG
PYRH_FRATO      MSNDSSECSQXXXXXXXXXXXXSGESLSADQGFGINVESAQPIINQIKTLTNFGVELALVVGGGNILRGG
PYRH_FRATH      MSNDSSECSQXXXXXXXXXXXXSGESLSADQGFGINVESAQPIINQIKTLTNFGVELALVVGGGNILRGG
PYRH_FRATF      MSNDSSECSQXXXXXXXXXXXXSGESLSADQGFGINVESAQPIINQIKTLTNFGVELALVVGGGNILRGG
PYRH_HERAR      ----------------------SGEALMGDDPYGINRATIERMVADVSEVSRLGVELAIVIGGGNIFRGV
PYRH_CLOAB      ----------------------SGEALAGTNGYGIDFEVANRIAKEIKEIVDLGIEVGAVVGGGNIWRGR
PYRH_JANMA      ----------------------SGEALMGDDPYGINRATIERMVADVSEVAKLGVELAIVIGGGNIFRGV
PYRH_ALHEH      ----------------------SGEALMGDAAYGISPDVIRRIAHEVAEVSRMGVEIALVIGGGNIFRGG
PYRH_MAGSA      ----------------------SGEGLMGTREYGLDPETVDRIAREVKSVRDLGVEVCVVIGGGNIFRGV
PYRH_BURS3      ----------------------SGEALMGDDAFGINRATIERMVADIAEVVRLGTQLAVVIGGGNIFRGV
PYRH_RALEJ      ----------------------SGEALMGDDAFGINRATIEGMVNDIAEIVKLGVQVAVVIGGGNIFRGV
PYRH_METPP      ----------------------SGEALMGDDAYGINRATIVRMVQEVREITEMGCEVAVVIGGGNLFRGV
PYRH_RALSO      ----------------------SGEALMGDDAFGINRSTIEGMVNDIAEIVRLGVQVAVVIGGGNIFRGV
PYRH_BURCH      ----------------------SGEALMGDDAFGINRATIERMVADIAEVVRLGTQLAVVIGGGNIFRGV
PYRH_BURCA      ----------------------SGEALMGDDAFGINRATIERMVADIAEVVRLGTQLAVVIGGGNIFRGV
PYRH_RALEH      ----------------------SGEALMGDDAFGINRSTIEAMVNDIAEIVKLGVQVAVVIGGGNIFRGV
PYRH_PROM3      ----------------------SGEALMGDQSYGIDPAIVQSIAEDVAKVVAKGTQLAIVVGGGNIFRGL
PYRH_RALME      ----------------------SGEALMGDDAFGINRATIEGMVNDIAEIVKLGVQVAVVIGGGNIFRGV
PYRH_LEPBL      ----------------------SGEALAGEGEFGIDTNKAHSLAEEIKEVHDLGVEIALVVGGGNIIRGT
PYRH_LEPBJ      ----------------------SGEALAGEGEFGIDTNKAHSLAEEIKEVHDLGVEIALVVGGGNIIRGT
PYRH_BORPE      ----------------------SGEALMGEDAFGINRSTIVRMTDEIAEVAALGVELAIVIGGGNIFRGV
PYRH_POLNA      ----------------------SGEALMGDDAFGINRATIVRMVEEIAEVTRMGVQVAVVIGGGNIFRGV
PYRH_HAEIN      ----------------------SGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGA
PYRH_ACISJ      ----------------------SGEALMGDDAFGINRATIVRMVEEIAEVTRLGVQVAVVIGGGNIFRGV
PYRH_ACIAC      ----------------------SGEALMGDDAFGINRATIVRMVEEIAEVTRMGVQVAVVIGGGNIFRGV
PYRH_MANSM      ----------------------SGEALQGDEGFGIDPSILDRMALEIKELIAMDVEVGVVIGGGNLFRGA
PYRH_PROMM      ----------------------SGEALMGDQSYGIDPAIVQSIAEDVAKVVAKGTQLAIVVGGGNIFRGL
PYRH_BURVG      ----------------------SGEALMGDDAFGINRATIERMVADIAEVVGLGTQLAVVIGGGNIFRGV
PYRH_BURCM      ----------------------SGEALMGDDAFGINRATIERMVADIAEVVGLGTQLAVVIGGGNIFRGV
PYRH_BORBR      ----------------------SGEALMGEDAFGINRSTIVRMTDEIAEVAALGVELAIVIGGGNIFRGV
PYRH_XANCP      ----------------------SGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRGG
PYRH_XANC8      ----------------------SGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRGG
PYRH_BURTA      ----------------------SGEALMGDDAFGINRATIERMVADIAEVVRLGTQLAVVIGGGNIFRGV
PYRH_BURPS      ----------------------SGEALMGDDAFGINRATIERMVADIAEVVRLGTQLAVVIGGGNIFRGV
PYRH_BURP6      ----------------------SGEALMGDDAFGINRATIERMVADIAEVVRLGTQLAVVIGGGNIFRGV
PYRH_BURP1      ----------------------SGEALMGDDAFGINRATIERMVADIAEVVRLGTQLAVVIGGGNIFRGV
PYRH_BURP0      ----------------------SGEALMGDDAFGINRATIERMVADIAEVVRLGTQLAVVIGGGNIFRGV
PYRH_BURMS      ----------------------SGEALMGDDAFGINRATIERMVADIAEVVRLGTQLAVVIGGGNIFRGV
PYRH_BURMA      ----------------------SGEALMGDDAFGINRATIERMVADIAEVVRLGTQLAVVIGGGNIFRGV
PYRH_BURM9      ----------------------SGEALMGDDAFGINRATIERMVADIAEVVRLGTQLAVVIGGGNIFRGV
PYRH_BURM7      ----------------------SGEALMGDDAFGINRATIERMVADIAEVVRLGTQLAVVIGGGNIFRGV
PYRH_SYNS3      ----------------------SGEALMGNQGYGIDPEIVQAIARDVAEVVATGTQLAIVVGGGNIFRGL
PYRH_GEOMG      ----------------------SGEALAGDQGYGIDPLTITTIAAEIKEVVASGAQLALVIGGGNIFRGL
PYRH_CLOTH      ----------------------SGEALAGEKKLGLDTDTINEISRNIKEVYDLGVEIAIVVGGGNFWRG-
PYRH_BORPA      ----------------------SGEALMGEDAFGINRSTIVRMTDEIAEVAALGVELAIVIGGGNIFRGV
PYRH_RHOFD      ----------------------SGEALMGDDQFGINHDTIVRMVDEIAEVTRLGVEVAVVIGGGNIFRGV
PYRH_BURXL      ----------------------SGEALMGDDAFGINRATIERMVADVAEVVRLGTQLAVVIGGGNIFRGV
PYRH_XANOR      ----------------------SGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRGG
PYRH_XANOM      ----------------------SGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRGG
PYRH_PROMT      ----------------------SGEALMGDKPYGIDPEIVQSIAKDVSKVVENGTQIAIVVGGGNIFRGL
PYRH_PROM1      ----------------------SGEALMGDKPYGIDPEIVQSIAKDVSKVVENGTQIAIVVGGGNIFRGL
PYRH_FUSNN      ----------------------SGEALMGDQEFGISSDVIASYAKQIKEIVDLGVEVSIVIGGGNIFRG-
PYRH_COLP3      ----------------------SGEALMGDEGFGIDPKVLDRMAQEIKELVEMGIQVGLVIGGGNLFRGG
PYRH_BORA1      ----------------------SGEALMGDDAFGINRSTIVRMTDEIAEVAAMGVELAIVIGGGNIFRGV
PYRH_SYNPW      ----------------------SGEALMGDQGYGIDPAIVQAIAKDVAGVVASGTQLAIVVGGGNIFRGL
PYRH_LEPIN      ----------------------SGEALAGEGEFGIDTNKAHSLAEEIKEVHDLGVEIALVVGGGNIIRGT
PYRH_LEPIC      ----------------------SGEALAGEGEFGIDTNKAHSLAEEIKEVHDLGVEIALVVGGGNIIRGT
PYRH_GEOSL      ----------------------SGEALAGDQGYGIDPRTITAIAAEIKEVVATGSQLALVIGGGNIFRGL
PYRH_ANAVT      ----------------------SGEALMGNMGYGIDPEVVKEIAQEIAEVIATGVQIAIVVGGGNIFRGV
PYRH_POLSJ      ----------------------SGEALMGDDAFGINHATIVRMVEEIAEVTRMGVQVAVVIGGGNIFRGV
PYRH_PARDP      ----------------------SGEALMGDQGYGLHPPTVARIAQEVKSVHDMGIEICMVIGGGNIFRGL
PYRH_HALHL      ----------------------SGEALLGDGQYGIAANTLDRIADELAEINAMGVEVAVVIGGGNIFRGG
PYRH_ANASP      ----------------------SGEALMGNMGYGIDPEVVKEIAQEIAEVIATGVQIAIVVGGGNIFRGV
PYRH_XANC5      ----------------------SGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRGG
PYRH_SYNR3      ----------------------SGEALMGDQGYGIDPAIVSAIAKDVAEVVAKGTQLAIVVGGGNIFRGL
PYRH_XYLFT      ----------------------SGEALMGSADYGIDPKVINRLAGEVIEAQNAGAELALVIGGGNIFRGG
PYRH_THET8      ----------------------SGEFLTRN-GFGIEPEATQALAREIKAAYDTGVQLAIVIGAGNLWRGA
PYRH_THET2      ----------------------SGEFLTRN-GFGIEPEATQALAREIKAAYDTGVQLAIVIGAGNLWRGA
PYRH_PROMA      ----------------------SGEALMGSKPYGIDPEIVQSIAQDVSKVVQEGTQLAIVVGGGNIFRGL
PYRH_XYLFA      ----------------------SGEALMGSADYGIDPKVINRLAGEVIEAQNAGAELALVIGGGNIFRGG
PYRH_XANAC      ----------------------SGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRGG
PYRH_SYNY3      ----------------------SGEALMGDLGYGIDPAVVGTIAQEIKDVLQAGVQLAIVVGGGNIFRGV
PYRH_RHORT      ----------------------SGEGLLGNKEFGLDLEMVDRVAGEVKAAHDRGIQVCLVIGGGNIFRG-
PYRH_EHRCR      ----------------------SGEALMGKKGFGCDIEVLDKLSHDLKEVHSFGVQLCLVVGGGNIFRGA
PYRH_SYNS9      ----------------------SGEALMGSQGYGIDPEIVHSIAEDVAKVVASGTQLAIVVGGGNIFRGL
PYRH_ROSDO      ----------------------SGEALMGDQGFGLHPPTVERVAREVQSVHALGVEICMVIGGGNIFRGL
PYRH_PROMP      ----------------------SGEALMGDKPYGIDPAIVQSIAEDVERVIANKVQLAIVVGGGNIFRGL
PYRH_PROM5      ----------------------SGEALMGDKPYGIDPAIVQSIAEDVEKVIANNVQLAIVVGGGNIFRGL
PYRH_TRIEI      ----------------------SGEALMGSLGYGIDPAVVQGIAQEVAEVAATGIQIAIVVGGGNIFRGV
PYRH_RHOS4      ----------------------SGEALMGDQGYGLHPPTVQRIAREVQAVHRLGVEICLVIGGGNIFRGL
PYRH_METCA      ----------------------SGEALMGDQGAGIDAEILKRLATEIDELCQAGVEVGLVIGGGNIVRGA
PYRH_JANSC      ----------------------SGEALMGDQGFGLHPPTVERIAREIQSVHDMGVEICLVIGGGNIFRGL
PYRH_PARZE      ----------------------SGEALMGDQGFGLNPPTVARIANEVDSVAKMGVEVCMVIGGGNIFRGL
PYRH_DESRM      ----------------------SGEALAGQKGYGIDPEVVYSIASQIKDVLEHRVQLAIVVGGGNIWRGI
PYRH_RHOS1      ----------------------SGEALMGDQGYGLHPPTVQRIAREVQAVHRLGVEICMVIGGGNIFRGL
PYRH_RHOS5      ----------------------SGEALMGDQGYGLHPPTVQRIAREVQAVHRLGVEICMVIGGGNIFRGL
PYRH_PELPD      ----------------------SGESLAGSQGYGIDPKTITTIAREIKEVVQQGVQLALVIGGGNIFRGL
PYRH_VEREI      ----------------------SGEALMGSDAFGINHATIVRMVQEIAEVTRLGVQVAVVIGGGNIFRGV
PYRH_GLOVI      ----------------------SGEALMGDREFGIDPEVVKSLAGEIARVVEAGTELAVVVGGGNIFRGV
PYRH_DEHE1      ----------------------SGEAFKGATGYGIDIPTVRSIAHEIKHICLMGVEVAIVVGGGNIWRGA
PYRH_COXBU      ----------------------SGEALMGKGLHAIDPNVLDRMAKDVTQVYQLGVQIAIVIGGGNFFRGA
PYRH_SYNPX      ----------------------SGEALMGTQGYGIDPAIVNSIASDVAKVVAGGTELAIVVGGGNIFRGL
PYRH_MAGSM      ----------------------SGEALMGEQAYGIAPEFLSYLVEEVQSAIALDIELALVIGGGNIFRGI
PYRH_ANADE      ----------------------SGEALMGDGKYGISPKTLTSIAHDVKDVVDLGVEVALTIGGGNIFRGV
PYRH_CYTH3      ----------------------SGEALMGEQKYGIDSQVLIRYANEIKAIADKGVEITIVVGGGNIYRGI
PYRH_ACIAD      ----------------------SGEALSGNKDMGIDAQVLDQMSLSIAHLXXXXXXXXXXXXXXNLYRGS
PYRH_CARHZ      ----------------------SGEALAGEKGYGIDPEVVNSIAGQIEIIKEFGIQVAVVVGGGNIWRG-
PYRH_SYNSC      ----------------------SGEALMGSQGYGIDPAIVQSIASDVAKVVANGTQLAIVVGGGNIFRGL
PYRH_NITMU      ----------------------SGEALMGDDSYGINRDVIERIVAEIAEVNQLGVEVAVVIGGGNIFRGM
PYRH_NITEC      ----------------------SGEALMGDAQYGIDRTVVERIVVEIAGVLQLGVEVAIVVGGGNIFRGM
PYRH_MARMM      ----------------------SGEALMGSQNYGIDIDTADRIAREVAAAVKGGTEMCLVIGGGNIFRG-
PYRH_CLONN      ----------------------SGEALSGKKGFGFDFDVTQRIAKEIKEIVDMGIEVGAVVGGGNIWRGR
PYRH_PROMS      ----------------------SGEALMGEKPYGIDPAIVQSIAEDVSKVVENNVQLAIVVGGGNIFRGL
PYRH_MYXXD      ----------------------SGEALMGEGKYGIHPPTLMGIAEEVIELAQAGVEVALVIGGGNIFRGV
PYRH_CLOBL      ----------------------SGEALSGEKGFGFDFDFTKEISEQIKKLVDMGIEVGAVVGGGNIWRG-
PYRH_CLOBH      ----------------------SGEALSGEKGFGFDFDFTKEISEQIKKLVDMGIEVGAVVGGGNIWRG-
PYRH_CLOB1      ----------------------SGEALSGEKGFGFDFDFTKEISEQIKKLVDMGIEVGAVVGGGNIWRG-
PYRH_CHLPD      ----------------------SGEALAGEDGYGINAQMLERYAEEIREVRNLGAEVALVIGGGNIFRGV
PYRH_CLOPS      ----------------------SGEALAGENGFGIDFNIAMNIAKAVKELVDMGIEVGAVVGGGNIWRG-
PYRH_EHRCJ      ----------------------SGEALMGEKGFGCDVEVLDKLSHDLKEVYDFGIQLCLVVGGGNIFRGA
PYRH_DEHSC      ----------------------SGEAFKGATGYGIDIPTVRNIAQEIKHICLMGVEVAIVVGGGNIWRGA
PYRH_CLOPE      ----------------------SGEALAGENGFGIDFNIAMNIAKAVKELVDMGIEVGAVVGGGNIWRG-
PYRH_CLOP1      ----------------------SGEALAGENGFGIDFNIAMNIAKAVKELVDMGIEVGAVVGGGNIWRG-
PYRH_RHOBA      ----------------------SGESLAESGKRGISDNELLAIAKQIKSAHESGCQIAIVNGGGNILRGA
PYRH_PROM9      ----------------------SGEALMGEKPYGIDPAIVQSIAEDVSKVVGNNIQLAIVVGGGNIFRGL
PYRH_GRAFK      ----------------------SGEALMGNRQYGIDPERLAEYAAEIKSVVDKGVEVAIVIGGGNIFRGV
PYRH_BUCAP      ----------------------SGEVLQGVNKFGIDINSLKRIVKEIKLVLQFGIQVGLVIGSGNLFRGA
PYRH_ACTP2      ----------------------SGEALQGDEGFGIDPSILDRMALEIKELIEMXXXXXXXXXXXNLFRGA
PYRH_PROM2      ----------------------SGEALMGEKPYGIDPAIVQSIAEDVLKVVEKNVQLAIVVGGGNIFRGL
PYRH_PROM0      ----------------------SGEALMGEKPYGIDPAIVQSIAEDVSKVVENNVQLAIVVGGGNIFRGL
PYRH_THICR      ----------------------SGEALMGQGQFGLDSNTLRQVVLEVKALRDXXXXXXXXXXXXNIFRGA
PYRH_BARBK      ----------------------SGEALMGEQSFGIDVSVADRIASDIAEVRKMGVEVAIVIGGGNIFRGA
PYRH_PARL1      ----------------------SGEALMGPAQYGIDLDTVDRVARDIKQAIDAGVQVCLVIGGGNIFRG-
PYRH_CHLTE      ----------------------SGESLAGESGYGIDAGVLESFADDIKEATDLGAEIALVIGGGNIFRGL
PYRH_DEIRA      ----------------------SGEFLAGDNGFGISPETTAELARRIGALDGTEVELAVVIGGGNLWRGA
PYRH_ANADF      ----------------------SGEALMGDGKYGISPKTLSAIAGDVKDCVDLGVEVALTIGGGNIFRGV
PYRH_ACIBT      ----------------------SGEALSGNKDMGIDAQVLDQMSLSIAHLXXXXXXXXXXXXXXNLYRGS
PYRH_RICB8      ----------------------SGEALMGDKQFGHDYDTIKKIAGDIKELIDSGVEVAIVVGGGNIYRGI
PYRH_LACSS      ----------------------SGEALAGEQGFGINPEIVKVVANEIKSVHDLGVQIAIVCGGGNIWRGV
PYRH_LACC3      ----------------------SGEALAGEAGFGIKPPVIATIAKQIKEVHELGVQIAIVCGGGNIWRGE
PYRH_CAUCR      ----------------------SGEVLMGDTPYGIDTNTVQSVAEDVAEIVKSGVELCLVIGGGNIFRG-
PYRH_ALKOO      ----------------------SGEALAGEKGFGLDPNVVTNIATQVKDIVNMGVEVAIVVGGGNYWRG-
PYRH_NITEU      ----------------------SGEALMGDGHYGIDRXXXXXXXXXXXXXLQLGVEVAIVVGGGNIFRGM
PYRH_DESPS      ----------------------SGEALMGKDSYGINTGVLEFVAGEIKELVAMGVELGVVVGAGNIFRG-
PYRH_DEIGD      ----------------------SGPAPDGSAGFGISPDTTAQLARLITALTGTNVELAIVIGGGNLWRGA
PYRH_SYNP6      ----------------------SGEALMGDASYGIDPAVVQRIAQEIATVVQDGFQVAIVVGGGNIFRGI
PYRH_SYNE7      ----------------------SGEALMGDASYGIDPAVVQRIAQEIATVVQDGFQVAIVVGGGNIFRGI
PYRH_RICM5      ----------------------SGEALMGDKQFGHEYDVIKKIAGDIKEVINLGVEVAIVVGGGNIYRGI
PYRH_RICBR      ----------------------SGEALMGDKQFGHDYDTIKKIAGDIKELIDSGVEVAIVVGGGNIYRGI
PYRH_ANAPZ      ----------------------SGEALAGERGFGFDQDVIGKLSCDLKKVRESGVELCIVVGGGNIFRGS
