[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD31463.1

[Show Plain Result]


## Summary of Sequence Search
    1::1290
    3::1295      0.0  57% 1295 aa  PUR4_PHOLL RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1296      0.0  58% 1296 aa  PUR4_PSEHT RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1297      0.0  58% 1298 aa  PUR4_PSEU2 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1297      0.0  58% 1298 aa  PUR4_PSE14 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1297      0.0  58% 1298 aa  PUR4_PSESM RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    1::1293      0.0  58% 1297 aa  PUR4_PASMU RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    6::1298      0.0  58% 1298 aa  PUR4_HAHCH RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1322      0.0  57% 1322 aa  PUR4_PHOPR RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    1::1295      0.0  57% 1295 aa  PUR4_SHIDS RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    1::1295      0.0  57% 1295 aa  PUR4_ECOLI RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    1::1295      0.0  57% 1295 aa  PUR4_ECO57 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    1::1295      0.0  57% 1295 aa  PUR4_SHISS RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1297      0.0  57% 1298 aa  PUR4_PSEAE RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    1::1295      0.0  56% 1295 aa  PUR4_SHIBS RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1297      0.0  58% 1298 aa  PUR4_PSEF5 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1293      0.0  57% 1293 aa  PUR4_SHEDO RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    1::1295      0.0  56% 1295 aa  PUR4_ECOL6 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    1::1320      0.0  56% 1320 aa  PUR4_COLP3 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    1::1293      0.0  56% 1297 aa  PUR4_MANSM RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    1::1295      0.0  56% 1295 aa  PUR4_ECOUT RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    1::1295      0.0  56% 1295 aa  PUR4_ECOL5 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    1::1295      0.0  56% 1295 aa  PUR4_SALTY RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1294      0.0  57% 1297 aa  PUR4_HAEI8 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    1::1295      0.0  56% 1295 aa  PUR4_SALPA RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1297      0.0  56% 1297 aa  PUR4_VIBCH RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1298      0.0  58% 1299 aa  PUR4_PSEPK RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1294      0.0  56% 1297 aa  PUR4_HAEIN RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1295      0.0  56% 1295 aa  PUR4_PSEA6 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    1::1295      0.0  56% 1295 aa  PUR4_SALCH RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    1::1295      0.0  56% 1295 aa  PUR4_SALTI RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1296      0.0  56% 1296 aa  PUR4_YERPN RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1296      0.0  56% 1296 aa  PUR4_YERPE RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1296      0.0  56% 1296 aa  PUR4_YERPA RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1296      0.0  56% 1296 aa  PUR4_YERPS RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1302      0.0  56% 1302 aa  PUR4_VIBPA RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1293      0.0  55% 1293 aa  PUR4_SHEFN RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1297      0.0  55% 1297 aa  PUR4_VIBVU RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1297      0.0  57% 1298 aa  PUR4_PSEPF RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1294      0.0  56% 1294 aa  PUR4_ERWCT RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1294      0.0  55% 1297 aa  PUR4_VIBVY RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1295      0.0  56% 1295 aa  PUR4_IDILO RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1303      0.0  55% 1303 aa  PUR4_VIBF1 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    1::1297      0.0  56% 1297 aa  PUR4_HAES1 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1293      0.0  55% 1293 aa  PUR4_SHESR RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1293      0.0  55% 1293 aa  PUR4_SHESM RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1293      0.0  55% 1293 aa  PUR4_SHEON RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    6::1293      0.0  54% 1293 aa  PUR4_METFK RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1295      0.0  53% 1295 aa  PUR4_SODGM RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    6::1299      0.0  52% 1299 aa  PUR4_MYXXD RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    7::1369      0.0  53% 1369 aa  PUR4_RALSO RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    9::1320      0.0  50% 1320 aa  PUR4_NEIMB RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    5::1314      0.0  50% 1314 aa  PUR4_NEIG1 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    9::1320      0.0  50% 1320 aa  PUR4_NEIMA RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1323      0.0  50% 1323 aa  PUR4_SCHPO RecName: Full=Probable phosphoribosylformylglycinamidine
    5::1358      0.0  49% 1358 aa  PUR4_YEAST RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1322      0.0  47% 1322 aa  PUR4_XYLFT RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1322      0.0  47% 1322 aa  PUR4_XYLFA RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1348      0.0  46% 1348 aa  PUR4_XANAC RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    3::1348      0.0  46% 1348 aa  PUR4_XANCP RecName: Full=Phosphoribosylformylglycinamidine synthase; 