PYRH_PELLD      ----------------------SGEALAGKDGYGINAEMLERFAEEVKEARDMGAEIALVIGGGNIFRGV
PYRH_FLAPJ      ----------------------SGEALMGDRQYGIDPKRLAEYADEIKQIHDLGVQIAIVIGGGNIFRG-
PYRH_ZYMMO      ----------------------SGEVLMGPGQFGIDPATVARVADEIRAAREAGYQLCIVVGGGNIFRGL
PYRH_CHLCH      ----------------------SGESLAGEDGYGINAGVLDQYAEEISEARDMGAQIALVIGGGNIFRGV
PYRH_BACSK      ----------------------SGEALAGEQGYGIDPTVIQSIAKQIKEITELNIEVAVVVGAGNIWRG-
PYRH_SYNFM      ----------------------SGEALLGKEAYGIDSSVLDQIAEEVTAVHQMGVQVAIVIGGGNIFRGV
PYRH_GEOTN      ----------------------SGEALAGKQGFGIQPAVIQSIAKQVKEVAELDVEIAIVVGGGNIWRG-
PYRH_CHLFF      ----------------------SGESLSTDSGNRIDEVRLSRLVAELRAVRNCDIETALVIGGGNIIRGL
PYRH_BARQU      ----------------------SGEALMGGQSFGIDVFVADRIATDIAEVRAMGVEVAIVIGGGNIFRGA
PYRH_PSYWF      ----------------------SGEALAGGLGMGIDTSVLDKMSLAIAHLCXXXXXXXXXXXXXNLYRGS
PYRH_PSEA6      ----------------------SGEALMGEEGFGIDPKVLERMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_LACPL      ----------------------SGEALAGEKGFGINPPVIKTVAEELKDVYDMGVQIAIVVGGGNMWRG-
PYRH_CHLCV      ----------------------SGESLSTDSGNRIDEVRLSRLVSELRAVRNSDIETALVIGGGNILRGL
PYRH_LACRD      ----------------------SGEALAGDKGFGINPPVLKDVAKELKEVHDLGVQIAIVVGGGNMWRGV
PYRH_ENTFA      ----------------------SGEALAGEDGFGIKPPVIKEIVQEIKEVHELGIEMAIVVGGGNIWRGQ
PYRH_RICFE      ----------------------SGEALMGDKQFGHEYEVIKKIAGDIKEVIDLGVEVAIVVGGGNIYRGI
PYRH_AZOSB      ----------------------SGEALMGDDAYGINEDVVSRIVSEIAEVTRLXXXXXXXXXXXNIFRGM
PYRH_SHEB8      ----------------------SGEALMGDEGFGIDPKVLDRMAQEVKXXXXXXXXXXXXXXXXNLFRGG
PYRH_SHEB5      ----------------------SGEALMGDEGFGIDPKVLDRMAQEVKXXXXXXXXXXXXXXXXNLFRGG
PYRH_SILPO      ----------------------SGEALMGDQGFGLHPPTVKRIAHEIKTVHDMGVEICMVIGGGNIFRG-
PYRH_PSYCK      ----------------------SGEALAGTKDMGIDTEVLDKMSLSIAHLRXXXXXXXXXXXXXNLYRGA
PYRH_PSYA2      ----------------------SGEALAGTKDMGIDTEVLDKMSLSIAHLRXXXXXXXXXXXXXNLYRGA
PYRH_LAWIP      ----------------------SGESLAGRQLTGIDPDTVAVLCNELSSVIELGLQIALVIGGGNIFRGL
PYRH_SILST      ----------------------SGEALMGTQGFGLHPPTVRRIAEEVKSVHDLGVEICMVIGGGNIFRG-
PYRH_RHOP5      ----------------------SGEYFAGDQSFGIHQPTIDRIAGDLIAAQQLGVEIAVVIGGGNIFRGV
PYRH_METFK      ----------------------SGEALMGDDSYGINRATISRIVEEIKEXXXXXXXXXXXIGGGNIFRGV
PYRH_HAEDU      ----------------------SGEALQGDEGFGIDPSILDRMALEIKXXXXXXXXXXXXXXXXXXFRGA
PYRH_SPHAL      ----------------------SGEALMGPSPFGIDPETVASMAAEVKEAKDRGLEICLVIGGGNIFRG-
PYRH_GRABC      ----------------------SGEALMGSREYGLDKAMVQTIASDIADVVAFGVEVCLVIGGGNIFRGV
PYRH_THEFY      ----------------------SGEAFAGEEQLGISPKVVGYIAQAIAEAVAKGIQVAVVIGGGNMFRGA
PYRH_WOLTR      ----------------------SGEALMGSRPFGHDMELIDQLCKDISDIYKLGVQVCIVVGGGNIFRGA
PYRH_VIBF1      ----------------------SGEALQGEEGFGIDPATLDRMAQEVKELIELXXXXXXXXXXXNLFRGG
PYRH_RICCN      ----------------------SGEALMGDKQFGHEYDVIKKIAIDIKEVIDLGVEVAIVVGGGNIYRGI
PYRH_LACBA      ----------------------SGEALAGDKGFGINPPVIKTVAEEVKDVYNLGIQIAIVVGGGNMWRG-
PYRH_BUCAI      ----------------------SGEVLQGVNKFGIDINSLKRIAKEIEFIVKIGVQVGLVIGSGNLFRGA
PYRH_SHESW      ----------------------SGEALMGDEGFGIDPKVLDRMAQEVKXXXXXXXXXXXXXXXXNLFRGG
PYRH_SHEON      ----------------------SGEALMGDEGFGIDPKVLDRMAQEVKXXXXXXXXXXXXXXXXNLFRGG
PYRH_NITWN      ----------------------SGEYLAGSQPFGIDQPTIDRIAGDLAEARALGVEIAVVVGGGNIFRGV
PYRH_ERYLH      ----------------------SGEVLMGEQDYGIDPAFVMELAKEVKAAREQGLQICLVIGGGNIFRG-
PYRH_SODGM      ----------------------SGEALQGAEGFGIDASVLDRMAQEVKXXXXXXXXXXXXXXXXNLFRGG
PYRH_LACLS      ----------------------SGEALSGEKGFGFDPETAKAVAEELKEVHDLGAELAIVCGGGNVWRGV
PYRH_LACLM      ----------------------SGEALSGEKGFGFDPETAKAVAEELKEVHDLGAELAIVCGGGNVWRGV
PYRH_LACLA      ----------------------SGEALSGEKGFGFDPETAKAVAEELKEVHDLGAELAIVCGGGNVWRGV
PYRH_FERNB      ----------------------SGEVLSGEDQKGFNEEHVEYLIKEIKGISEYGTKLGIVIGAGNIFRG-
PYRH_CHLAB      ----------------------SGESLSTDSGNRIDEVRLSRLVAELRAVRNCDIETALVIGGGNILRGL
PYRH_SPHWW      ----------------------SGEVLMGQGQFGIDPETVARVAREIADVATH-YELCLVVGGGNIFRG-
PYRH_NOVAD      ----------------------SGEVLMGEQQFGIDTDYVARVAQEVKDARDSGLEICLVIGGGNIFRG-
PYRH_WOLPM      ----------------------SGEALMGSKQFGHDMEAIGELSKGIVEVCNLGVQVCIVVGGGNIFRGT
PYRH_THEEB      ----------------------SGEALMGNLNYGIDPKVVQSFASEIAQVVQAGVQTAIVVGGGNIFRGM
PYRH_RICTY      ----------------------SGEALMGNKQFGHEYEVIKKIAEDIKEVIDLGLEVAIVVGGGNIYRGI
PYRH_NITHX      ----------------------SGEYLAGSQPFGIDQPTVDRIAGDLASARALGTEIAVVVGGGNIFRGV
PYRH_HAEIG      ----------------------SGEALQGEDGLGIDPAILDRMAVEIKXXXXXXXXXXXXXXXXXXFRGA
PYRH_HAEI8      ----------------------SGEALQGEDGLGIDPAILDRMAVEIKXXXXXXXXXXXXXXXXXXFRGA
PYRH_CAMC5      ----------------------SGEALAGDSGFGIDTAILKFIADEIKELVTNGTEXXXXXXXXXXXXXX
PYRH_VESOH      ----------------------SGEALASTTNI-IDPVTLNKIVDIIKSVLSQNIEIAIVIGGGNIFRGE
PYRH_SHESR      ----------------------SGEALMGDEGFGIDPKVLDRMAQEVKXXXXXXXXXXXXXXXXNLFRGG
PYRH_SHESM      ----------------------SGEALMGDEGFGIDPKVLDRMAQEVKXXXXXXXXXXXXXXXXNLFRGG
PYRH_SHEPC      ----------------------SGEALMGEEGFGIDPKVLDRMAQEVKXXXXXXXXXXXXXXXXNLFRGG
PYRH_HYPNA      ----------------------SGEALMGGGQFGIDIPTCEQFXXXXXXXXXXXXXXCLVIGGGNIFRGV
PYRH_SHESA      ----------------------SGEALMGDEGFGIDPKVLDRMAQEVKXXXXXXXXXXXXXXXXNLFRGG
PYRH_CHRVO      ----------------------SGEALMGDDSYGINRTTIEQIVGQIKXXXXXXXXXXXXXXXXNIFRGV
PYRH_THEM4      ----------------------SGEVLSGEGEKGFNHENIIYLVDELKKILEYGTNVGIVIGAGNLFRGR
PYRH_RICPR      ----------------------SGEALMGNKQFGHEYEVIKKIAEDIKEVIDLGLEVAIVVGGGNIYRGI
PYRH_LEGPA      ----------------------SGEALMGKSQFGIDPSVLDSLARDIAELIHMXXXXXXXXXXXXXFRG-
PYRH_LACRE      ----------------------SGEALAGEKGFGINPPVLKDVAKELKEVHELGVQIAIVVGGGNMWRGV
PYRH_LACJO      ----------------------SGEALAGEKGTGINPEVIKHLAEEIKSVHDMGVEIGIVCGGGNMWRGE
PYRH_LACGA      ----------------------SGEALAGEKGTGINPEVIKHLAEEIKSVHDMGVEIGIVCGGGNMWRGE
PYRH_LEGPH      ----------------------SGEALMGKSQFGIDPSVLDSLARDIAELIHMXXXXXXXXXXXXXFRG-
PYRH_LEGPC      ----------------------SGEALMGKSQFGIDPSVLDSLARDIAELIHMXXXXXXXXXXXXXFRG-
PYRH_KLEP7      ----------------------SGEALQGSEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_BACA2      ----------------------SGEALAGEQGNGINPTVIQSIAKQVKEIAELDVEVAVVVGGGNLWRG-
PYRH_SALTY      ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_SALTI      ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_SALPA      ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_SALCH      ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_RICCK      ----------------------SGEALMGDKQFGHEYDVIKKIAGDIKEVIDLGVEVTIVVGGGNIYRGI
PYRH_PSYIN      ----------------------SGEALVGEEGFGIDPKVLDRMALEIKSLIEXXXXXXXXXXXXNIFRGG
PYRH_LEUMM      ----------------------SGEALAGDKGQGIDLETVSAIAEELKDVHDLGTQIAIVVGGGNLWRGE
PYRH_HAEIE      ----------------------SGEALQGEDGLGIDPAILDRMAVEIKXXXXXXXXXXXXXXXXXXFRGA
PYRH_CLOTE      ----------------------SGEALAGENGYGLDFKVVKRISKEIKELVDMGVEIGAVVGGGNIWRGR
PYRH_CHLPN      ----------------------SGEALSKDSSNRIDEMRLSRLVSELRAVRNNDIEIALVIGGGNILRGL
PYRH_ALCBS      ----------------------SGEALAGEEGFGIDPKVLDAISLEXXXXXXXXXXXXXXXXXXNLFRGA
PYRH_YERE8      ----------------------SGEALQGAEGFGIDASVLDRMAQEVKXXXXXXXXXXXXXXXXNLFRGG
PYRH_SYNWW      ----------------------SGEALAGHNTYGIDNEVLNSXXXXXXXXXXXXXXXXXXXGGGNIWRGV
PYRH_SHEFN      ----------------------SGEALMGEEGFGIDPKVLDRMAQEVKXXXXXXXXXXXXXXXXNLFRGG
PYRH_SERP5      ----------------------SGEALQGAEGFGIDASVLDRMAQEVKXXXXXXXXXXXXXXXXNLFRGG
PYRH_RUTMC      ----------------------SGEALANTENI-IDPVALNKVVNIIKSVLSQNVEIAIVVGGGNIFRGA
PYRH_SYNJA      ----------------------SGEALMGERPYGIDPEVLQSIASEVASXXXXXXXXXXXXXXXNIWRGR
PYRH_PHOPR      ----------------------SGEALQGSEGFGIDAKVLDRMAQXXXXXXXXXXXXXXXXXXXNLFRGG
PYRH_OCEIH      ----------------------SGEALSGDQGYGIDPKVIQSISKQVKEVADLGVEVAIVVGGGNIWR-G
PYRH_DESDG      ----------------------SGEALAGDKKFGIDPETVSNICREIAEVLEMGLQVSLVIGGGNIFRG-
PYRH_ANAMM      ----------------------SGEAFVGEKRFGFDPAVVLRLSRDLKNVKESGVELCIVVGGGNIFRGA
PYRH_ACTSZ      ----------------------SGEALQGAEGFGIDPSILDRMALEIKELIAMXXXXXXXXXXXNLFRGA
PYRH_SHISS      ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_SHIFL      ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_SHIF8      ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_SHIBS      ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_LEGPL      ----------------------SGEALMGKSQFGIDPSVLDSLARDIAELIHMXXXXXXXXXXXXXFRG-
PYRH_HAHCH      ----------------------SGEALMGEENFGIDPKVLNRMALEXXXXXXXXXXXXXXXXXXNLFRG-
PYRH_HAES1      ----------------------SGEALQGDEGFGIDPSILDRMALEIKXXXXXXXXXXXXXXXXNLFRGA
PYRH_ENTS8      ----------------------SGEALQGAEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_ECOUT      ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_ECOLI      ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_ECOL6      ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_ECOL5      ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_ECOK1      ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_ECOHS      ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_ECO57      ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_ECO24      ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_SHEAM      ----------------------SGEALMGSEGFGIDPSVLDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_MYCPU      ----------------------SGEGLAKEKNLAIDYKLVEDIAKQLKEVVKKGIEVAIVVGGGNFWRGT
PYRH_DECAR      ----------------------SGEALMGSDAYGINPQTIAAICGEIKAVADMXXXXXXXXXXXXXFRG-
PYRH_BACLD      ----------------------SGEALAGEQGNGINPTVIQSIAKQVKEIAELDVEVAVVVGGGNLWRG-
PYRH_AQUAE      ----------------------SGEAFAGEQGYGIDPAFLEYISHEIKNVYDLGVQVAIVIGGGNIFRG-
PYRH_THETN      ----------------------SGEALAGDKEFGIDFNVVNRIADEIKEVRDXXXXXXXXXXXXNIWRGR
PYRH_SHIDS      ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_SHEDO      ----------------------SGEALMGEEGFGIDPKVLDRMAQEVKXXXXXXXXXXXXXXXXNLFRGG
PYRH_NITSB      ----------------------SGEALANEDGHGINSKTLKYIASEIKPLXXXXXXXXXXXXXXXXXXXX
PYRH_EHRRW      ----------------------SGEALMGDKGFGWDIETIDNLSHDLKEVHDXXXXXXXXXXXXNIFRGA
PYRH_EHRRG      ----------------------SGEALMGDKGFGWDIETIDNLSHDLKEVHDXXXXXXXXXXXXNIFRGA
PYRH_ACICJ      ----------------------SGEALMGRRDYGLXXXXXXXXXXXXXXXXXMRVEVCLVIGGGNIFRGI
PYRH_YERPS      ----------------------SGEALQGAEGFGIDASVLDRMAQEVKXXXXXXXXXXXXXXXXNLFRGG
PYRH_YERPP      ----------------------SGEALQGAEGFGIDASVLDRMAQEVKXXXXXXXXXXXXXXXXNLFRGG
PYRH_YERPN      ----------------------SGEALQGAEGFGIDASVLDRMAQEVKXXXXXXXXXXXXXXXXNLFRGG
PYRH_YERPE      ----------------------SGEALQGAEGFGIDASVLDRMAQEVKXXXXXXXXXXXXXXXXNLFRGG
PYRH_YERPA      ----------------------SGEALQGAEGFGIDASVLDRMAQEVKXXXXXXXXXXXXXXXXNLFRGG
PYRH_YERP3      ----------------------SGEALQGAEGFGIDASVLDRMAQEVKXXXXXXXXXXXXXXXXNLFRGG
PYRH_SYNJB      ----------------------SGEALMGERPYGIDPEVLKSIAGEVASXXXXXXXXXXXXXXXNIWRGR
PYRH_STRSV      ----------------------SGEALAGEKGVGIDIQTVQKMAEEIKEVHDLGVQIALVIGGGNLWRGE
PYRH_PEDPA      ----------------------SGEALAGDKGTGINPPVIQKVAEELRDVHDLGVQIAIVVGGGNMWRG-
PYRH_DESVV      ----------------------SGEALAGENKFGIDPATVSKICHEIADVVDMGLQVALVIGGGNIFRG-
PYRH_DESVH      ----------------------SGEALAGENKFGIDPATVSKICHEIADVVDMGLQVALVIGGGNIFRG-
PYRH_CITK8      ----------------------SGEALQGSEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_BDEBA      ----------------------SGEALAGKQGTGINTATITQIAQDVAAAYKAGVQIGLVIGGGNIYRGV
PYRH_RHOPA      ----------------------SGEYFAGPQDYGIDQATIDRVAGELIAARSLGIEIAVVIGGGNIFRGV
PYRH_PSEHT      ----------------------SGEALMGDEGFGIDPKVLDRMAQEIKXXXXXXXXXXXXXXXXNFLRGG
PYRH_AZOSE      ----------------------SGEALMGDDSYGINEDVVSRIVAEIAEVNRLXXXXXXXXXXXNIFRGM
PYRH_PHOLL      ----------------------SGEALQGAEGFGIDASVLDRMAQXXXXXXXXXXXXXXXXXXXNLFRGG
PYRH_LACAC      ----------------------SGEALAGDKGNGINPTVIGHLANEIKSVHDLGVEIGIVCGGGNMWRGE
PYRH_DICNV      ----------------------SGEALMGNQAFGLDPKVVNRIADEVRQLHEXXXXXXXXXXXXNLFRGA
PYRH_BACCR      ----------------------SGEALAGEQGFGINPTVIKSVAEQVKEIAELDVEVAVVVGGGNIWRG-
PYRH_BACAN      ----------------------SGEALAGEQGFGINPAVIKSVAEQVKEIAELDVEVAVVVGGGNIWRG-
PYRH_SHELP      ----------------------SGEALMGEEGFGIDPKVLDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_HELHP      ----------------------SGEALSGNSGFGIDVKILEYIAGEIKSLVDNQXXXXXXXXXXXXXXXX
PYRH_STRMU      ----------------------SGEALAGEKGVGIDIPTVQTIAQEIKEVHDSGIEIALVIGGGNLWRGE
PYRH_CHRSD      ----------------------SGEALIGEHEFGIDPKVLDRMALEXXXXXXXXXXXXXXXXXXNLFRGA
PYRH_AZOC5      ----------------------SGEALMGSEPFGLHPPTVARIARELVAARELGCEVAVVVGGGNILRGA
PYRH_AERS4      ----------------------SGEALQGSEGFGIDPAVLERMAQEIKEXXXXXXXXXXXXXXXXXFRGG
PYRH_STRTD      ----------------------SGEALAGEKGVGIDLPTVQAIAKEIAEVADSGIQIALVIGGGNLWRGE
PYRH_STRT1      ----------------------SGEALAGEKGVGIDLPTVQAIAKEIAEVADSGIQIALVIGGGNLWRGE
PYRH_MOOTA      ----------------------SGEALAGNQGFGIDQEVITSIASQIKEVRELGVDVAIVVGGGNIWRGV
PYRH_ERWCT      ----------------------SGEALQGTEGFGIDASILDRMAQEVKXXXXXXXXXXXXXXXXNLFRGG
PYRH_NEOSM      ----------------------SGERLAAR---GVSVHDAEVIARGIKRVHEMGIQVCLVIGGGNIYRGS
PYRH_VIBCH      ----------------------SGEALQGSEGFGIDPTVLDRMAQXXXXXXXXXXXXXXXXXXXXXFRGG
PYRH_VIBC3      ----------------------SGEALQGSEGFGIDPTVLDRMAQXXXXXXXXXXXXXXXXXXXXXFRGG
PYRH_ENT38      ----------------------SGEALQGTEGFGIDASILDRMAQEIKXXXXXXXXXXXXXXXXNLFRGG
PYRH_WOLSU      ----------------------SGEALAGENGFGIDTKILGFIASEIRSLXXXXXXXXXXXXXXXXXXXX
PYRH_VIBVY      ----------------------SGEALQGSEGFGIDPTVLDRMAQXXXXXXXXXXXXXXXXXXXXXFRGG
PYRH_VIBVU      ----------------------SGEALQGSEGFGIDPTVLDRMAQXXXXXXXXXXXXXXXXXXXXXFRGG
PYRH_VIBHB      ----------------------SGEALQGEEGFGIDPAVLDRMAQXXXXXXXXXXXXXXXXXXXXXFRGG
PYRH_RICRS      ----------------------SGEALMGDKQFGHEYXXXXXXXXXXXEVIALGVEVAIVVGGGNIYRGI
PYRH_PSEMY      ----------------------SGEALMGSEDFGIDPKVLDRMALEXXXXXXXXXXXXXXXXXXNLFRGA
PYRH_STRT2      ----------------------SGEALAGEKGVGIDLPTVQAIAKEIAEVADSGIQIALVIGGGNLWRGE
PYRH_STRCO      MSSTKAEKSDDGKVSGRFMLKLSGEAFSXXXXXXVDPDVVHAIAREIAAVVRDGAQIAIVIGGGNFFRGA
PYRH_NITOC      ----------------------SGEALIGEVGYGIDPKVVQQIALELQELNRXXXXXXXXXXXXXXFRGG
PYRH_PELCD      ----------------------SGEALAGNQGFGIDPQVISGIAEEIREVIGLGVQVAVVIGGGNIFXXX
PYRH_PASMU      ----------------------SGEALQGDEGFGIDPSILDRMALEIKXXXXXXXXXXXXXXXXNLFRGA
PYRH_CAMHC      ----------------------SGEALAGDSGFGIDSTILKFIANEIKSLVDMXXXXXXXXXXXXXXXXX
PYRH_VIBPA      ----------------------SGEALQGEDGFGIDPAILDRMAQXXXXXXXXXXXXXXXXXXXXXFRGG
PYRH_HELPY      ----------------------SGEALAGDNQFGIDIHVLDHIAKEIKSLXXXXXXXXXXXXXXXXXXXX
PYRH_HELPH      ----------------------SGEALAGDNQFGIDIHVLDHIAKEIKSLXXXXXXXXXXXXXXXXXXXX
PYRH_CALS8      ----------------------SGEALGGEKGFGIDWEVVESIAEEISKVRELGVEVAIVVGGGNFFRGR
PYRH_STRAW      ----------------------SGEAFSXXXXXXVDPDVVHAIAREIAAVVRDGSEIAVVIGGGNFFRGA
PYRH_SOLUE      ----------------------SGEALAGAATFGIDADRVRSLGREVADVAASGIQXXXXXXXXNIFRGV
PYRH_GLUOX      ----------------------SGEALMGDGPSGXXXXXXXXXXXXXXXXXXSGVEVCLVVGGGNIFRG-
PYRH_ACIC1      ------------------------------------------IARQIAAVVAEGVQMAVVIGGGNFFRGA
PYRH_STAS1      ----------------------SGEALAGDDGFGINPIIIKSIAEQVAEVAKLDCEIAVIVGGGNIWRG-
PYRH_PSEU5      ----------------------SGEALMGSEDFGIDPKVLDRMAXXXXXXXXXXXXXXXXXXXXNLFRGA
PYRH_HELPJ      ----------------------SGEALAGDNQFGIDIHVLDHIAKEIRSLXXXXXXXXXXXXXXXXXXXX
PYRH_HELAH      ----------------------SGEALAGDNQFGIDIHVLDHIAKEIRSLXXXXXXXXXXXXXXXXXXXX
PYRH_SULNB      ----------------------SGEALAGKEGYGIDTKILKFIASEIKALVDAGMEXXXXXXXXXXXXXX
PYRH_CHLTR      ----------------------SGEALSGDSSNRISEERLSRLIAELKVVRNADVEVALVIGGGNILRGL
PYRH_STAAW      ----------------------SGEALAGEKGFGINPVIIKSVAEQVAEVAKMDCEIAVIVGGGNIWRG-
PYRH_STAAS      ----------------------SGEALAGEKGFGINPVIIKSVAEQVAEVAKMDCEIAVIVGGGNIWRG-
PYRH_STAAR      ----------------------SGEALAGEKGFGINPVIIKSVAEQVAEVAKMDCEIAVIVGGGNIWRG-
PYRH_STAAN      ----------------------SGEALAGEKGFGINPVIIKSVAEQVAEVAKMDCEIAVIVGGGNIWRG-
PYRH_STAAM      ----------------------SGEALAGEKGFGINPVIIKSVAEQVAEVAKMDCEIAVIVGGGNIWRG-
PYRH_STAAC      ----------------------SGEALAGEKGFGINPVIIKSVAEQVAEVAKMDCEIAVIVGGGNIWRG-
PYRH_STAAB      ----------------------SGEALAGEKGFGINPVIIKSVAEQVAEVAKMDCEIAVIVGGGNIWRG-
PYRH_STAA8      ----------------------SGEALAGEKGFGINPVIIKSVAEQVAEVAKMDCEIAVIVGGGNIWRG-
PYRH_STAA3      ----------------------SGEALAGEKGFGINPVIIKSVAEQVAEVAKMDCEIAVIVGGGNIWRG-
PYRH_STAA1      ----------------------SGEALAGEKGFGINPVIIKSVAEQVAEVAKMDCEIAVIVGGGNIWRG-
PYRH_CHLTA      ----------------------SGEALSGDSSNRISEERLSRLIAELKVVRNADVEVALVIGGGNILRGL
PYRH_STAAE      ----------------------SGEALAGEKGFGINPVIIKSVAEQVAEVAKMDCEIAVIVGGGNIWRG-
PYRH_RHOPB      ----------------------SGEYFAGDQSFGIDQPTIDRIAGDLIAAQKLGVEIAVVVGGGNIFRGV
PYRH_PSEAE      ----------------------SGEALMGSEEFGIDPKVLDRMALEXXXXXXXXXXXXXXXXXXNLFRGA
PYRH_PSEAB      ----------------------SGEALMGSEEFGIDPKVLDRMALEXXXXXXXXXXXXXXXXXXNLFRGA
PYRH_STAES      ----------------------SGEALAGDKGFGINPIIIKSVAQQVAEVAKMDCEIAVIVGGGNIWRG-
PYRH_STAEQ      ----------------------SGEALAGDKGFGINPIIIKSVAQQVAEVAKMDCEIAVIVGGGNIWRG-
PYRH_CLOD6      ----------------------SGEALAGERGFGINNDVVNDIAIAIKKIQEIXXXXXXXXXXXNFWRG-
PYRH_SYNAS      ----------------------SGEALGGHRSSSIDPEMVNAIAAEIKEXXXXXXXXXXXXXXXXIFRGV
PYRH_STAHJ      ----------------------SGEALAGDKGFGINPIIIKSVAQQVAEVAKMDCEIAVIVGGGNIWRG-
PYRH_PSEA7      ----------------------SGEALMGSEEFGIDPKVLDRMALEXXXXXXXXXXXXXXXXXXNLFRGA
PYRH_CORJK      ---------------------------------GIDPDVVQNVARQIAEVSKSGVEVAVVIGGGNFFRGA
PYRH_AERHH      ----------------------SGEALQGSEGFGIDPAVLDRMAQEIKEXXXXXXXXXXXXXXXXXFRGG
PYRH_PSEU2      ----------------------SGEALMGSEEFGIDPKVLDRMALEXXXXXXXXXXXXXXXXXXNLFRGA
PYRH_PSEPK      ----------------------SGEALMGSEDFGIDPKVLDRMALEXXXXXXXXXXXXXXXXXXNLFRGA
PYRH_PSEP1      ----------------------SGEALMGSEDFGIDPKVLDRMALEXXXXXXXXXXXXXXXXXXNLFRGA
PYRH_BRASO      ----------------------SGEYLAGPHSFGIDQPTVDRIADDLIAVQKLGIEIAXXXXXXXXXXXX
PYRH_ALKMQ      ----------------------SGEALAGEKGFGLDTDTINDIAHQISEITDMGVQVAIVVGGGNFWRG-
PYRH_PSESM      ----------------------SGEALMGSEEFGIDPKVLDRMALEXXXXXXXXXXXXXXXXXXNLFRGA
PYRH_PSEE4      ----------------------SGEALMGSEDFGIDPKVLDRMALEXXXXXXXXXXXXXXXXXXNLFRGA
PYRH_PSE14      ----------------------SGEALMGSEEFGIDPKVLDRMALEXXXXXXXXXXXXXXXXXXNLFRGA
PYRH_MYCSS      ---------------------------------GLDPDVVHLVARQIAEVVRSGVQVAVVIGGGNFFRGA
PYRH_MYCSK      ---------------------------------GLDPDVVHLVARQIAEVVRSGVQVAVVIGGGNFFRGA
PYRH_MYCSJ      ---------------------------------GLDPDVVHLVARQIAEVVRSGVQVAVVIGGGNFFRGA
PYRH_CAMC1      ----------------------SGEALAGENGFGIDTAVLKFIASEIKELXXXXXXXXXXXXXXXXXXXX
PYRH_FRAAA      ----------------------SGRAIAGSAEFGFDSNALEHLAREIIAVRQSGVEVAIVVGGGNLFRGN
PYRH_CORDI      ---------------------------------GIDPDVVQNVARQIASVARTGAEIAVVIGGGNFFRGA
PYRH_BAUCH      ----------------------SGEALQGKNNFGIDTNALNRIVQEIKEXXXXXXXXXXXXXXXXXXRGT
PYRH_PSEF5      ----------------------SGEALMGSEEFGIDPKVLDRMALEXXXXXXXXXXXXXXXXXXNLFRGA
PYRH_PARUW      ----------------------SGETLIGNQGFGIQQQACLQITKSXXXXXXXXXXXXXXXXXXNIFRGI
PYRH_NEIMF      ----------------------SGESLMGSDPFGINHDTIVQTVGEIAEXXXXXXXXXXXXXXXXXXXXX
PYRH_LACS1      ----------------------SGEALAGDQGKGINPPEILKVAEEIKEVHDLGVQIAIVVGGGNMWRG-
PYRH_COREF      ---------------------------------GIDPDVVDNVARQIAEVAKSGAEIAVVIGGGNFFRGA
PYRH_BARHE      ----------------------SGEALMGGQSFGIDVSVADRIAADXXXXXXXXXXXXXXXXXXNIFRGA
PYRH_MARAV      ----------------------SGEALMGEHDFGIDPKVLDRMALEXXXXXXXXXXXXXXXXXXXXFRGA
PYRH_LACDB      ----------------------SGEALAGEKGTGIDPTVIKKLAHEIKLVHDMGVQIGVVCGGGNMWRGE
PYRH_LACDA      ----------------------SGEALAGEKGTGIDPTVIKKLAHEIKLVHDMGVQIGVVCGGGNMWRGE
PYRH_IDILO      ----------------------SGEALMGDEPFGIDAKVLDRMAQEIKEXXXXXXXXXXXXXXXXXFRGG
PYRH_BRASB      ----------------------SGEYLAGPHSFGIDQATVDRIADDLIAAQKLGIEIAXXXXXXXXXXXX
PYRH_SACD2      ----------------------SGEQLMGDEGFGIDPKVLDKMALEXXXXXXXXXXXXXXXXXXNLFRGA
PYRH_NEIG1      ----------------------SGESLMGSDPFGINHDTIVQTVGEIAEXXXXXXXXXXXXXXXXXXXXX
PYRH_RICAH      ----------------------SGEALMGDKQFGHEYEVIKKISSDIKEVIDLGVEVAIVVGGGNIYRGI
PYRH_PSEPF      ----------------------SGEALMGSEEFGIDPKVLDRMALEXXXXXXXXXXXXXXXXXXNLFRGE
PYRH_CAMJR      ----------------------SGEALAGENGFGIENSILKFIASEIKELIKNQXXXXXXXXXXXXXXXX
PYRH_CAMJJ      ----------------------SGEALAGENGFGIENSILKFIASEIKELIKNQXXXXXXXXXXXXXXXX
PYRH_CAMJE      ----------------------SGEALAGENGFGIENSILKFIASEIKELIKNQXXXXXXXXXXXXXXXX
PYRH_CAMJ8      ----------------------SGEALAGENGFGIENSILKFIASEIKELIKNQXXXXXXXXXXXXXXXX
PYRH_NEIMB      ----------------------SGESLMGSDPFGINHDTIVQTVGEIAEXXXXXXXXXXXXXXXXXXXXX
PYRH_NEIMA      ----------------------SGESLMGSDPFGINHDTIVQTVGEIAEXXXXXXXXXXXXXXXXXXXXX
PYRH_MYCVP      -----------------------GEMFGGGQ-VGLDPDVVAQVARQIAEVVRSGAQVAVVIGGGNFFRGA
PYRH_SYMTH      ----------------------SGEALAGAKGFGLDPQVLTALARQIKAVHDMGVQVAIVVGAGNFWRG-
PYRH_MYCS2      -----------------------GEMFGGGQ-VGLDPDVVAQVARQIAEVVRSGAQVAVVIGGGNFFRGA
PYRH_OENOB      ----------------------SGEALAGPGGSGIDLTTVKRVANELAEIKRAQVQIAIVNGGGNLWRGE
PYRH_GEOKA      ----------------------SGEALAGKQGFGIQPAVIQSIAKQVKXXXXXXXXXXXXXXXXNIWRG-
PYRH_CAMJD      ----------------------SGEALAGENGFGIENSILKFIASEIKELIKNQXXXXXXXXXXXXXXXX
PYRH_RHOSR      ---------------------------------GLDPDVVTKVAEQIAEVVRSGVQVAVVIGGGNFFRGA
PYRH_RHILO      ----------------------SGEALMGEQHFGIDVSVVDRIAADIEARXXXXXXXXXXXXXXXXXXXA
PYRH_CORGL      ------------------------------------------VARQIAEVAKTGAEIAVVIGGGNFFRGA
PYRH_CORGB      ------------------------------------------VARQIAEVAKTGAEIAVVIGGGNFFRGA
PYRH_CAMFF      ----------------------SGEALAGGNGFGIDTHILKYIAGEIKXXXXXXXXXXXXXXXXXXXRGV
PYRH_SULDN      ----------------------SGEALAGEAGYGIDTKILNFISQEIKSLXXXXXXXXXXXXXXXXXXXX
PYRH_MYCHJ      ----------------------SGESLANKQSLAIDYELVRQIGSQLKEIQNLGHKILIVIGGGNFWRGT
PYRH_MYCH7      ----------------------SGESLANKQSLAIDYELVRQIGSQLKEIQNLGHKILIVIGGGNFWRGT
PYRH_MYCH2      ----------------------SGESLANKQSLAIDYELVRQIGSQLKEIQNLGHKILIVIGGGNFWRGT
PYRH_BUCBP      ----------------------SGEALQGVHKFGIDIIELNRIAKEIKAIFDLXXXXXXXXXXXXXFRGK
PYRH_BACSU      ----------------------SGEALAGEQGNGINPTVIQSIAKQXXXXXXXXXXXXXXXGGGNLWRG-
PYRH_RHOPS      ----------------------SGEYFAGPQSYGIDQSTIDRVAGDLIAARGLGVEIAVVVGGGNIFRGV
PYRH_RUBXD      ----------------------SGESLAGNGGYGIDPGSLEVSXXXXXXXXXXXXXXXXXXXXXNIFRGA
PYRH_RHOP2      ----------------------SGEYFAGPQHYGIDQPTIDRVAGDLIAARGLGVEIAVVVGGGNIFRGV
PYRH_PARD8      ----------------------SGESLMGGKQYGIDEVRLNEYAAQIKEIAEMXXXXXXXXXXXXXFRG-
PYRH_FRASC      ----------------------SGRAIAGSAEFGFDSNALEHLAREIIAVRQSGVEVAIVVGGGNLFRGN
PYRH_BLOPB      ----------------------SGEALQGAEGFGIDTTILNRMVTEVKELVKXXXXXXXXXXXXNLFRGA
PYRH_ACIBL      ----------------------SGEALAGEQGFGVDPTRVHEIAAEIAEVHRLXXXXXXXXXXXXXXXXX
PYRH_RHIEC      ----------------------SGEALMGAQGFGIDVTVADRIASDIAEARHMXXXXXXXXXXXNIFRGA
PYRH_CHLMU      ----------------------SGEALSASSSDKISEERLSRLIAELKXXXXXXXXXXXXIGGGNILRGL
PYRH_ROSS1      ----------------------SGEALAGKGTHSIDPNMLDYYAEEIERVHRHGVQVAVVLGGGNIWRGN
PYRH_BRAJA      ----------------------SGEYLAGQQGFGIDQPTVDRVADDLIAARHLGTXXXXXXXXXXXXXXX
PYRH_BACHD      ----------------------SGEALAGEQGYGIDPEVIQSIASQIKXXXXXXXXXXXXXXXXNIWRG-
PYRH_SACEN      ---------------------------------GIDPDVVGTVARQIAEVVADGVEVAIVIGGGNFFRGA
PYRH_ARCB4      ----------------------SGEALAGAEGYGIDTKILDYIAEEIKSLXXXXXXXXXXXXXXXXXXXX
PYRH_MYCCT      ----------------------SGEALKGDAEV-YDKKCLEDIASQIIHLVKNGLKLGIVIGGGNIWRGK
PYRH_PORGI      ----------------------SGESLMGAQQYGIDPNRLADYASDIKAMXXXXXXXXXXXXXXXXXSGA
PYRH_SALRD      ----------------------SGQALLGDREFGIDEAVLRTYANEVKTXXXXXXXXXXXXXXXNIFRGV
PYRH_STRGC      ----------------------SGEALAGDKGVGINIQTVQKMAEEIKEVHDLGIEIALVIGGGNLWRGE
PYRH_DESHY      ----------------------SGEALAGSQGFGIAHEMLVTVAEQVVEIQKXXXXXXXXXXXXNIWRG-
PYRH_BLOFL      ----------------------SGEALQGTENFGVDSSILDRMVLEIKELVNXXXXXXXXXXXXNLFRGS
PYRH_MESSB      ----------------------------------------------------------------------
PYRH_LACH4      ----------------------SGEALAGDKGNGINPTVIGHLAKEIKSVYDLXXXXXXXXXXXNMWRGE
PYRH_STRPN      ----------------------SGEALAGERGVGIDIQTVQTIAKEIQEVHSLGIEIALVIGGGNLWRGE
PYRH_THELT      ----------------------SGEVMCGEGSRGFDQSNINYLVQQIAQIVDYXXXXXXXXXXXXXFRGE
PYRH_ORITB      ----------------------SGAALKGDSNTNFDIKKLKYIAQEILAIKNMGIEVVLVTGGGNIFRGN
PYRH_AGRT5      ----------------------SGEALMGDQGFGIDVAVADRIASDIAEARAMXXXXXXXXXXXNIFRGA
PYRH_MYCMO      ----------------------SGEGLSKKKSLLIDYEIVKNIAIQLQKIHKQGYEVAIVVGGGNFWRGE
PYRH_BACTN      ----------------------SGESLMGEKQYGIDEKRLAEYAAQIKEIHEXXXXXXXXXXXXNIFRGS
PYRH_THEP1      ----------------------SGEALSGEGGRGFDPERVNYIVTEIKSVVEEGFKIGIVVGAGNLFRGV
PYRH_THEMA      ----------------------SGEALSGEGGRGFDPERVNYIVNEIKSAIEEGFKIGIVVGAGNLFRGV
PYRH_STRSY      ----------------------SGEALAGERGVGIDLKTVQEMAKEIQEVAESGIQIALVIGGGNLWRGE
PYRH_STRS2      ----------------------SGEALAGERGVGIDLKTVQEMAKEIQEVAESGIQIALVIGGGNLWRGE
PYRH_STRR6      ----------------------SGEALAGERGVGIDIQTVQTIAKEIQEVHSLGIEIALVIGGGNLWRGE
PYRH_STRP2      ----------------------SGEALAGERGVGIDIQTVQTIAKEIQEVHSLGIEIALVIGGGNLWRGE
PYRH_BACFR      ----------------------SGESLMGEKQYGIDEKRLAEYAAQIKEIHEXXXXXXXXXXXXNIFRGS
PYRH_BACFN      ----------------------SGESLMGEKQYGIDEKRLAEYAAQIKEIHEXXXXXXXXXXXXNIFRGS
PYRH_ARTS2      ----------------------SGEVFGGGK-LGVDPDTVRGVAKQIAAAVP-DVEVAIVVGGGNFFRGA
PYRH_MYCS5      ----------------------SGEGFAKEKNLAIDFELVAKIASQLKIIIEKGVQVSIVVGGGNFWRGV
PYRH_AYWBP      ----------------------SGESLKGDSSYGIDPRTXXXXXXXXXXXXDLGVKIAIIVGAGNLWRG-
PYRH_LEIXX      ----------------------SGEAFGGGQ-LGVNPDIVSGIAREIAQAAT-DVEIAIVVGGGNFFRGA
PYRH_TROWT      ------------------------------------------------------IQIAIVVGGGNYFRGA
PYRH_TROW8      ------------------------------------------------------IQIAIVVGGGNYFRGA
PYRH_STRA5      ----------------------SGEALAGDKGVGIDIPTVQSIAKEIAEVHNSGVQIALVIGGGNLWRGE
PYRH_STRA1      ----------------------SGEALAGDKGVGIDIPTVQSIAKEIAEVHNSGVQIALVIGGGNLWRGE
PYRH_STRA3      ----------------------SGEALAGDKGVGIDIPTVQSIAKEIAEVHNSGVQIALVIGGGNLWRGE
PYRH_NOCSJ      ----------------------------------------QTVAREIAAVVNAGVQIAIVTGGGNFFRGA
PYRH_MYCPE      ----------------------SGASLKGKNDI-IDLDFLREIGRQIKVLSN-NYKVAIVLGGGNIWRG-
PYRH_NOCFA      ----------------------------------------------------------------------
PYRH_ONYPE      ----------------------SGESLKGESSYGIDPRTXXXXXXXXXXXXDLGVKIAIIVGAGNLWRG-
PYRH_BACV8      ----------------------SGESLMGEKQYGIDEKRLGEYAQQIKEIHDLXXXXXXXXXXXXXFRG-
PYRH_UREPA      ----------------------SGACLKQNDSSIIDFIKINDLAEQIEKISKKYI-VSIVLGGGNIWRGS
PYRH_STRPM      ----------------------SGEALAGEKGVGIDIPTVQAIAKEIAEVHVSGVQIALVIGGGNLWRGE
PYRH_STRPG      ----------------------SGEALAGEKGVGIDIPTVQAIAKEIAEVHVSGVQIALVIGGGNLWRGE
PYRH_STRPF      ----------------------SGEALAGEKGVGIDIPTVQAIAKEIAEVHVSGVQIALVIGGGNLWRGE
PYRH_STRPC      ----------------------SGEALAGEKGVGIDIPTVQAIAKEIAEVHVSGVQIALVIGGGNLWRGE
PYRH_STRPB      ----------------------SGEALAGEKGVGIDIPTVQAIAKEIAEVHVSGVQIALVIGGGNLWRGE
PYRH_STRP8      ----------------------SGEALAGEKGVGIDIPTVQAIAKEIAEVHVSGVQIALVIGGGNLWRGE
PYRH_STRP6      ----------------------SGEALAGEKGVGIDIPTVQAIAKEIAEVHVSGVQIALVIGGGNLWRGE
PYRH_STRP3      ----------------------SGEALAGEKGVGIDIPTVQAIAKEIAEVHVSGVQIALVIGGGNLWRGE
PYRH_STRP1      ----------------------SGEALAGEKGVGIDIPTVQAIAKEIAEVHVSGVQIALVIGGGNLWRGE
PYRH_OCHA4      ----------------------SGEALMGSQGFGIDVSVADRIANDIKQARSLXXXXXXXXXXXXXXXXX
PYRH_BRUAB      ----------------------SGEALMGSQGFGIDVSVADRIANDIKQARALXXXXXXXXXXXXXXXXX
PYRH_STRPD      ----------------------SGEALAGEKGAGIDIPTVQAIAKEIAEVHVSGVQIALVIGGGNLWRGE
PYRH_MYCA1      ----------------------------------------------------------------NFFRGA
PYRH_MESFL      ----------------------SGEALKSENEI-YNKEKLEDIAKQIVELAKNGLKLGIVIGGGNIWRG-
PYRH_BRUSU      ----------------------SGEALMGSQGFGIDVSVADRIANDIKQARALXXXXXXXXXXXXXXXXX
PYRH_MYCPA      ----------------------------------------------------------------NFFRGA
PYRH_LISW6      ----------------------SGEALAGNDGFGINPSVVNLISAQIKXXXXXXXXXXXXXXXXNIWRG-
PYRH_LISMO      ----------------------SGEALAGNDGFGINPSVVNLISAQIKXXXXXXXXXXXXXXXXNIWRG-
PYRH_LISMF      ----------------------SGEALAGNDGFGINPSVVNLISAQIKXXXXXXXXXXXXXXXXNIWRG-
PYRH_LISIN      ----------------------SGEALAGNDGFGINPSVVNLISAQIKXXXXXXXXXXXXXXXXNIWRG-
PYRH_MYCPN      ----------------------SGAGMSADSSEPFSNQFLETVIAQLKQLVP-NYQIGIVIGGGNIMRGK
PYRH_SINMW      ----------------------SGEALMGSQGFGIDVAVADRIASDIAQARAMXXXXXXXXXXXNIFRGA
PYRH_MYCLE      ----------------------------------------------------------------NFFRGA
PYRH_RHIME      ----------------------SGEALMGSQGFGIDVAVADRIASDIAEARAMXXXXXXXXXXXNIFRGA
PYRH_MYCTU      ----------------------------------------------------------------------
PYRH_MYCTA      ----------------------------------------------------------------------
PYRH_MYCBP      ----------------------------------------------------------------------
PYRH_MYCBO      ----------------------------------------------------------------------
PYRH_BRUME      ----------------------SGEALMGSQGFGIDVSVADRIANDIKQARALXXXXXXXXXXXXXXXXX
PYRH_ARTAT      -------------------------------------------------------------GGGNFFRGA
PYRH_MYCGA      ------------------------------------------LADQLKSLAK-KYNIGLIVGGGNIFRGK
PYRH_RHIL3      ----------------------SGEALMGGQGFGIDVTVADRIASDIAEARHMXXXXXXXXXXXNIFRGA
PYRH_CLAM3      ----------------------SGESFGGGQ-MGVDPDVVSALAREIAEAAKT-VEVAIVVGGGNFFRGA
PYRH_PROAC      ----------------------------------------------------------------NFFRGA
PYRH_WIGBR      ----------------------SGECLKKGKKNLVDFDILNKITNEIKNLFNLXXXXXXXXXXXNLFRGS
PYRH_THIDA      ----------------------SGEALMGPDSFGYHAGTMAGFVGQIRDXXXXXXXXXXXXXXXNLFRGA
PYRH_BUCCC      ----------------------SGEFLSSKKTFNINTIFITKLIKQIKLLTXXXXXXXXXXXXXXLFRGS
PYRH_BIFLO      ----------------------------------------------------------------NFFRGA
PYRH_BIFAA      ----------------------SGEAFGGGK-VGIDTTVVRRIAEEIVPXXXXXXXXXXXXXXXNFFRGA
PYRH_MYCGE      -------------------------------GAGLTKENSQPIINQLKVLKESYQXXXXXXXXXXXXXXX
PYRH_METJA      ---------------------------------GAKAEKIMEYANIFKKIKDEGHEVAIVVGGGKTARE-
PYRH_META3      ---------------------------------GASVDKIKEYADVFKKMKDENNEICIVVGGGNTARTY
PYRH_METVS      ---------------------------------GASAENIKSYAQVFKKLKDMGHNVSIVVGGGNTAREY
PYRH_METM6      ---------------------------------GASTENIQNYAEAFKKLKEMGHRVSVVVGGGNTARQY
PYRH_METB6      ----------------------------------------------------------------------
PYRH_THEVO      --------------------------------------------------------IGIVTGGGKTARSY
PYRH_METM7      ---------------------------------GASTENIQNYAQAFKKLKEMGHRVSVVVGGGNTARQY
PYRH_METM5      ---------------------------------GASTENIQNYAKAFKKLKEMGHRVSVVVGGGNTARQY
PYRH_METMP      ---------------------------------GASTENIQNYAKAFKKLKEMGHRVSVVVGGGNTARQY
PYRH_METS3      -------------------------------------------------------EIFVVVGGGKPARGV
PYRH_METST      -------------------------------------EDYAKIIRQI----NEDHEIFIVVGGGRPAR--
PYRH_SULTO      -----------------------------------NIENFISLRNTIKNIVNEGHRLAIVSGGGSTARK-
PYRH_METHJ      ----------------------------------------------ISVLTRISAKLFVVVGGGGTARQY
PYRH_PICTO      ----------------------------------------------------------------------
PYRH_METTH      -------------------------------------------------------DLFVVVGGGRPARGV
PYRH_SULAC      ----------------------------------------------------------------------
PYRH_METMA      --------------------------------------------------------LLVVTGGGEAARAA
PYRH_THEAC      ----------------------------------------------------------------------
PYRH_METMJ      ----------------------------------------------------------------------
PYRH_METAC      --------------------------------------------------------LLVITGGGNYIGAA
PYRH_CENSY      ----------------------------------------------------------------------
PYRH_METS5      -----------------------------------------PLSSAIRSLVQEGHRVALVTGGGTTARKG
PYRH_HALSA      ----------------------------------------------------------------------
PYRH_HALS3      ----------------------------------------------------------------------
PYRH_METLZ      -------------------------------------EWAEALIN----LTNAGIQIFAVVGGGGEARRY
PYRH_METBU      -------------------------------------------------------QIVVVTGGGDVARGV
PYRH_STAMF      -------------------------------------------------------KLAIITGGGGLARKG
PYRH_METBF      --------------------------------------------------------LLVVAGGGEAARNA
PYRH_THEON      ----------------------------------------------------------------------
PYRH_PYRKO      ----------------------------------------------------------------------
PYRH_ARCFU      ----------------------------------------------------------------------
AK_PSEAE        ------------------------------------VERIEQVAEKVKKFREAGDDVVVVVSAMSGETNR
PYRH_THESM      ----------------------------------------------------------------------
PYRH_PYRAB      -------------------------------------------------------EIAIVVGGGKTARAS
PYRH_THEGJ      ----------------------------------------------------------------------
PYRH_HALLT      ----------------------------------------------------------------------
PYRH_HYPBU      ----------------------------------------------------------------------
PYRH_HALMA      ----------------------------------------------------------------------
PYRH_SULIY      -----------------------------------NVNNLIVLRESIRELTDNGFRVGIVTGGGSTARRY
PYRH_SULIN      -----------------------------------NVNNLIVLRESIRELTDNGFRVGIVTGGGSTARRY
PYRH_SULIM      -----------------------------------NVNNLIVLRESIRELTDNGFRVGIVTGGGSTARRY
PYRH_SULIL      -----------------------------------NVNNLIVLRESIRELTDNGFRVGIVTGGGSTARRY
PYRH_SULIK      -----------------------------------NVNNLIVLRESIRELTDNGFRVGIVTGGGSTARRY
PYRH_NATPD      ----------------------------------------------------------------------
PYRH_SULSO      -----------------------------------NVDNLIVLRQSIKELADNGFRVGIVTGGGSTARRY
PYRH_UNCMA      ----------------------------------------------------------------------
PYRH_SULIA      -----------------------------------NVNNLIVLRESIRELTYNGFRVGIVTGGGSTARRY
PYRH_METTP      -------------------------------------------------------QVYVVVGGGALARGK
PROB_NEIMA      ----------------------------------------------------------------------
PROB_NEIMF      ----------------------------------------------------------------------
PROB_NEIMB      ----------------------------------------------------------------------
PYRH_PYRCJ      -------------------------------------------------IRRIGGKVAVVTGGGEVARGG
AK_CHLPN        ----------------------------------------------------------------------
PROB_BACCR      -----------------------GSSSLADSHGGISTEQLSDHVAALARLKEDGHEVVLITSGA--VAAG
PROB_BACC4      -----------------------GSSSLADSHGGISTEQLSDHVAALARLKEDGHEVVLITSGA--VAAG
PROB_BACC2      -----------------------GSSSLADSHGGISTEQLSDHVAALARLKEEGHEVVLITSGA--VAAG
PROB_STRZT      ----------------------------------------------------------------------
PROB_STRZP      ----------------------------------------------------------------------
PROB_STRZJ      ----------------------------------------------------------------------
PROB_STRR6      ----------------------------------------------------------------------
PROB_STRPN      ----------------------------------------------------------------------
PROB_STRP7      ----------------------------------------------------------------------
PROB_STRP2      ----------------------------------------------------------------------
PROB_SILST      ----------------------------------------------------------------------
PROB_OCEIH      ----------------------------------------------------------------------
PROB_CAMJE      ----------------------------------------------------------------------
PROB_CAMJ8      ----------------------------------------------------------------------
PROB_BACSU      ----------------------------------------------------------------------
PROB_BACHK      -----------------------GSSSLADSHEGISKEQLSDHVAALARLKEEGHEVLLITSGA--VAAG
PROB_BACCZ      -----------------------GSSSLADSHEGISKEQLSDHVAALARLKEEGHEVLLITSGA--VAAG
PROB_BACCQ      -----------------------GSSSLADSHGGISKEQLSDHVAALARLKEEGHEVLLITSGA--VAAG
PROB_BACC1      -----------------------GSSSLADSHGGISKEQLSDHVAALARLKEEGHEVLLITSGA--VAAG
PROB_BACAN      -----------------------GSSSLADSHEGISKEQLSDHVAALARLKEEGHEVLLITSGA--VAAG
PYRH_THEPD      ----------------------------------------------------------------------
PROB1_BACLD     ----------------------------------------------------------------------
PROB_STRTR      ----------------------------------INLEKIDQLAFVISSLHNKGIEVVLVSSGA---MGF
PROB_STRPJ      ----------------------------------------------------------------------
PROB_ALKMQ      ----------------------------------------------------------------------
PROB_BACWK      -----------------------GSSSLADSHGGISKEQLSDHVAALARLKEEGHEVLLITSGA--VAAG
PROB_STRTD      ----------------------------------INLEKIDQLAFVISSLHNKGIEVVLVSSGANVLETR
PROB_STRT2      ----------------------------------INLEKIDQLAFVISSLHNKGIEVVLVSSGANVLETR
PROB_STRT1      ----------------------------------INLEKIDQLAFVISSLHNKGIEVVLVSSGANVLETR
PROB_MYCUA      ----------------------------------------------------------------------
PROB_MYCPA      ----------------------------------------------------------------------
PROB_MYCMM      ----------------------------------------------------------------------
PROB_MYCA1      ----------------------------------------------------------------------
PROB_DESDG      ----------------------------------------------------------------------
AK_MYCTU        ----------------------------------------------------------------------
AK_MYCBO        ----------------------------------------------------------------------
PROB_DESAD      ---------------------------------GINLGLICRLADQLATLHERGVDIVLVSSGAVAAGRN
AK_METJA        ----------------------------------------------------------------------
PYRH_HALWD      ----------------------------------------------------------------------
PROB_MYCLE      ----------------------------------------------------------------------
PROB_MYCLB      ----------------------------------------------------------------------
AK_YEAST        ----------------------------------------------------------------------
PROB_ROSDO      ----------------------------------------------------------------------
PROB_MYCTU      ----------------------------------------------------------------------
PROB_MYCTA      ----------------------------------------------------------------------
PROB_MYCBT      ----------------------------------------------------------------------
PROB_MYCBP      ----------------------------------------------------------------------
PROB_MYCBO      ----------------------------------------------------------------------
AK3_ECOLI       ----------------------------------------------------------------------
PROB_IDILO      ----------------------------------------------------------------------
RL10_LEUCK      ----------------------------------------------------------------------
PROB_RHOS4      ----------------------------------------------------------------------
PROB_LACS1      ----------------------------------------------------------------------
PROB_LACLA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RANFGNKIRRATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGLLKVASAHEFNQELAKGRVLI
PYRH_FRATW      RANFGNKIRRATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGLLKVASAHEFNQELAKGRVLI
PYRH_FRATT      RANFGNKIRRATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGLLKVASAHEFNQELAKGRVLI
PYRH_FRATN      RANFGNKIRRATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGLLKVASAHEFNQELAKGRVLI
PYRH_FRAT1      RANFGNKIRRATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGLLKVASAHEFNQELAKGRVLI
PYRH_FRATO      RANFGNKIRRATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGLLKVASAHEFNQELAKGRVLI
PYRH_FRATH      RANFGNKIRRATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGLLKVASAHEFNQELAKGRVLI
PYRH_FRATF      RANFGNKIRRATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGLLKVASAHEFNQELAKGRVLI
PYRH_HERAR      -APGAEGMDRATADYMGMLATVMNSLALADAMRQVGITARVMSAIAIEQVVEPYVRPKALQYLEEGKIVV
PYRH_CLOAB      N---GKGMDRTTADYMGMLATCINALALQDSLENMDVDTRVQTAIEMKQVAEPFIRRRAMRHLEKGRVVI
PYRH_JANMA      -APGAQGMDRATADYMGMLATVMNSLALADAMRQVGITARVMSAIAIEQVVEPYVRPKALQYLEEGKIVI
PYRH_ALHEH      LAAAG--MDRVTADHMGMLATVMNGLALQDALEHEGVYCRVMSAVKINQVCEDYIRRRAIRHLEKGRVVV
PYRH_MAGSA      -SGASSGMERAAADNMGMLATVINALSVQNALEKVGVETRVQSAIVMPTVCEAFIRRRAIRHLEKGRVVI
PYRH_BURS3      AGGAAG-MDRATADYMGMLATMMNALALQDAMRHAGIEARVQSALRMDQVVEPYIRPRAIRQLEEGRVVI
PYRH_RALEJ      AGGAAG-MDRATADYMGMLATMMNALALQDAMRHANIEGRVQSALRMDQVVEPYIRPRAIRQLEEGKVVI
PYRH_METPP      -AGGAVGMDRATADYMGMLATVMNALALADTMRQEGMTARVMSAIGIEQVVEPYVRPKALQYLEEGKVVI
PYRH_RALSO      AGGAAG-MDRATADYMGMLATMMNALALQDAMRHANIEGRVQSALRMDQVVEPYIRPRAIRQLEEGKVVI
PYRH_BURCH      AGGAAG-MDRATADYMGMLATMMNALALQDAMRHAGIEARVQSALRMDQVVEPYIRPRAIRQLEEGRVVI
PYRH_BURCA      AGGAAG-MDRATADYMGMLATMMNALALQDAMRHAGIEARVQSALRMDQVVEPYIRPRAIRQLEEGRVVI
PYRH_RALEH      AGGAAG-MDRATADYMGMLATMMNALALQDAMRHANIEGRVQSALRMDQVVEPYIRPRAIRQLEEGKVVI
PYRH_PROM3      KGSAAG-MDRATADYVGMLATVMNAITLQDGLERAGVATRVQTAIEMQEVAEPYIRRRAIRHLEKGRVVV
PYRH_RALME      AGGAAG-MDRATADYMGMLATMMNALALQDAMRHASIEGRVQSALRMDQVVEPYIRPRAIRQLEEGKVVI
PYRH_LEPBL      NAKVG--IDRATADYMGMLATIQNALALQDACEKKGLYTRVQSAIEINSIAESYIRRRAVRHLEKRRIVI
PYRH_LEPBJ      NAKVG--IDRATADYMGMLATIQNALALQDACEKKGLYTRVQSAIEINSIAESYIRRRAVRHLEKRRIVI
PYRH_BORPE      -APGAQGMDRATADYMGMMATIMNALALQDALKHKGVDTRVQSALNIDQVVEPYIRPKALRYLEEGKVVI
PYRH_POLNA      -AGGSVGMDRATADYMGMLATVMNALALGDTMDKAGLVARVMSAIGIERVVEPYVRPKALQYLEEGKVVV
PYRH_HAEIN      KAKAG--MNRVVGDHMGMLATVMNGLAMRDSLFRADVNAKLMSAFQLNGICDTYNWSEAIKMLREKRVVI
PYRH_ACISJ      -AGGSVGMDRATADYMGMLATVMNALALADAMDKQGLTARVMSAIGIEQVVEPYVRPKALQYLEEGKVVV
PYRH_ACIAC      -AGGSVGMDRATADYMGMLATVMNALALADAMDKQGLIARVMSAIGIEQVVEPYVRPKALQYLEEGKVVV
PYRH_MANSM      KAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRADVNAKLMSAFQLNGICDTYNWSEAIKMLREKRVVI
PYRH_PROMM      KGSAAG-MDRATADYVGMLATVMNAITLQDGLERAGVPTRVQTAIEMQEVAEPYIRRRAIRHLEKGRVVV
PYRH_BURVG      AGGAAG-MDRATADYMGMLATMMNALALQDAMRHAGIVARVQSALRMDQVVEPYIRPRAIRQLEEGKVVI
PYRH_BURCM      AGGAAG-MDRATADYMGMLATMMNALALQDAMRHAGIVARVQSALRMDQVVEPYIRPRAIRQLEEGKVVI
PYRH_BORBR      -APGAQGMDRATADYMGMMATIMNALALQDALKHKGVDTRVQSALNIDQVVEPYIRPKALRYLEEGKVVI
PYRH_XANCP      LAASG--MDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLEKGRIAI
PYRH_XANC8      LAASG--MDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLEKGRIAI
PYRH_BURTA      AGGAAG-MDRATADYMGMLATMMNALALQDAMRHAGIEARVQSALRMDQVVEPYIRPRAIRQLEEGKVVI
PYRH_BURPS      AGGAAG-MDRATADYMGMLATMMNALALQDAMRHAGIEARVQSALRMDQVVEPYIRPRAIRQLEEGKVVI
PYRH_BURP6      AGGAAG-MDRATADYMGMLATMMNALALQDAMRHAGIEARVQSALRMDQVVEPYIRPRAIRQLEEGKVVI
PYRH_BURP1      AGGAAG-MDRATADYMGMLATMMNALALQDAMRHAGIEARVQSALRMDQVVEPYIRPRAIRQLEEGKVVI
PYRH_BURP0      AGGAAG-MDRATADYMGMLATMMNALALQDAMRHAGIEARVQSALRMDQVVEPYIRPRAIRQLEEGKVVI
PYRH_BURMS      AGGAAG-MDRATADYMGMLATMMNALALQDAMRHAGIEARVQSALRMDQVVEPYIRPRAIRQLEEGKVVI
PYRH_BURMA      AGGAAG-MDRATADYMGMLATMMNALALQDAMRHAGIEARVQSALRMDQVVEPYIRPRAIRQLEEGKVVI
PYRH_BURM9      AGGAAG-MDRATADYMGMLATMMNALALQDAMRHAGIEARVQSALRMDQVVEPYIRPRAIRQLEEGKVVI
PYRH_BURM7      AGGAAG-MDRATADYMGMLATMMNALALQDAMRHAGIEARVQSALRMDQVVEPYIRPRAIRQLEEGKVVI
PYRH_SYNS3      KGSAAG-MDRATADYVGMLATVMNAITLQDGLERAGIPTRVQTAIEMQEVAEPYIRRRAMRHLEKGRVVV
PYRH_GEOMG      AAS-SKGMDRASADYMGMLATMINSLAMQDALEKIGVDTRVQSAIAMQEVAEPYIRRRAMRHLEKGRVVI
PYRH_CLOTH      --RSGKGMDRTTADYMGMLATVINALGLQDALESQGMPTRVQTAIEMRQIAEPYIRRKAVRHLEKKRIVI
PYRH_BORPA      -APGAQGMDRATADYMGMMATIMNALALQDALKHKGVDTRVQSALNIDQVVEPYIRPKALRYLEEGKVVI
PYRH_RHOFD      -AGGSVGMDRATADYMGMLATVMNALALGDTMNKAGLTARVMSAIAIEQVVEPYVRPKALQYLEEGKVVI
PYRH_BURXL      AGGAAG-MDRATADYMGMLATMMNALALQDAMRHAGIEARVQSALRMDQVVEPYIRPRAIRQLEEGKVVI
PYRH_XANOR      LAASG--MDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLEKGRIAI
PYRH_XANOM      LAASG--MDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLEKGRIAI
PYRH_PROMT      KGSAAG-MDRATADYVGMLATVMNAITLQDGLERAGVPTRVQSAIDMQQIAEPYIRRRAIRHLEKGRVVV
PYRH_PROM1      KGSAAG-MDRATADYVGMLATVMNAITLQDGLERAGVPTRVQSAIDMQQIAEPYIRRRAIRHLEKGRVVV
PYRH_FUSNN      LSGAAQGVDRVTGDHMGMLATVINSLALQNSIEKLGVPTRVQTAIEMPKVAEPFIKRRAQRHLEKGRVVI
PYRH_COLP3      LAEAG--MNRVVGDQMGMLATVMNGLAMRDALHRAFVNTRLMSAIDLAGVCERYNWANAISLLKSGRVVI
PYRH_BORA1      -APGAQGMDRATADYMGMMATIMNALALQDALKHKGLDTRVQSALNIDQVVEPYIRPKTLRYLEEGKVVI
PYRH_SYNPW      KGSAAG-MDRATADYVGMLATVMNAITLQDGLERAGIPTRVQTAIEMQEVAEPYIRRRAIRHLEKGRVVV
PYRH_LEPIN      NAKAG--IDRATADYMGMLATIQNALALQDACEKKGLYTRVQSAIEINSIAESYIRRRAVRHLEKRRIVI
PYRH_LEPIC      NAKAG--IDRATADYMGMLATIQNALALQDACEKKGLYTRVQSAIEINSIAESYIRRRAVRHLEKRRIVI
PYRH_GEOSL      AAS-SKGMDRASADYMGMLATMINSLAMQDALEKVGVDTRVQSAIAMQEVAEPYIRRRAIRHLEKGRIVI
PYRH_ANAVT      KAASAG-MDRATADYIGMIATVMNAMTLQDSLERIGVQTRVQTAIAMQELAEPYIRRRAIRHLEKGRVVI
PYRH_POLSJ      -AGGSVGMDRATADYMGMLATVMNALALGDTMDKAGLIARVMSAIGIERVVEPYVRPKALQYLEEGKVVI
PYRH_PARDP      QGS-AQGMERATADYMGMLATVMNALAMQAALEALKIHTRVISAIRMDEVAEPYIRRRAVRHLEKKRVCI
PYRH_HALHL      LAASG--MDRVTADHMGMLATVMNALAIQDALERRSVFCRVMSAIKINQVCEDYIRRRAVRHLEKGRVVI
PYRH_ANASP      KAASAG-MDRATADYIGMIATVMNAMTLQDSLERIGVQTRVQTAIAMQELAEPYIRRRAIRHLEKGRVVI
PYRH_XANC5      LAASG--MDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLEKGRIAI
PYRH_SYNR3      KGSAAG-MERATADYVGMLATVMNAITLQDGLERAGVPTRVQSAIAMQEVAEPYIRRKAMRHLEKGRVVI
PYRH_XYLFT      LAAKG--MDRVTGDQMGMLATIINALAMQDALEKLGTKVRVMSAIKINNVCEDFIRRRAIRHLEKSRITI
PYRH_THET8      RQGVG--MDRATADYIGMLATIMNALALQDALESLGVPTRVQTALTITQVAEPYIRRRALRHLEKERIVI
PYRH_THET2      RQGVG--MDRATADYIGMLATIMNALALQDALESLGVPTRVQTALTITQVAEPYIRRRALRHLEKERIVI
PYRH_PROMA      KGSSAG-MDRATADYVGMLATVMNAITLQDGLERAGVETRVQTAIEMQQIAEPYIRRRAIRHLEKGRVVV
PYRH_XYLFA      LAAKG--MDRVTGDHMGMLATIINALAMQDALEKLGTKVRVMSAIKINNVCEDFIRRRAIRHLEKSRITI
PYRH_XANAC      LAASG--MDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLEKGRIAI
PYRH_SYNY3      KASAAG-MDRATADYIGMIATVMNAMTLQDALEQMDIPTRVLTAIAMQEVAEPYIRRRAIRHLEKGRVVI
PYRH_RHORT      ISTAAKGMDRTSADYMGMLATVMNALAVQNALEKRGVQTRVQSAIPMSMVCEPYIRRRAIRHMEKGRVVI
PYRH_EHRCR      SASASFGFERASNDYIGMLATMMNALSLQNALEKVNVQSRVLSAIPITAVCETYIRRRAIRHLEKGRVVI
PYRH_SYNS9      KGSAAG-MDRATADYVGMLATVMNAITLQDGLERAGVPTRVQTAIAMQEVAEPYIRRKAMRHLEKGRVVV
PYRH_ROSDO      QGS-AQGMERTTADYMGMLATVMNALAMQSALEGLGIHTRVISAITMNEVAEPYIRRRAVRHLEKKRVCI
PYRH_PROMP      KGS-ADGMDRATADYVGMLATVMNAISLQDGLERVGVETRVQTAIEMQEIAEPYIRRRAMRHLEKGRVVV
PYRH_PROM5      KGS-ADGMDRATADYVGMLATVMNAISLQDGLERVGVETRVQTAIEMQEIAEPYIRRRAMRHLEKGRVVV
PYRH_TRIEI      KAA-SKGMDRATADYVGMIATVMNAITLQDALEQVGVPTRVQTAIAMQELAEPYIRRRAIRHLEKGRVVV
PYRH_RHOS4      QGS-AQGMERTTADYMGMLATVMNALAMQAALESLGIFTRVISAIPMDQVCEPYIRRRAVRHLEKKRVCI
PYRH_METCA      KASEG--LDRVTGDHMGMLATVINALAMQDALENLGRPVRVMSALKINQVCEDYIRRRAVRHLEKGRVVV
PYRH_JANSC      QGS-AQGMERTTADYMGMLATVMNALAMQGALESLGVYTRVISAITMNEVAEPYIRRRAIRHLEKKRVCI
PYRH_PARZE      QGS-AQGMERTTADYMGMLATVMNALAMQSALEALGHHCRVISAIRMDEVCEPYIRRRAIRHLEKKRIVI
PYRH_DESRM      SGSTKG-MDRATADYMGMLATVINSLALQDALEKIEVDTRVQTSFEMRAVAETYIRRRAIRHMEKGRVVI
PYRH_RHOS1      QGS-AQGMERTTADYMGMLATVMNALAMQAALESLGIFTRVISAIPMDQVCEPYIRRRAVRHLEKKRVCI
PYRH_RHOS5      QGS-AQGMERTTADYMGMLATVMNALAMQAALESLGIFTRVISAIPMDQVCEPYIRRRAVRHLEKKRVCI
PYRH_PELPD      AAS-SQGMDRAGADNMGMLATMINSLAMQDALEKIGVATRVQSAIVMQQVAEPYIRRRAIRHLEKGRVVI
PYRH_VEREI      -AGGAVGMDRATADYMGMLATVMNALALADAMNKQALVARVMSAIAIEQVVEPYVRPKALQYLEEGKVVI
PYRH_GLOVI      KAS-SSGMDRATADYVGMLATVMNALTLQDALEQQQVQTRLLSAIEMKEVAEPFIRRRAMRHLEKGRVVI
PYRH_DEHE1      TAA-KEGIDRVSADYAGMLATIINALTLQDALEREGIVTRTQSALAVQQVAEPYICRRAIRHLEKGRVVI
PYRH_COXBU      ALQAAG-INRITGDYMGMLATLMNALALRDAFERSNLPVRILSAIPMTGVADAFHRRKAIHHLQQGRVVI
PYRH_SYNPX      KGSAAG-MERATADYVGMLATVMNAITLQDGLERAGVPTRVQTAIAMQEVAEPYIRRKAMRHLEKGRVVV
PYRH_MAGSM      SGS-ANGMGRTRADQMGMLATVINGLALQSALMLSGTEAVVQTALEMPRVAEPFDHDSAKSHMKQGRVVI
PYRH_ANADE      -SGATEGMDRSSADYMGMLATVINSMALQDALEKIGVPTRVQSAIEMHQVAEPYIRRRAIRHLEKGRVVI
PYRH_CYTH3      EAA-ATGIDRVQGDYMGMLATVINCMALQSALENIGLDTRLMSGIKIEQVCESFIRRRAIRHLEKGRIVM
PYRH_ACIAD      QLQKDGLVGRVTGDQMGMLATVMNGLAMRDALVRRNIKTRLMSALSIGTVVEPYSSRDAIRYLSQGEVCV
PYRH_CARHZ      LSGSAKGMDRATADYMGMLATVINSLALQDALEKLGIDTRVQTAIEMRQIAEPYIRRRAIRHLEKGRVVI
PYRH_SYNSC      KGSAAG-MERATADYVGMLATVMNAITLQDGLERAGVPTRVQTAIAMQEVAEPYIRRKAIRHLEKNRVVV
PYRH_NITMU      TSS-AEGMDRATADYMGMLATVMNALALQDAMRRAGLVSRVQSALRIDQVVEPYIRGKAIRYLEEGKIVI
PYRH_NITEC      KSA-GDGMDRVTADYMGMLATTMNALALHDAMRRNGVVSRVQSALRIDQVVEPYIRGKALRYLNERKVVI
PYRH_MARMM      LSGAAKGMDRAAADYMGMLATVMNALAMQTALERIGVQTRVQSAIPMTTVCEPYIRRRATRHMEKGRVVI
PYRH_CLONN      N---GEEMDRTTADYMGMLATCINALALQDSLENIGVKTRVQTAIEMKEVAEPFIRRRAMRHLEKKRVVI
PYRH_PROMS      KGS-ADGMDRATADYVGMLATVMNAISLQDGLERVGVATRVQTAIEMQEIAEPYIRRRAMRHLEKGRVVV
PYRH_MYXXD      -AGATEGMDRASADYMGMLATCINSMAMQDALEKKGLHTRVLSAIKMEQIAEPYIRRRAVRHLEKGRVVI
PYRH_CLOBL      --RSGSEMDRTTADYMGMLATCINALALQDSLEQLGVNTRVQTAIEMKEIAEPFIRRRAMRHLEKERVVI
PYRH_CLOBH      --RSGSEMDRTTADYMGMLATCINALALQDSLEQLGVNTRVQTAIEMKEIAEPFIRRRAMRHLEKERVVI
PYRH_CLOB1      --RSGSEMDRTTADYMGMLATCINALALQDSLEQLGVNTRVQTAIEMKEIAEPFIRRRAMRHLEKERVVI
PYRH_CHLPD      SEAAAN-MDRVQADYMGMLATVINAIAFQDALERKGVFTRLQTAIKMEQMAEPFIRRRAIRHLEKGRVVI
PYRH_CLOPS      --RSGEGMDRTTADYMGMLATSINALALQDSLESLGVDTRVQTAIEMKEIAEPYIRRRAMRHLEKGRVVI
PYRH_EHRCJ      SSSSPFGFERASNDYIGMLATMMNALSLQNALEKINVQSRVLSAIPITAVCETYIRRRAIRHLEKGRVVI
PYRH_DEHSC      TAA-KEGIDRVSADYAGMLATIINAITLQDALEREGIVTRTQSALSVQQVAEPYIRRRAVRHLEKGRVVI
PYRH_CLOPE      --RSGEGMDRTTADYMGMLATSINALALQDSLESLGVDTRVQTAIEMKEIAEPYIRRRAMRHLEKGRVVI
PYRH_CLOP1      --RSGEGMDRTTADYMGMLATSINALALQDSLESLGVDTRVQTAIEMKEIAEPYIRRRAMRHLEKGRVVI
PYRH_RHOBA      SFSGANSVQEATAHYMGMLATVINSLALQDALDSIGLQTRVMSALPVDRVAEQFIRRRAIRHLEKGRVII
PYRH_PROM9      KGS-ADGMDRATADYVGMLATVMNAISLQDGLERVGVATRVQTAIEMQEIAEPYIRRRAMRHLEKGRVVV
PYRH_GRAFK      -AGASRGMDRVQGDHMGMLATVINGLALQSALEDANIQTRLQSAIKINEVAEPFIRRKAIRHLEKGRVVI
PYRH_BUCAP      TSQLG--VNRIVSDHIGILSTIINSLAMKDIMNSYSIPSYVMSSIPVDGICETYNYERAIDLLSNNFVVI
PYRH_ACTP2      KAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRADVNAKLMSAFQLNGICDTYNWSEAIKMLREKRVVI
PYRH_PROM2      KGS-ADGMDRATADYVGMLATVMNAISLQDGLERVGVATRVQTAIEMQEIAEPYIRRRAMRHLEKGRVVV
PYRH_PROM0      KGS-ADGMDRATADYVGMLATVMNAISLQDGLERVGVATRVQTAIEMQEIAEPYIRRRAMRHLEKGRVVV
PYRH_THICR      QIE-GAGIQRTTGDHMGMMATVINALALRDVIEDMGMSSVVYSAMAIEGVSHGFNANHVKKGMAEGQVAI
PYRH_BARBK      VASHGGD--RVTGDHMGMLATAINSLALRTSLTKLGVETVVLSAITMPQICESFSQRKAMSYMNQGKVVI
PYRH_PARL1      LSGAAKGMERASADYMGMLATVMNALAMQTALEAIGVPTRVQSAIPMMTVCEPYIRRRAVRHMEKGRVVI
PYRH_CHLTE      SAAAAS-MDRVQADYMGMLATVINSLALQDALERKGIFTRLVTAIKMEQIAEPFIRRRAVRHLEKGRVVI
PYRH_DEIRA      RN--GQGMDPATADYIGMLGTVMNAMALQDAMEAAGKPTRIMSAIHMQQVAEPYIRRRAMRHLEKGRVVI
PYRH_ANADF      -SGATEGMDRSSADYMGMLATVINAMALQDALEKIGVNTRVQSAIEMHQVAEPYIRRRAIRHLEKGRVVI
PYRH_ACIBT      QLQKDGLVGRVTGDQMGMLATVMNGLAMRDALVRRNIRTRLMSALPIGTVVESYSSRDAIRHLSQGEVCV
PYRH_RICB8      NAALVG-MDRASADYIGMLATVINALTLQNVMESLNIYTRVLSAIPMMSVCEPYIRRRAKRHMEKGRVVI
PYRH_LACSS      TGEQMG-MERAQADYMGMMATVMNALALQDNLESIGVPTRVQTSIEMRQIAEPYIRRKAVRHLEKGRVVI
PYRH_LACC3      TAEMG--MERAQADYMGMLATVMNALALQDNLESQGVPTRVQTSIEMRQIAEPYIRRKAIRHLEKGRVVI
PYRH_CAUCR      MAGAAKGMERSSADYMGMLATVMNALAMQDALERIGVETRVQSAIPMATVCEPYIRRRAQRHLEKGRVVI
PYRH_ALKOO      --RTGEGMDRTTADYMGMLATVINALALQDSLENLDVLTRVQSAIEMRQIAEPYIRRRAVRHLEKNRVVI
PYRH_NITEU      KSA-GDGMDRVTADYMGMLATTMNALALHDAMRRNGVVSRVQSALRIDQVVEPYVRGKALRYLDERKVVV
PYRH_DESPS      MAGASKGMDRATADNMGMLATVMNSLAMQDALERSGVITRAMSAIPMQSICESYIRRRATRHLEKGRVVI
PYRH_DEIGD      RN--GKGMDAATADYIGMLGTVMNAMALQDAMEAAGQPTRVMTAIQMAAVAEPYIRRRAIRHLEKGRVVI
PYRH_SYNP6      KGAAAG-MERATADYVGMIATVMNAITLQDALEQLQVPTRVQTAIAMQEVAEPYIRRRAIRHLEKGRVVI
PYRH_SYNE7      KGAAAG-MERATADYVGMIATVMNAITLQDALEQLQVPTRVQTAIAMQEVAEPYIRRRAIRHLEKGRVVI
PYRH_RICM5      NASLVG-MDRASADYIGMLATMINALTLQNVMESLNIYTRVLSAIPMMSVCEPYIRRKAKRHMEKKRVVI
PYRH_RICBR      NAALVG-MDRASADYIGMLATVINALTLQNVMESLNIYTRVLSAIPMMSVCEPYIRRRAKRHMEKGRVVI
PYRH_ANAPZ      STSFG--FERASNDYVGMLATMINALALQNSLEDMGIASRVLSAIPMTAVCETYIRRRAIRHLEKGRVVI
PYRH_PELLD      -SDAAKNMDRVQADYMGMLATVINSIAFQDALERLGVYTRLQTAIKMEQMAEPFIRRRAIRHLEKGRVVI
PYRH_FLAPJ      IAGASNGMDRVQGDYMGMLATVINGMALQGALEEKGMLTRLQTALKIEAIAEPYIKRRAVRHLEKNRIVI
PYRH_ZYMMO      AAT-ARGIERSSADYMGMLATVMNAIAVQNALENLGVDTRVQSAIPMPTVCEPFIRRRAERHMEKGRVVI
PYRH_CHLCH      SQAAAN-MDRVQADYMGMLATVINSLAFQDALERKGVFTRLLTAISMEQIAEPFIRRRAIRHLEKGRVVI
PYRH_BACSK      MAGSAQGMDRATADYMGMLATVMNSLALQDSLEAIGVESRVQTSIEMRQVAEPYIRRKAIRHLQKKRVVI
PYRH_SYNFM      -SGASRGMDRSTADYMGMLATVMNALALQQALEKHGTSTRVQSAIDMKEVAEPYIRRRALRHMEKGRIVI
PYRH_GEOTN      KTGSEMGMDRATADYMGMLATVMNALALQDSLEQLGVETRVQTSIEMRQVAEPYIRRRAIRHLEKKRVVI
PYRH_CHLFF      AQQKELQINRVSADQMGMLATLINGMAVADALKADDIPCLLTSTLSCPQLADLYTPQKSAEALSQGKVLI
PYRH_BARQU      VASHGGD--RVTGDHMGMLATAINSLALRTSLTKLGVETVVLSAVAMPQICESFSQRKAIGYMNQGKVVI
PYRH_PSYWF      QLQKEGLVGRVTGDQMGMLATVMNGLAMRDALERRNINTRLMSALPIGEVTESYSSRNAIRYLKNGDVCI
PYRH_PSEA6      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAFVNARLMSAIPLNGVCDAYNWAEAISLLKSGRVVI
PYRH_LACPL      EAGAQMGMERAQADYIGMLATIMNALALQDNLESIGVPTRVQTSIEMRQIAEPYIRRKAMRHLEKRRIVI
PYRH_CHLCV      AQQKELQINRVSADQMGMLATLINGMAVADALKADDIPCLLTSTLSCPQLADLYTPQKSEEALSQGKVLI
PYRH_LACRD      TAELG--MERAQADYIGMLATIMNALSLQDALESIGVPTRVQTSIEMRQIAEPYIRRKAIRHLEKDRIVI
PYRH_ENTFA      GAQMG--MERAQADYMGMLATVMNALALQDTLENLGVPTRVQTSIEMRQIAEPYIRRRAERHLEKGRVVI
PYRH_RICFE      NAALVG-MDRASADYIGMLATVINALTLQNVMESLNIYTRVLSAIPMMSVCEPYIRRKAKRHMEKKRVVI
PYRH_AZOSB      KGA-ASGMDRATADYMGMLATVMNAMALADAMRRNGVEARVQSALRIDQVVEPYIRGRAIRHLEEGRVVI
PYRH_SHEB8      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLKGVCDDYNWAEAISLLKSGRVVI
PYRH_SHEB5      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLKGVCDDYNWAEAISLLKSGRVVI
PYRH_SILPO      LSGAAQGMERTTADYMGMLATVMNALGMQAALEGLGVFTRVISAIRMDEVAEPYIRRRAVRHLEKKRVCI
PYRH_PSYCK      QLQKEGLVGRVTGDQMGMLATVMNGLAMRDALERRNIKTRLMSALPIGEVTESYSSRNAIRYLKNGEVCI
PYRH_PSYA2      QLQKEGLVGRVTGDQMGMLATVMNGLAMRDALERRNIKTRLMSALPIGEVTESYSSRNAIRYLKNGEVCI
PYRH_LAWIP      SAS-AKGMDRSSADYMGMLATVLNALAIQDTLEKKGHPTRVLSAIAMQEVCEPYVRRRAMRHLEKGRVII
PYRH_SILST      LSGSAQGMERTTADYMGMLATVMNALGMQSALEDLGVFTRVISAIRMDEVAEPYIRRRAVRHLEKKRVCI
PYRH_RHOP5      EVSTRG-VSRPTGDTMGMLATVMNCLALEAAIERRGVSARTLSAPQVCELFTRATAHRY---LAEKRIVL
PYRH_METFK      -APAAEGMDRATADYMGMLATVMNALALQDAMRHIGLVSRVQSALNIEQVAEPYIRGKAIRYLEEGRVVI
PYRH_HAEDU      KAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAEVNAKLMSAFQLNGICDTYNWSEAIKMLREKRVVI
PYRH_SPHAL      MAGAAKGMDRAQADYMGMLATVMNALAMQNALEQLGVQTRVQSAIEMDKVCEPVIRRRAERHMEKGRVVI
PYRH_GRABC      SAA-ASGMDRAQGDYIGMLATVMNALAMQAALEKLNVPTRVQSAIPMASVCEPYVRRRAQRHMEKGRVVI
PYRH_THEFY      ELSQGG-MERSRADYMGMLGTVINCLALQDFLERLGIETRVQTAIHMSQVAEAYIPRRAIRHLEKGRVVI
PYRH_WOLTR      SASLSG-CERASSDYIGMLATIINALILQNFLEKNSVNSKVLSAIPMVTICEPYIRRKAIHHLEKGRVVI
PYRH_VIBF1      LAEAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARVMSAIPLKGVCDDYNWADAIAQLRQGRVVI
PYRH_RICCN      NAALVG-MDRASADYIGMLATVINALTLQNVMESLNIYTRVLSAIPMMSVCEPYIRRKAKRHMEKKRVVI
PYRH_LACBA      EAGAQMGMERAQADYIGMLATIMNALALQDNLESIGVPTRVQTSIEMRQIAEPYIRRKAIRHLEKERVVI
PYRH_BUCAI      KSKLG--LNRVASDHIGILSTVINSLAMRDTINSSSIKTCLMSAIPLNGICEIYNYEKAMNLLSNHVVVI
PYRH_SHESW      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLKGVCDDYNWAEAISLLKSGRVVI
PYRH_SHEON      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLKGVCDDYNWAEAISLLKSGRVVI
PYRH_NITWN      EVS-SRGVSRPTGDTMGMLATVMNCLALEAALERRGQSARALSSFVMPEVCELFTRRAAHKYLAEDRIVL
PYRH_ERYLH      MAGAAQGMERAQADYMGMLATVMNALAMQSALEQLGVHTRVQSAIQMDQVCEPVIRRRAERHLEKDRVVI
PYRH_SODGM      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDNYSWAEAISLLRNNRVVI
PYRH_LACLS      TGEKAG-MERAQADYMGMLATIQNGLFIQSALENIGVDTRVMTAIEMKAVAEPYIRRRAERHLEKGRVVI
PYRH_LACLM      TGEKAG-MERAQADYMGMLATIQNGLFIQSALENIGVDTRVMTAIEMKAVAEPYIRRRAERHLEKGRVVI
PYRH_LACLA      TGEKAG-MERAQADYMGMLATIQNGLFIQSALENIGVDTRVMTAIEMKAVAEPYIRRRAERHLEKGRVVI
PYRH_FERNB      -RDFEG-LRPTISDQIGMLGTVINALYLKDRFENAGIRTVIVSQIVTLPSVKLINYDDIDLYFDAGYVVI
PYRH_CHLAB      AQQKELQINRVSADQMGMLATLINGMAVADALKADDIPCLLTSTLSCPQLADLYTPQKSEEALNQGKIVI
PYRH_SPHWW      LAAAAKGFDRTSADYMGMLATVMNALAVQNALEQIGVDTRVQSAIPMSTVCEPFIRRRAERHLEKGRIVI
PYRH_NOVAD      MAGAAKGMDRAQADYMGMLATVMNALAMQSALEQLGVPTRVQSAIEMDKVCEPVIRRRAERHLEKGRIVI
PYRH_WOLPM      SASLSG-CERASSDYIGMLATIINALILQNFLEKNLVASRVLSAIPMATVCEPYIRRKAIRHLEKGRVVI
PYRH_THEEB      KGAAAG-MDRATADYIGMIATVMNAMTLQDALEQMNVPTRVQTAIAMQEVAEPYIRRRAIRHLEKGRVVI
PYRH_RICTY      NAALVG-MDRASADYIGMLATVINALTLQNVMESLGIYTRVLSAIPMMSVCEPYIRRKAKRHMEKKRVVI
PYRH_NITHX      EVS-SRGVSRPTGDTMGMLATVMNCLALEAALERRGQSARALSAFVMPEVCELFTRNAAHKYLSEGRIVL
PYRH_HAEIG      KAKAG--MNRVVGDHMGMLATVMNGLAMRDSLFRADVNAKLMSAFQLNGICDTYNWSEAIKMLREKRVVI
PYRH_HAEI8      KAKAG--MNRVVGDHMGMLATVMNGLAMRDSLFRADVNAKLMSAFQLNGICDTYNWSEAIKMLREKRVVI
PYRH_CAMC5      SAAKDGIIRRTSGDHMGMLATVINSIAMREALERGGLDVRVQSAIKMEAICETFIVGRANRHLEKGRVVI
PYRH_VESOH      TLT-KTGINRITSDHIGMLSTIINALAIADTCQKNKVDALVMSGLSIGGGICNSINHIYKQALKKGKVII
PYRH_SHESR      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLKGVCDDYNWAEAISLLKSGRVVI
PYRH_SHESM      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLKGVCDDYNWAEAISLLKSGRVVI
PYRH_SHEPC      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLKGVCDDYNWAEAISLLKSGRVVI
PYRH_HYPNA      -AGAAKGMERAQADSMGMLATVMNALAMQSVLENLGVPTRVQSALNMDAICEPYIRRRAHRHMEKGRVVI
PYRH_SHESA      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLKGVCDDYNWAEAISLLKSGRVVI
PYRH_CHRVO      -APAAAGMDRATADYMGMMATVMNALALKDAMTKAGLIARVQSALTMQQIAEPYVRGKAMQYLEEGKVVI
PYRH_THEM4      EMQ---ELSPTIADQIGMLGTVINALYLKDIFEKNNLRTVVVSQ--VSSLPSIRPIHDINLYFDAGYLVI
PYRH_RICPR      NAALVG-MDRASADYIGMLATVMNALTLQNVMESLGIYTRVLSAIPMMSVCEPYIRRKAKRHMEKKRVVI
PYRH_LEGPA      KALSQAGVGRVTGDHMGMLATLMNALALRDALERIDLPARIMSAIPMLGVVDPYHRRKAITHLRNGQVVI
PYRH_LACRE      TAELG--MERAQADYIGMLATIMNALSLQDALESLDVPTRVQTSIEMRQIAEPYIRRKAIRHLEKDRIVI
PYRH_LACJO      TANLG--MERAQADYMGMLATIMNGLALQDGLENLGVPTRVQTSIEMRQIAEPYIRRKAVRHLEKGRVVI
PYRH_LACGA      TANLG--MERAQADYMGMLATIMNGLALQDGLENLGVPTRVQTSIEMRQIAEPYIRRKAMRHLEKGRVVI
PYRH_LEGPH      KALSQAGVGRVTGDHMGMLATVMNALALRDALERIDLPARIMSAIPMLGVVDPYHRRKAITHLRNGQVVI
PYRH_LEGPC      KALSQAGVGRVTGDHMGMLATVMNALALRDALERIDLPARIMSAIPMLGVVDPYHRRKAITHLRNGQVVI
PYRH_KLEP7      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDNYSWAEAISLLRNNRVVI
PYRH_BACA2      KTGSDLGMDRATADYMGMLATVMNSLALQDSLETLGIQSRVQTSIEMRQVAEPYIRRKAIRHLEKKRVVI
PYRH_SALTY      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDNYSWAEAISLLRNNRVVI
PYRH_SALTI      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDNYSWAEAISLLRNNRVVI
PYRH_SALPA      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDNYSWAEAISLLRNNRVVI
PYRH_SALCH      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDNYSWAEAISLLRNNRVVI
PYRH_RICCK      NAALVG-MDRASADYIGMLATVINALTLQNVMESLNIYTRVLSAIPMMSVCEPYIRRKAKRHMEKKRVVI
PYRH_PSYIN      LAEAG--MNRVVGDHMGMLATVMNGLAMRDALQRSHVNSRLMSAIPLNGVCDDYNWAKAIRYLKQGTVVI
PYRH_LEUMM      PASKIG-MERSRADYTGMLGTTMNALVLQDSLERAGVQTRVQTAITMQQIAEPYIRGRAIRHLEKGRIVI
PYRH_HAEIE      KAKAG--MNRVVGDHMGMLATVMNGLAMRDSLFRADVNAKLMSAFQLNGICDTYNWSEAIKMLREKRVVI
PYRH_CLOTE      N---GEDMDRTTADYMGMLATCINAMALQDSLEQLGVDTRVQTAIEMKEVAEPFIRRRAMRHLEKGRVVI
PYRH_CHLPN      AEQKELQINRVSADQMGMLATLINGMAVADALKAEDIPCLLTSTLSCPQLADLYTPQKSIEALDQGKILI
PYRH_ALCBS      ALQSAG-LDRVAGDHMGMLATVMNGLALRDALERSNIRTRLMSAIPMSGVVEHYDHRNANRHLKNGEVVI
PYRH_YERE8      LAQAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDNYSWAEAISLLRHNRVVI
PYRH_SYNWW      -AGSAKGMDRATADYMGMLATVINALALQDALEQEGMGTRVMSAIEMKEVCEPYIRRRAIRHLEKGRVTI
PYRH_SHEFN      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLKGVCDDYTWTEAISLLKSGRVVI
PYRH_SERP5      LAQAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDNYSWAEAISLLRNNRVVI
PYRH_RUTMC      LAQAG--MNRITGDHMGMLATVMNALAIADVCQKNKVDTLVMSGFSIGGGVCDSINHHAKQALNEGKVVI
PYRH_SYNJA      KEAAAQGMDQASADYVGMLATVINALTLQDAIERAGIPTRVQTAIAMQEVAEPYIRRRAIRHLEKGRVVI
PYRH_PHOPR      LAEAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARVMSAIPLNGVCDSYNWAEAISQLRQGRVVI
PYRH_OCEIH      KVGSEMGMDRASADYMGMLATIMNSLALQDGLETIDVETRVQTSIEMRQVAEPYIRRKAIRHLEKKRVVI
PYRH_DESDG      LSSSAKGMDRSSADYMGMLATVLNAVAVQDALEKLGHATRVLSAITMQEVCEPYIRRRAERHLEKGRVVI
PYRH_ANAMM      STSDG--FERTSNDYVGMLATVINALALQNALEEMGVECRVLSAMPMTAVCETYVRRRAVRHLEKGRVVI
PYRH_ACTSZ      KAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRADVNAKLMSAFQLNGICDTYNWSEAIKMLREKRVVI
PYRH_SHISS      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVI
PYRH_SHIFL      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVI
PYRH_SHIF8      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVI
PYRH_SHIBS      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVI
PYRH_LEGPL      KALSQAGVGRVTGDHMGMLATVMNALALRDALERIDLPARIMSAIPMLGVVDPYHRRKAITHLRNGQVVI
PYRH_HAHCH      KALQDAGMDRVTGDHMGMLATVMNALAMRDALERSNIATRVMSAIPMSGVVEHYDRRRAIRDLKEGDVVI
PYRH_HAES1      KAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRANVNAKLMSAFQLNGICDTYNWSEAIKMLCEKRVVI
PYRH_ENTS8      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAFPLNGVCDNYSWAEAISLLRNNRVVI
PYRH_ECOUT      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVI
PYRH_ECOLI      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVI
PYRH_ECOL6      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVI
PYRH_ECOL5      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVI
PYRH_ECOK1      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVI
PYRH_ECOHS      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVI
PYRH_ECO57      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVI
PYRH_ECO24      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVI
PYRH_SHEAM      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLKGVCDDYNWAEAISLLKSGRVVI
PYRH_MYCPU      SAE-KNGIPRNRADYIGMLATVMNGLALKSGFEKEGLVARVYSSLNLDP--KVAENYKATKNLENNEIVI
PYRH_DECAR      MAGTATGMDRATADYMGMLATVMNAMALSDAFRQCGLNARVQSALNIEQVVEPYIRGKAIRYLEEGKIVI
PYRH_BACLD      KTGSDLGMDRATADYMGMLATVMNSLALQDSLETLGIQSRVQTSIEMRQVAEPYIRRKAIRHLEKKRVVI
PYRH_AQUAE      ---FQGKVDRATADYMGMLATVINALALQSALENHNIPTRVLSAIEMRQVAEPYIRRRAIRHLEKGRIVI
PYRH_THETN      DAV---GMDRTTADHMGMLATVINALALQDALEQRGVPTRVQTAIEMRAIAEPYIRRRAIRHLEKGRVVI
PYRH_SHIDS      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVL
PYRH_SHEDO      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLKGVCDDYNWAEAISLLKSGRVVI
PYRH_NITSB      NASKEGIIRRSSGDYMGMLATVINAVALQEALEYFGLTARVQSAIEMNEICEPFIVRRAMRHLEKGRIVI
PYRH_EHRRW      SASAPFGFERASNDYIGMLATMMNALSLQNSLEKINVQSRVLSAVSITAVCETYIRRRAIRHLEKGRIVI
PYRH_EHRRG      SASAPFGFERASNDYIGMLATMMNALSLQNSLEKINVQSRVLSAVSITAVCETYIRRRAIRHLEKGRIVI
PYRH_ACICJ      SGAAGG-MDRAQADYMGMLATVMNALAMQSALEKRGVATRVQSAIPMSAVCEPYIRRRAERHMEKGRVVI
PYRH_YERPS      LAQAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDNYSWAEAISLLRHNRVVI
PYRH_YERPP      LAQAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDNYSWAEAISLLRHNRVVI
PYRH_YERPN      LAQAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDNYSWAEAISLLRHNRVVI
PYRH_YERPE      LAQAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDNYSWAEAISLLRHNRVVI
PYRH_YERPA      LAQAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDNYSWAEAISLLRHNRVVI
PYRH_YERP3      LAQAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDNYSWAEAISLLRHNRVVI
PYRH_SYNJB      KEAAAQGMDQASADYVGMLATVINALTLQDAIERAGIPTRVQTAIAMQEVAEPYIRRRAIRHLEKGRVVI
PYRH_STRSV      PAAEAG-MDRVQADYTGMLGTVMNALVMADSLQQVGVDTRVQTAIAMQQVAEPYIRGRALRHLEKGRIVI
PYRH_PEDPA      --ETGEQLERVQADYIGMLGTVMNALALQDSLESLGVPTRVQTSIEMRQIAEPYIRRKAVRHLEKNRIVI
PYRH_DESVV      LSSSAKGMDRSSADYMGMLATVLNALAVQDALEKLGHPTRVLSAITMQEVCEPYIRRRAERHLEKGRVVI
PYRH_DESVH      LSSSAKGMDRSSADYMGMLATVLNALAVQDALEKLGHPTRVLSAITMQEVCEPYIRRRAERHLEKGRVVI
PYRH_CITK8      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDNYSWAEAISLLRNNRVVI
PYRH_BDEBA      AAS-AEGMDRASADYMGMLATCINALALQDALEKQGVPTRVQTAIEMAEIAEPYIRRRAIRHLEKNRLVI
PYRH_RHOPA      EVS-ARGVSRTTGDTMGMLATVMNCLALAEALQRHGQKARTLAALMMPEVCELYTRAAAEQTLREGGIAL
PYRH_PSEHT      SAEAG--MNRVVGDHMGMLATVMNGLAMRDALHRAFVNCRLMSAIPLHGMCDAYNWAEAISLLKTGRVVI
PYRH_AZOSE      KGA-ASGMDRATADYMGMLATVMNAMALADAFRRAQVEARVQSALRIDQVVEPYIRGRAIRHMEEGRVVI
PYRH_PHOLL      LAEAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDNYSWAEAISLLRHGRVVI
PYRH_LACAC      TAKLG--MERAQADYMGMLATIMNGLALQDGLEKVGVPTRMQTSIEMRQIAEPYIRRRALRHLEKGRVVI
PYRH_DICNV      QAALG--MERVTGDHMGMLATLMNSLAMQDALEQIGVPVRTVSALRVDEICEPYIRRRAIRHLEKGNVVI
PYRH_BACCR      --KIGSEMGRAGADYMGMLATVMNSLALQDSLENIGIQTRVQTSIEMRQVAEPYIRRKAVRHLEKKRVVI
PYRH_BACAN      --KIGSEMGRAGADYMGMLATVMNSLALQDSLENIGIQTRVQTSIEMRQVAEPYIRRKAVRHLEKKRVVI
PYRH_SHELP      LAQAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLKGVCDDYNWAEAISLLKSGRVVI
PYRH_HELHP      SAAQGGIIRRTSGDYMGMLATVINAVAMQEALEYLGVDVRVQSALEIKEVCESYIYRRAIRHLEKGRVVV
PYRH_STRMU      PASKAG-MDRVQADYTGMLGTVMNALVMADALQHAGVDTRVQTAIAMQQVAEPYIRGRALRHLQKGRIVI
PYRH_CHRSD      ALHAAG-MERVTGDHMGMLATVMNGLAMRDALERSNIRSRVMSAIPMSGVVEHYDRRTAIRYLTSGDVVI
PYRH_AZOC5      RVA-GEDLDRSTADHMGMLATVMNCLALEAAVEAAGQPARTMSAIPMPTVCEPYARQPAQRHLRRGRVVL
PYRH_AERS4      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAISLQGVCDSYSWAEAISQLRAGKVVI
PYRH_STRTD      PAAEAG-MDRVQADYTGMLGTTMNALVMADSLKQLGVDTRVQTAIDMKSVAEPYIRGRALRHFEKGRIVI
PYRH_STRT1      PAAEAG-MDRVQADYTGMLGTTMNALVMADSLKQLGVDTRVQTAIDMKSVAEPYIRGRALRHFEKGRIVI
PYRH_MOOTA      KGS-ARGMDRATADYMGMLATVINSLALQDALENQGVDTRVQTAIEMRQIAEPYIRRRAIRHLEKGRVVI
PYRH_ERWCT      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDNYSWAEAISLLRNNRVVI
PYRH_NEOSM      SGI--PNIDRATGDYMGMLATVINALALQGAINNLGVVSRVQSAIPMRSICEPYVRQKAISHMEKNRIVI
PYRH_VIBCH      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDDYSWSDAIRELRQGRVVI
PYRH_VIBC3      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDDYSWSDAIRELRQGRVVI
PYRH_ENT38      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDNYSWAEAISLLRNNRVVI
PYRH_WOLSU      SAAQDGVIRRTSADYMGMLATVINAVAMQEALEHAGLDVRVQSAIELKEICESYIYRRAIRHLEKGRVVI
PYRH_VIBVY      LAQAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARVMSAIPLNGVCDDYNWADAIRELRQGRVVI
PYRH_VIBVU      LAQAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARVMSAIPLNGVCDDYNWADAIRELRQGRVVI
PYRH_VIBHB      LAEAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARVMSAIPLKGVCDDYNWADAIRELRQGRVVI
PYRH_RICRS      NAALVG-MDRASADYIGMLATVINALTLQNVMESLNIYTRVLSAIPMMSVCEPYIRRKAKRHMEKKRVVI
PYRH_PSEMY      ALSAAG-MDRVTGDHMGMLATVMNALAMRDALERSNIPAIVMSAISMVGVTDHYDRRKAMRHLKTGEVVI
PYRH_STRT2      PAAEAG-MDRVQADYTGMLGTTMNALVMADSLKQLGVDTRVQTAIDMKSVAEPYIRGRALRHFEKGRIVI
PYRH_STRCO      ELQVRG-MDRARSDYMGMLGTVMNCLALQDFLEKEGVDCRVQTAITMGQVAEPYIPLRAVRHLEKGRVVI
PYRH_NITOC      LAAVG--MDRVTGDHMGMLATVMNALALQDALERLGVFCRVMSAIRINEVCEDYLRRRAIRHLEKGRLVI
PYRH_PELCD      XXXXXXXXXXXXXXXXXL-ATIMNSLALQDALEQAGVPTRVQTAIEMREVAEPYIRRRAIRHLEKKRVVI
PYRH_PASMU      KAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRADVNAKLMSAFQLNGICDTYNWSEAIKMLREKRVVI
PYRH_CAMHC      SAAAGGIIKRTSGDHMGMLATVINAIAMREALEFYDVDVRVQSAIKMEAICETFIIGRAKRHLEKGRVVI
PYRH_VIBPA      LAEAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARVMSAIPLKGVCDDYNWADAIRELRQGRVVI
PYRH_HELPY      SAAQGGIIRRTSGDYMGMLATVINAVAMQEALEHIGLDTRVQSAIEIKEICESYIYRKAIRHLEKGRVVI
PYRH_HELPH      SAAQGGIIRRTSGDYMGMLATVINAVAMQEALEHIGLDTRVQSAIEIKEICESYIYRKAIRHLEKGRVVI
PYRH_CALS8      SAEH---IDRATADYMGMLATVINSLALQSILEKRGIPTRVQSAIEMRQIAEPYIRRRAIRHLEKGRVVI
PYRH_STRAW      ELQ-QRGMDRARSDYMGMLGTVMNCLALQDFLEKEGIDSRVQTAITMGQVAEPYIPLRAVRHLEKGRVVI
PYRH_SOLUE      AAA-ARSMDRVTGDHMGMLATVINSLALSDALEQMGIPTRVMSAIEMHQVAEPYIRRRAIRHLEKGRIVI
PYRH_GLUOX      LAAAAKGMDRAQGDYAGMLATVINALMLQNALERRGMETRVMTAIQMAAIAEPYIRRRAVRHMEKGRVVI
PYRH_ACIC1      ELSVRG-MDRARSDYMGMLGTVMNCLALQDFLEKLGVDTRVQTAITMGQVAEPYIPRRAIRHMEKGRVVI
PYRH_STAS1      KTGSDLGMDRGTADYMGMLATVMNALALQDSLEQLECDTRVLTSIEMKQVAEPYIRRRAIRHLEKNRVVI
PYRH_PSEU5      ALSAAG-MDRVTGDHMGMLATVMNALAMRDALERSNIPALVMSAISMVGVTDHYDRRKAMRHLKSGEVVI
PYRH_HELPJ      SAAQGGIIRRTSGDYMGMLATVINAVAMQEALEHIGLDTRVQSAIEIKEICESYIYRKAIRHLEKGRVVI
PYRH_HELAH      SAAQGGIIRRTSGDYMGMLATVINAVAMQEALEHIGLDTRVQSAIEIKEICESYIYRKAIRHLEKGRVVI
PYRH_SULNB      SAAADGIIKRTSGDYMGMLATVINGVAIQEALEHIGLEARLQSAIDMHEIGEAFIIRRARRHLEKGRVVI
PYRH_CHLTR      SQSQSLQINRVSADQMGMLATLINGMALADALKTEDVPNLLTSTLSCPQLAELYNPQKASDALSQGKVVI
PYRH_STAAW      KTGSDLGMDRGTADYMGMLATVMNALALQDSLEQLDCDTRVLTSIEMKQVAEPYIRRRAIRHLEKKRVVI
PYRH_STAAS      KTGSDLGMDRGTADYMGMLATVMNALALQDSLEQLDCDTRVLTSIEMKQVAEPYIRRRAIRHLEKKRVVI
PYRH_STAAR      KTGSDLGMDRGTADYMGMLATVMNALALQDSLEQLDCDTRVLTSIEMKQVAEPYIRRRAIRHLEKKRVVI
PYRH_STAAN      KTGSDLGMDRGTADYMGMLATVMNALALQDSLEQLDCDTRVLTSIEMKQVAEPYIRRRAIRHLEKKRVVI
PYRH_STAAM      KTGSDLGMDRGTADYMGMLATVMNALALQDSLEQLDCDTRVLTSIEMKQVAEPYIRRRAIRHLEKKRVVI
PYRH_STAAC      KTGSDLGMDRGTADYMGMLATVMNALALQDSLEQLDCDTRVLTSIEMKQVAEPYIRRRAIRHLEKKRVVI
PYRH_STAAB      KTGSDLGMDRGTADYMGMLATVMNALALQDSLEQLDCDTRVLTSIEMKQVAEPYIRRRAIRHLEKKRVVI
PYRH_STAA8      KTGSDLGMDRGTADYMGMLATVMNALALQDSLEQLDCDTRVLTSIEMKQVAEPYIRRRAIRHLEKKRVVI
PYRH_STAA3      KTGSDLGMDRGTADYMGMLATVMNALALQDSLEQLDCDTRVLTSIEMKQVAEPYIRRRAIRHLEKKRVVI
PYRH_STAA1      KTGSDLGMDRGTADYMGMLATVMNALALQDSLEQLDCDTRVLTSIEMKQVAEPYIRRRAIRHLEKKRVVI
PYRH_CHLTA      SQSQSLQINRVSADQMGMLATLINGMALADALNTEDVPNLLTSTLSCPQLAELYNPQKASDALSQGKVVI
PYRH_STAAE      KTGSDLGMDRGTADYMGMLATVMNALALQDSLEQLDCDTRVLTSIEMKQVAEPYIRRRAIRHLEKKRIVI
PYRH_RHOPB      EVS-SRGVSRPTGDTMGMLATVMNCXXXXXXXXXXXXXXXTLSAFVMPQVCELFTRGAAHRYLAEGKIVL
PYRH_PSEAE      ALSAAG-MDRVTGDHMGMLATVMNGLAMRDALERSNIPALVMSAISMVGVTDHYDRRKAMRHLGGGEVVI
PYRH_PSEAB      ALSAAG-MDRVTGDHMGMLATVMNGLAMRDALERSNIPALVMSAISMVGVTDHYDRRKAMRHLGGGEVVI
PYRH_STAES      KTGSDLGMDRGTADYMGMLATVMNALALQDSLEQLDCDTRVLTSIEMKQVAEPYIRRRAIRHLEKKRVVI
PYRH_STAEQ      KTGSDLGMDRGTADYMGMLATVMNALALQDSLEQLDCDTRVLTSIEMKQVAEPYIRRRAIRHLEKKRVVI
PYRH_CLOD6      RTSEG--MDRTTADYIGMLATVMNAMALQDALENIDVATRVQTAIDMRQIAEPYIRRRAVRHLEKERVVI
PYRH_SYNAS      EAN-AKGMDRTSADYMGMLATVINSLALQSAFERIGIDTRVQSAIAMREIAEPFIQRKAMSHLEKRRVMI
PYRH_STAHJ      KTGSDLGMDRGTADYMGMLATVMNALALQDSLEQLECDTRVLTSIEMKQVAEPYIRRRAIRHLEKKRVVI
PYRH_PSEA7      ALSAAG-MDRVTGDHMGMLATVMNGLAMRDALERSNIPALVMSAISMVGVTDHYDRRKAMRHLNGGEVVI
PYRH_CORJK      ELQ-QRGLDRSRSDYMGMLGTVMNCLALQDFLEQEGVDCRVQTAIQMTQVAEPYLPLRASRHLEKGRVVI
PYRH_AERHH      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAISLQGICDSYVWAEAISQLRAGKVVI
PYRH_PSEU2      ALSAAG-MDRVTGDHMGMLATVMNALAMRDALERANITAIVMSAISMVGVTDHYDRRKAMRHLSAKEVVI
PYRH_PSEPK      ALSAAG-MDRVTGDHMGMLATVMNGLAMRDALERSNIPALVMSAISMVGVTDHYDRRKAIRHLNSGDVVI
PYRH_PSEP1      ALSAAG-MDRVTGDHMGMLATVMNGLAMRDALERSNIPALVMSAISMVGVTDHYDRRKAIRHLNSGDVVI
PYRH_BRASO      XXS-SQGVSRATGDTMGMLATVMNSLALEAALQRKGAPAVALSAFVMPQVCELFTRAAAHRALAEGRIVV
PYRH_ALKMQ      --RTGEGMDRTTADYMGMMATVINALALQDALENIEILTRVQTAIEMRQIAEPYIRRRAVRHLEKNRVVI
PYRH_PSESM      ALSAAG-MDRVTGDHMGMLATVMNALAMRDALERANITAIVMSAISMLGVTDHYDRRKAMRHLSAKEVVI
PYRH_PSEE4      ALSAAG-MDRVTGDHMGMLATVMNGLAMRDALERSNIPALVMSAISMVGVTDHYDRRKAIRHLNTGDVVI
PYRH_PSE14      ALSAAG-MDRVTGDHMGMLATVMNALAMRDALERANITAIVMSAISMLGVTDHYDRRKAMRHLSAKEVVI
PYRH_MYCSS      QLQ-QRGMERTRSDYMGMLGTVMNSLALQDFLEKEGIDTRVQTAITMGQVAEPYIPLRAVRHLEKGRVVI
PYRH_MYCSK      QLQ-QRGMERTRSDYMGMLGTVMNSLALQDFLEKEGIDTRVQTAITMGQVAEPYIPLRAVRHLEKGRVVI
PYRH_MYCSJ      QLQ-QRGMERTRSDYMGMLGTVMNSLALQDFLEKEGIDTRVQTAITMGQVAEPYIPLRAVRHLEKGRVVI
PYRH_CAMC1      SAAKDGIIKRTSGDHMGMLATVINSIAMREALERSGLEVRVQSAIKMEAICETFIVGRAQRHLEKGRVVI
PYRH_FRAAA      QSDRWG-IDRVEADNIGMLGTVINSLLLRGKLTALGEDLRVMTAVPVPAVAEPYIRLRAVHLLEKGATVI
PYRH_CORDI      QLQ-QRGLDRNRSDYMGMLGTVMNCLALQDFLEQEGIDCRVQTAINMAQVAEPYLPLRAKRHLEKGRVVI
PYRH_BAUCH      LAHLG--IQRVVCDHMGMLATVINSLAIRNTMLHININANILSAIPLDGICELYNLDKAIDLLEKNIVVI
PYRH_PSEF5      ALSAAG-MDRVTGDHMGMLATVMNALAMRDALERANISAIVMSAISMVGVTDHYDRRKAMRHLNSKEVVI
PYRH_PARUW      NLK-ANGMPRVPADHMGMLATLLNGIALQQALISLEVKTCVMSALDCP---KVAESYQWSQYLEEGVVVI
PYRH_NEIMF      SAQAGS-MDRATADYMGMMATVMNALALKDAFETLGIKARVQSALSMQQIAETYARPKAIQYLEEGKVVI
PYRH_LACS1      EAGAEIGMERAQADYIGMLGTVMNALALQDSLESVGVPTRVQTAIEMRQVAEPYIRRKAIRHLEKGRIVI
PYRH_COREF      ELQ-QRGMDRARSDYMGMLGTVMNCLALQDFLGQHGVECRVQTAINMAQVAEPYLPLRAERHLEKGRVVI
PYRH_BARHE      VASHGGD--RVTGDHMGMLATAINSLALRTSLTKLGVETVVLSAIAMPQICESFSQRKAIGYMNQGRVVI
PYRH_MARAV      ALNAAG-LDRVTGDHMGMLATVMNGLAMRDALERSNIRTRVMSAIPMSGIVEHYDRRRAVRDLKEGDVVI
PYRH_LACDB      TAKLG--MERAQADYMGMLATIMNGLALQDGLETAGVQTRLQTSISMRQVAEPYIRRVAISHMEKNRVVI
PYRH_LACDA      TAKLG--MERAQADYMGMLATIMNGLALQDGLETAGVQTRLQTSISMRQVAEPYIRRVAISHMEKNRVVI
PYRH_IDILO      LAKAG--MNRVVGDHMGMLATVMNGLAMRDALHRAFVNARLMSAIELTGVCDSYNWAEAISLLKSGRVVI
PYRH_BRASB      XXS-SQGVSRPTGDTMGMLATVMNCLALEAAIQRKGAPAQALSAFVMPQVCELFTRAAAHKALAEGRIVV
PYRH_SACD2      ALSRAG-LDRVTGDHMGMLATVMNALAMRDALERSNISSTVMSAIPMHGVTDQYDRRKALRLLDNGEVVI
PYRH_NEIG1      SAQAGS-MDRATADYMGMMATVMNALALKDAFETLGIKARVQSALSMQQIAETYARPKAIQYLEEGKVVI
PYRH_RICAH      NAALVG-MDRASADYIGMLATVINALTLQNVMESLDIYTRVLSAIPMMSVCEPYIRRKAKRHMEKKRVVI
PYRH_PSEPF      ALSKAG-MDRVTGDHMGMLATVMNALAMRDALERANISAIVMSAISMVGVTDHYDRRKAMRHLNSKDVVI
PYRH_CAMJR      SAAKGGLIKRTSGDHMGMLATVINAIAIQEALESSGLEVRVQSAIQMEAFCETYIMRRAQRHLEKGRVVV
PYRH_CAMJJ      SAAKGGLIKRTSGDHMGMLATVINAIAIQEALESSGLEVRVQSAIQMEAFCETYIMRRAQRHLEKGRVVV
PYRH_CAMJE      SAAKGGLIKRTSGDHMGMLATVINAIAIQEALESSGLEVRVQSAIQMEAFCETYIMRRAQRHLEKGRVVV
PYRH_CAMJ8      SAAKGGLIKRTSGDHMGMLATVINAIAIQEALESSGLEVRVQSAIQMEAFCETYIMRRAQRHLEKGRVVV
PYRH_NEIMB      SAQAGS-MDRATADYMGMMATVMNALALKDAFETLGIKARVQSALSMQQIAETYARPKAIQYLEEGKVVI
PYRH_NEIMA      SAQAGS-MDRATADYMGMMATVMNALALKDAFETLGIKARVQSALSMQQIAETYARPKAIQYLEEGKVVI
PYRH_MYCVP      QLQ-QRGMDRARSDYMGMLGTVMNSLALQDFLQKEGIDTRVQTAITMGQVAEPYIPLRAVRHLEKGRVVI
PYRH_SYMTH      RLGEQMGMDRASADYMGLLATVMNALALQDAIEKLQVDTRVMTAVEMRQVAEPFIRRRAIRHLEKGRVVI
PYRH_MYCS2      QLQ-QRGMERTRSDYMGMLGTVMNSLALQDFLQKEGIDTRVQTAITMGQVAEPYIPLRAVRHLEKGRVVI
PYRH_OENOB      PAAKAG-MDRARADYIGMLGTVMNALSLADALEQAGVVTRVLTAIEMRQIAEPYIRGRAIRHLEKGRIVI
PYRH_GEOKA      KTGSEMGMDRATADYMGMLATVMNALALQDSLEQLGVETRVQTSIEMRQVAEPYIRRRAIRHLEKKRVVI
PYRH_CAMJD      SAAKGGLIKRTSGDHMGMLATVINAIAIQEALERSGLEVRVQSAIQMEAFCETYIMRRAQRHLEKGRVVV
PYRH_RHOSR      ELQ-QRGLDRARSDYMGMLGTVMNCLALQDFLEKEGIDSRVQTAITMGQVAEPYIPLRAQRHLEKGRVVI
PYRH_RHILO      VASKGGD--RVTGDHMGMLATVINSLALRTSLHKIGVDAVVLSAIAMPELCESFSQRQADAYMNQGRVVI
PYRH_CORGL      ELQ-QRGMDRARSDYMGMLGTVMNCLALQDFLGQHGVECRVQTAINMAQVAEPYLPLRAERHLEKGRVVI
PYRH_CORGB      ELQ-QRGMDRARSDYMGMLGTVMNCLALQDFLGQHGVECRVQTAINMAQVAEPYLPLRAERHLEKGRVVI
PYRH_CAMFF      SAAKDGIIKRTSGDHMGMLATVINAIAMREALEYSGLSVRVQSAIKMEAICETFIMGRAQRHLEKGRVVI
PYRH_SULDN      TAAQDGIIKRTSGDYMGMLATVINGIAMQEACEHAGLQVRMQTAIKMEQIAEPYINRRAVRHLEKGRVVI
PYRH_MYCHJ      SAA-KNGINRNTADYIGMLGTVMNGLALDSVFRDLGIKTRVLSSMSLDPRICEYFVREKAMKLEDNNVLI
PYRH_MYCH7      SAA-KNGINRNTADYIGMLGTVMNGLALDSVFRDLGIKTRVLSSMSLDPRICEYFVREKAMKLEDNNVLI
PYRH_MYCH2      SAA-KNGINRNTADYIGMLGTVMNGLALDSVFRDLGIKTRVLSSMSLDPRICEYFVREKAMKLEDNNVLI
PYRH_BUCBP      KAKFG--INKVISDYVGMLSTIMNGLLLCDSMDLVHLSSCLMSSICIDKICEQYSFKKALSLLRRNKVVV
PYRH_BACSU      KTGSDLGMDRATADYMGMLATVMNSLALQDSLETLGIQSRVQTSIEMRQVAEPYIRRKAIRHLEKKRVVI
PYRH_RHOPS      EVS-ARGVSRPTGDTMGMLATVMNCLALGEALQRHGQKARTLSSFVMPQVCDLYTRAAAQQXXXXXXXXX
PYRH_RUBXD      QVADELGIESATADYMSMLGTVINALALQAALERRGVPTRVQSAIEIKEVAEPYIRRRAIRHLEKGRVVI
PYRH_RHOP2      EVS-ARGVSRPTGDTMGMLATVMNCLALGEALRRHGQPARTFSALLMPEVCDLYTRAAAQQTXXXXXXXX
PYRH_PARD8      LSGASKGFDRVKGDQMGMLATVINSLALSSALVAQGVNAKVLTAIRMEPIGEFYNKWRAIELLEQGNVVI
PYRH_FRASC      QSDRWG-IDRVEADNIGMLSTVINSLLLRGKLTALGEDLRVMTAVPVPAVAEPYIRLRAVHLLEKGATVI
PYRH_BLOPB      EL-VKSGMNRIVGDHIGMLATIMNGLAMRSALNHAYVHSHLMSAIPLNGVCDHYNWMKAINLLSNNWVVI
PYRH_ACIBL      -AEQAKDMDRVSADHMGMLATVMNSLAVQDALEKQNVQCRVMSAIEIFQVAEPFIRRRAMRHLEKGRVVI
PYRH_RHIEC      VASKGGD--RVTGDHMGMLGTIINALALATSLRKLNIDTVVLSAISMPEICESFSQRATLYHLSMGRVVI
PYRH_CHLMU      SQSQNLQINRVSADQMGMLATLINGMALADALKTEDVPNLLTSTLSCPQLAELYNPQKASDALSQGKVVI
PYRH_ROSS1      QA-IARGMDAAQSHYMGMLATIINALALQDALERRGIFTRAMTAIKMDEVAEPYIRRRATRHLEKGRVII
PYRH_BRAJA      XXXXXXXXX-PTGDTMGMLATMMNCLALEAAIERKGTPARTLSAFVMPEISELFTRTAAHKYLAEGRIVL
PYRH_BACHD      MAGSAKGMDRATADYMGMLATVMNSLALQDSLENLDVQSRVQTSIEMRQVAEPYIRRRAIRHLEKKRVVI
PYRH_SACEN      ELQ-QRGMERARGDYMAMLGTVMNCLALQDFLEREGIDTRVMTAITMGQVAEPYIPRRAARHMEKGRVVI
PYRH_ARCB4      TAAADGVIKRTSADYMGMLGTVINGVAMQEALEYKGLSARLQTAIKMEQIAEPFIVRKAMRHFEKGRVVI
PYRH_MYCCT      LGNIG--MDAINADYMGMLATVMNGLALESTITKMGYDKKVYSSLPIKTVTDDYNFKKARIKMNEGFISI
PYRH_PORGI      AKGFD----RVKGDQMGMLATVINSLALSSALEGVGVKTKVLTAVRMEPIGEFYNKWHAIELLEQGYVTI
PYRH_SALRD      EHAMEG-MTRAHADYMGMLATMINGMALQDAFEQVDLVTRLQSSIKMEEIAEPFIRRRAIRHLEKGRVVI
PYRH_STRGC      PAAEAG-MDRVQADYTGMLGTVMNALVMADSLQRVGVDTRVQTAIAMQQVAEPYIRGRALRHLQKGRIVI
PYRH_DESHY      IAGSKQGMDRANADYMGMLATVMNALALQDAMEKAGAATRVLSAIEMRQVAEPYIRRRAIRHLEKGRVVI
PYRH_BLOFL      RVQFG--MNKVIGDHIGMLATIMNGLVMHNALHRVYVDSSVMSAIPLQGVCDNYNWMRAIDLLSNNKVVI
PYRH_MESSB      ---------RVTGDHMGMLATVINSLALRTSLAKIGVEAVVLSAIAMPELCESFSQRQALAYMDAGKVVI
PYRH_LACH4      TAKLG--MERAQADYMGMLATIMNGLALQDGLEKVGVPTRMQTSIEMRQIAEPYIRRRALRHLEKGRVVI
PYRH_STRPN      PAAEAG-MDRVQADYTGMLGTVMNALVMADSLQQVGVDTRVQTAIAMQQVAEPYVRGRALRHLEKGRIVI
PYRH_THELT      ELS---EIPHSLADQIGMLGTVINALYLKGSLQKVGIKCVVVSQ--VTSLPSIRPIHDINLYFDAGYVVI
PYRH_ORITB      SAEYW-KIERAEADNVGMLGTIINALMLKAALEKESYKVRVMSAIKIEAVAEPFIRSRALSHLYKGYLII
PYRH_AGRT5      VASKGGD--RVTGDHMGMLATVINALALATSLRKLSIDTVVLSAIAMPEICESFSQRAALHHLAQGRVVI
PYRH_MYCMO      SAS-KNGIPRTRADYIGMLATTMNALALQSGFESVGLKARVQSSLSIDG--KVAENYKAKHYLSNGEIVI
PYRH_BACTN      GANKG--FDRVKGDQMGMLATVINXXXXXXXXXXXGVKARVLTAVRMEPIGEFYSKWKAIECMENGEIVI
PYRH_THEP1      ELK---NLTMARADQIGLLGTVMNSVYLKDIFERSGLKARIYSQIVNLPDVERVNYDSIESALRENSILI
PYRH_THEMA      ELK---NLTMTRADQIGLLGTVMNSVYLKDIFERSGLKARIYSQIVNLPDVERVNYDSIESALRENSILI
PYRH_STRSY      PAAEAG-MDRVQADYTGMLGTVMNALVMADSLKQLGVDTRVQTAIAMQSVAEPYIRGRALRHLEKGRIVI
PYRH_STRS2      PAAEAG-MDRVQADYTGMLGTVMNALVMADSLKQLGVDTRVQTAIAMQSVAEPYIRGRALRHLEKGRIVI
PYRH_STRR6      PAAEAG-MDRVQADYTGMLGTVMNALVMADSLQQVGVDTRVQTAIAMQQVAEPYVRGRALRHLEKGRIVI
PYRH_STRP2      PAAEAG-MDRVQADYTGMLGTVMNALVMADSLQQVGVDTRVQTAIAMQQVAEPYVRGRALRHLEKGRIVI
PYRH_BACFR      GANKG--FDRVKGDQMGMLATVINXXXXXXXXXXXGVKARVLTAVRMEPIGEFYSKWKAIECMENGEIVI
PYRH_BACFN      GANKG--FDRVKGDQMGMLATVINXXXXXXXXXXXGVKARVLTAVRMEPIGEFYSKWKAIECMENGEIVI
PYRH_ARTS2      ELSQSG-MDRSRADYMGMLGTVMNCLALQDFLEQAGVETRVQSAITMGQVAEAYIPRRAIRHMEKGRVVI
PYRH_MYCS5      SAE-KNGIPRNRADFIGMLATEMNALALQSGFEKAGLKARVQSSINIDQ--KVAENY-INEKTLKGEVVI
PYRH_AYWBP      RTGEELGMDRSQADYMGMLGTIMNSLALQDALEQTNTITRVMTAFPVSSVAEPYIRRKAIRHLEKDRVVI
PYRH_LEIXX      ELS-QRGMDRGRADYMGMLGTVMNSLALQDFLEQAGAETRVQSAIEMIQVAEPYIPLRAERHLEKGRIVI
PYRH_TROWT      ELS-RRGMARDRADYMGMLGTVINALALQDFLEQAGGDTRVQSAISMSQVAELYVPRRAERHLTKGRVVI
PYRH_TROW8      ELS-RRGMARDRADYMGMLGTVINALALQDFLEQAGGDTRVQSAISMSQVAELYVPRRAERHLTKGRVVI
PYRH_STRA5      PAAEAG-MDRVQADYTGMLGTVMNALVMADSLQQYGVDTRVQTAIPMQTVAEPYVRGRALRHLEKNRIVV
PYRH_STRA1      PAAEAG-MDRVQADYTGMLGTVMNALVMADSLQQYGVDTRVQTAIPMQTVAEPYVRGRALRHLEKNRIVV
PYRH_STRA3      PAAEAG-MDRVQADYTGMLGTVMNALVMADSLQQYGVDTRVQTAIPMQTVAEPYVRGRALRHLEKDRIVV
PYRH_NOCSJ      ELQ-QRGMDRVRADYMGMLGIVMNCLALQDFLEKLGVETRVQTAITMGQVAEPYIPRRAIRHMEKGRVVI
PYRH_MYCPE      --NIAKEIQRYKADQMGMLATVMNSLALQSLLTNINVKSRIFSTIEMEKIADSYIIRNLEESLNNNEIAI
PYRH_NOCFA      -------MERARSDYMGMLGTVMNSLALQDFLQKQGVDTRVQTAITMGQVAEPYLPLRAKRHLEKGRVVI
PYRH_ONYPE      RTGEELGMDRSQADYMGMLGTIMNSLALQDALEQTNTITRVMTAFPVSSVAEPYIRRKAIRHLEKDRVVI
PYRH_BACV8      LSGASKGFDRVKGDQMGMLATVINXXXXXXXXXXXXVKARVLTAIRMEPIGEFYNKWKAIEAMENGEVVI
PYRH_UREPA      IAKELD-MDRNLADNMGMMATIINGLALENALNHLNVNTIVLSAIKCDKLVHESSANNIKKAIEKEQVMI
PYRH_STRPM      PAADAG-MDRVQADYTGMLGTVMNALVMADSLQHYGVDTRVQTAIPMQNVAEPYIRGRALRHLEKNRIVV
PYRH_STRPG      PAADAG-MDRVQADYTGMLGTVMNALVMADSLQHYGVDTRVQTAIPMQNVAEPYIRGRALRHLEKNRIVV
PYRH_STRPF      PAADAG-MDRVQADYTGMLGTVMNALVMADSLQHYGVDTRVQTAIPMQNVAEPYIRGRALRHLEKNRIVV
PYRH_STRPC      PAADAG-MDRVQADYTGMLGTVMNALVMADSLQHYGVDTRVQTAIPMQNVAEPYIRGRALRHLEKNRIVV
PYRH_STRPB      PAADAG-MDRVQADYTGMLGTVMNALVMADSLQHYGVDTRVQTAIPMQNVAEPYIRGRALRHLEKNRIVV
PYRH_STRP8      PAADAG-MDRVQADYTGMLGTVMNALVMADSLQHYGVDTRVQTAIPMQNVAEPYIRGRALRHLEKNRIVV
PYRH_STRP6      PAADAG-MDRVQADYTGMLGTVMNALVMADSLQHYGVDTRVQTAIPMQNVAEPYIRGRALRHLEKNRIVV
PYRH_STRP3      PAADAG-MDRVQADYTGMLGTVMNALVMADSLQHYGVDTRVQTAIPMQNVAEPYIRGRALRHLEKNRIVV
PYRH_STRP1      PAADAG-MDRVQADYTGMLGTVMNALVMADSLQHYGVDTRVQTAIPMQNVAEPYIRGRALRHLEKNRIVV
PYRH_OCHA4      AASKGGD--RVTGDHMGMLATVINSLALRTSLHKIGVDSVVLSAIAMPEICESFSQRQATAYMDEGKVVI
PYRH_BRUAB      AASKGGD--RVTGDHMGMLATVINSLALRTSLHKIGVDSVVLSAIAMPEICESFSQRQATAYMDEGKVVI
PYRH_STRPD      PAADAG-MDRVQADYTGMLGTVMNALVMADSLQHYGVDTRVQTAIPMQNVAEPYIRGRALRHLEKNRIVV
PYRH_MYCA1      QLQ-QRGMERTRSDYMGMLGTVMNSLALQDFLEKEGIVTRVQTAITMGQVAEPYLPLRAVRHLEKGRVVI
PYRH_MESFL      KLGTDIDMPQINADYMGMLATVMNGLALESTIKRLGYDVNVYSSLPIETVTDDYNFKRARLKMNEGYISI
PYRH_BRUSU      AASKGGD--RVTGDHMGMLATVINSLALRTSLHKIGVDSVVLSAIAMPEICESFSQRQATAYMDEGKVVI
PYRH_MYCPA      QLQ-QRGMERTRSDYMGMLGTVMNSLALQDFLEKEGIVTRVQTAITMGQVAEPYLPLRAVRHLEKGRVVI
PYRH_LISW6      --KLGSEMGRAAADQMGMLATIMNSLSLQDSLENIGVATRVQTSIDMRQIAEPYIRRKAIRHLEKGRVVI
PYRH_LISMO      --KLGSEMGRAAADQMGMLATIMNSLSLQDSLENIGVATRVQTSIDMRQIAEPYIRRKAIRHLEKGRVVI
PYRH_LISMF      --KLGSEMGRAAADQMGMLATIMNSLSLQDSLENIGVATRVQTSIDMRQIAEPYIRRKAIRHLEKGRVVI
PYRH_LISIN      --KLGSEMGRAAADQMGMLATIMNSLSLQDSLENIGVATRVQTSIDMRQIAEPYIRRKAIRHLEKGRVVI
PYRH_MYCPN      SCSDYN-ITEIAGHHLGIMATVINGAFLKAKFDSHKLNSTLLSAVSCPSLATIVSQTTIDDAFKNHDIVI
PYRH_SINMW      VASKGGD--RVTGDHMGMLATVINALALATSLRKLDIDTVVLSAIAMPEICESFSQRATLYHLSLGRVVI
PYRH_MYCLE      QLQ-QRGMERTRSDYMGMLGTVMNSLALQDFLEKEGIATRVQTAITMGQVAEPYLPLRAVRHLEKGRVVI
PYRH_RHIME      VASKGGD--RVTGDHMGMLATVINALALATSLRKLDIDTVVLSAIAMPEICESFSQRATLYHLSLGRVVI
PYRH_MYCTU      -------MERTRSDYMGMLGTVMNSLALQDFLEKEGIVTRVQTAITMGQVAEPYLPLRAVRHLEKGRVVI
PYRH_MYCTA      -------MERTRSDYMGMLGTVMNSLALQDFLEKEGIVTRVQTAITMGQVAEPYLPLRAVRHLEKGRVVI
PYRH_MYCBP      -------MERTRSDYMGMLGTVMNSLALQDFLEKEGIVTRVQTAITMGQVAEPYLPLRAVRHLEKGRVVI
PYRH_MYCBO      -------MERTRSDYMGMLGTVMNSLALQDFLEKEGIVTRVQTAITMGQVAEPYLPLRAVRHLEKGRVVI
PYRH_BRUME      AASKGGD--RVTGDHMGMLATVINSLALRTSLHKIGVDSVVLSAIAMPEICESFSQRQATAYMDEGKVVI
PYRH_ARTAT      ELSQSG-MDRSRADYMGMLGTVMNCLALQDFLEQAGVETRVQSAITMGQVAEAYIPRRAIRHMEKGRVVI
PYRH_MYCGA      LADFGVEINKA--DYIGMLATVINSTLLESKLQSLGLKTKVLSALEVKGLTNEINPKSLAEVFSDCQIAF
PYRH_RHIL3      VASKGGD--RVTGDHMGMLGTIINALALATSLRKLNIDTVVLSAISMPEICESFSQRATLYHLSMGRVVI
PYRH_CLAM3      QLS-QRGMDRGRADYMGMLGTVMNALALQDFLEQAGAATRVQSAISMTQVAEPYIPRRAVRHLEKGRIVI
PYRH_PROAC      ELQ-QHGMQRDRADYMGMLGTVMNCLALQDFCEKAGVDTRVQTAITMGQVAEPYIPRKAERHMEKGRVVI
PYRH_WIGBR      QLKI-HGIKRNIGDHIGMMSTLINGLFIYNHFERLNIKSQLISPFNINGICESYNIFRINKILKK-KIVI
PYRH_THIDA      TGALAG-MNRATADSMGMLATVMNALALKDALQQAGVAARVQTAVHIAHVGEGFERDAAVRELEAGRVVI
PYRH_BUCCC      DLEKIG-MRRSISDKIGMLSTVMNGLLLHEFMQTANIKSKIFSSTLLEGICERYHIDKAIKCLEKKSVAI
PYRH_BIFLO      ELQQAG-IDRSRGDYMGMLGTVMNCLALQDFLEQEGQATRVQTAITMGQVAEPYIPLKAIRHLEKGRVVI
PYRH_BIFAA      ELQQAG-IDRSRGDYMGMLGTVMNCLALQDFLEQEGQATRVQTAITMGQVAEPYIPLKAIRHLEKGRVVI
PYRH_MYCGE      CQEFN--IAEYHGHQLGIIATVVNGYFLKAKLDAHNLKSALLSAISCPSLVQILSQQTIDKAFEENDFVI
PYRH_METJA      YIEIGRELGASESDELGIMATRMNAMIL-------------ITALGDYSIKKVPTSFEEAELILNLGKIP
PYRH_META3      ISVAREFANESFCDEIGILATRMNSMLLISALDNYAVKKVPENFKDAEIILNLNK-------------IV
PYRH_METVS      IKVSREFTNESVCDEIGIMATRMNAMLLISALSKYSVNFVPTNFKDAEMILNL------------GKILV
PYRH_METM6      ISVAREFTNESFCDEIGILATRMNSMLL-------------ISALGKDAVKHVPENFKDAELILNMDKIL
PYRH_METB6      -------IDEGTSDEIGILVTRLNATLL-------------IAALGDAAYPKVAESHSEAKKFGESKKIV
PYRH_THEVO      ISLLRSLINENMLDEIGIYATRMNALSLASLL--KGANPIIPST--VEEAVNLMSEYRF----------V
PYRH_METM7      ISVAREFTNESFCDEIGILATRMNSMLL-------------ISALGKDAVKQVPENFKDAELILNMDKIL
PYRH_METM5      ISVAREFTNESFCDEIGILATRMNSMLL-------------ISALGKDAVKQVPENFKDAELILNMDKIL
PYRH_METMP      ISVAREFANESFCDEIGILATRMNSMLL-------------ISALGKDAVKQVPENFKDAEIILNMDKIL
PYRH_METS3      VRELG--AGEAQCDDIGIEVTRINAKLL-------------LSALGDAAYQKVP--HNFQEALATGKIIV
PYRH_METST      --DYISVVRESICDEIGIQVTRINALALKDVS---------YPAIPVN----FQQALEFS---ATGKIVV
PYRH_SULTO      YIKIGREVNEAHLDLLGIWASRLNAYLLTFIL------SDLSYMKVPENL------EEFIEKWESEKVVI
PYRH_METHJ      ISLARSEADEAFSDELGIMVTRLNATLL-------------VGALGQAAYPCVVTSHEALCAAETGKIVV
PYRH_PICTO      -------------DEIGINATRINALAMTTFL--DDVNS------------KIPTTVNDAAEMMHDYRYV
PYRH_METTH      ARELGAS--EARCDDIGIDVTRLNA---RLLITALGDSAYPGVPENFREALEVA---------ATGRIVV
PYRH_SULAC      -------------DILGILVSRLNAQLL------------LFSLDNIAYPKVPESIEDFNERWASGKVVI
PYRH_METMA      RAMGADEV---TCDYIGIEITRLNARLL-------------ISALGHDAYPEIPSNYEASKAMTSGKVVV
PYRH_THEAC      -------------DEIGIYATRMNALSMASLIPGSNPTIPFT----VEDAVNLMNTYRF----------V
PYRH_METMJ      ---------------------------------------------------RVAENYTEAQEFAQAGKIV
PYRH_METAC      RAMGADEV---TCDYIGIDITRLNARLL-------------IAALGPDGYPEIPTNYEASKAINSGKVVV
PYRH_CENSY      -----------------------------------------------------------------GGLVV
PYRH_METS5      RSL---NLNEASLDLLGIWVARLNALSMPDLAYSRIPE----------------SLEQFLEYWGHGKVVV
PYRH_HALSA      -------------DDIGVDVTRLNA---RLLIAALGGDAAPSPAEDYE---------DAGEAMRRGDIAV
PYRH_HALS3      -------------DDIGVDVTRLNA---RLLIAALGGDAAPSPAEDYE---------DAGEAMRRGDIAV
PYRH_METLZ      EACRDIGLDEASSDEIGIQVTRINAALL------------IGALKEYAYPVVAESYREAKTAAVSGKIVV
PYRH_METBU      GAN------EVVCDFIGIDITRLNAQLLIAALGNTAHPEPPTTYK------------EAESALASGKIVV
PYRH_STAMF      YAREIGVSSNYWLDMIGIRSAQLNAYLLISSLYPKAYPEPV---NNLEELLRIMN----NYEIAVLGGLI
PYRH_METBF      RAVGADEV---TCDYIGIEITRLNAHLLA-------------AALGPDACPEIPTNYEASKAIRPGKVVV
PYRH_THEON      ----------------------------------------------------------------------
PYRH_PYRKO      ----------------------------------------------------------------------
PYRH_ARCFU      -------------DYIGIAATRLNAMLL--------ISAIPSAAK------KVPVDFMEAEELSKLYRVV
AK_PSEAE        LIGLANQIMEQPVDVMVSTGEQV