   83::1384      0.0  38% 1387 aa  PUR4_ARATH RecName: Full=Probable phosphoribosylformylglycinamidine
   94::1350      0.0  37% 1355 aa  PUR4_DICDI RecName: Full=Phosphoribosylformylglycinamidine synthase; 
   90::1348      0.0  36% 1354 aa  PUR4_DROME RecName: Full=Phosphoribosylformylglycinamidine synthase; 
   90::1332    e-180  35% 1338 aa  PUR4_HUMAN RecName: Full=Phosphoribosylformylglycinamidine synthase; 
   90::1331    e-178  35% 1337 aa  PUR4_MOUSE RecName: Full=Phosphoribosylformylglycinamidine synthase; 
   27::1341    e-165  35% 1343 aa  PUR4_CAEEL RecName: Full=Probable phosphoribosylformylglycinamidine
    1::728     2e-43  27%  765 aa  PURL_ARCFU RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::690     1e-40  28%  741 aa  PURL_PICTO RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::712     3e-40  28%  759 aa  PURL_THEAC RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::693     5e-40  27%  759 aa  PURL_THEVO RecName: Full=Phosphoribosylformylglycinamidine synthase
   29::749     2e-39  29%  761 aa  PURL_MYCA9 RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::736     6e-38  28%  764 aa  PURL_NOCFA RecName: Full=Phosphoribosylformylglycinamidine synthase
    8::731     9e-37  29%  741 aa  PURL_LACS1 RecName: Full=Phosphoribosylformylglycinamidine synthase
   30::688     7e-36  28%  734 aa  PURL_ZYMMO RecName: Full=Phosphoribosylformylglycinamidine synthase
    6::722     7e-36  29%  733 aa  PURL_THETN RecName: Full=Phosphoribosylformylglycinamidine synthase
   30::695     5e-35  28%  762 aa  PURL_CORGL RecName: Full=Phosphoribosylformylglycinamidine synthase
   30::746     5e-35  27%  762 aa  PURL_CORGB RecName: Full=Phosphoribosylformylglycinamidine synthase
    6::662     1e-34  28%  733 aa  PURL_THEPX RecName: Full=Phosphoribosylformylglycinamidine synthase
   23::701     1e-34  25%  762 aa  PURL_RHOE4 RecName: Full=Phosphoribosylformylglycinamidine synthase
    7::706     4e-34  28%  728 aa  PURL_CARHZ RecName: Full=Phosphoribosylformylglycinamidine synthase
    6::662     7e-34  28%  733 aa  PURL_THEP3 RecName: Full=Phosphoribosylformylglycinamidine synthase
   26::677     9e-34  28%  740 aa  PURL_RHORT RecName: Full=Phosphoribosylformylglycinamidine synthase
   37::741     1e-33  26%  765 aa  PURL_MYCPA RecName: Full=Phosphoribosylformylglycinamidine synthase
   37::741     2e-33  26%  765 aa  PURL_MYCA1 RecName: Full=Phosphoribosylformylglycinamidine synthase
    8::722     2e-33  28%  813 aa  PURL_CORJK RecName: Full=Phosphoribosylformylglycinamidine synthase
   13::730     3e-33  28%  742 aa  PURL_OCEIH RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::699     3e-33  27%  764 aa  PURL_MYCVP RecName: Full=Phosphoribosylformylglycinamidine synthase
   25::717     4e-33  27%  751 aa  PURL_NOCSJ RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::680     6e-33  28%  729 aa  PURL_STAS1 RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::716     6e-33  30%  781 aa  PURL_MYCGI RecName: Full=Phosphoribosylformylglycinamidine synthase
    8::734     6e-33  28%  743 aa  PURL_LACH4 RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::742     6e-33  26%  758 aa  PURL_CORAM RecName: Full=Phosphoribosylformylglycinamidine synthase
   12::695     1e-32  28%  713 aa  PURL_THESM RecName: Full=Phosphoribosylformylglycinamidine synthase
   86::699     2e-32  26%  730 aa  PURL_PELUB RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::662     2e-32  29%  719 aa  PURL_NOVAD RecName: Full=Phosphoribosylformylglycinamidine synthase
    8::675     2e-32  26%  741 aa  PURL_LACF3 RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::231     4e-32  35%  269 aa  PURQ_METM5 RecName: Full=Phosphoribosylformylglycinamidine synthase
   12::696     6e-32  29%  705 aa  PURL_PYRAB RecName: Full=Phosphoribosylformylglycinamidine synthase
    6::234     1e-31  35%  272 aa  PURQ_METMP RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::668     1e-31  30%  729 aa  PURL_STACT RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::698     1e-31  27%  742 aa  PURL_BACLD RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::658     3e-31  28%  739 aa  PURL_PARL1 RecName: Full=Phosphoribosylformylglycinamidine synthase
   26::693     3e-31  26%  754 aa  PURL_MYCTU RecName: Full=Phosphoribosylformylglycinamidine synthase
   26::693     3e-31  26%  754 aa  PURL_MYCTA RecName: Full=Phosphoribosylformylglycinamidine synthase
   26::693     3e-31  26%  754 aa  PURL_MYCBT RecName: Full=Phosphoribosylformylglycinamidine synthase
   26::693     3e-31  26%  754 aa  PURL_MYCBP RecName: Full=Phosphoribosylformylglycinamidine synthase
   26::693     3e-31  26%  754 aa  PURL_MYCBO RecName: Full=Phosphoribosylformylglycinamidine synthase
   46::700     4e-31  27%  767 aa  PURL_RENSM RecName: Full=Phosphoribosylformylglycinamidine synthase
   24::700     5e-31  29%  752 aa  PURL_STRCO RecName: Full=Phosphoribosylformylglycinamidine synthase
    8::749     5e-31  25%  765 aa  PURL_CORA7 RecName: Full=Phosphoribosylformylglycinamidine synthase
   12::688     9e-31  28%  712 aa  PURL_THEGJ RecName: Full=Phosphoribosylformylglycinamidine synthase
   26::672     9e-31  28%  739 aa  PURL_EXISA RecName: Full=Phosphoribosylformylglycinamidine synthase
   24::700     1e-30  28%  752 aa  PURL_STRAW RecName: Full=Phosphoribosylformylglycinamidine synthase
   19::667     1e-30  28%  719 aa  PURL_ROSDO RecName: Full=Phosphoribosylformylglycinamidine synthase
  592::1295    2e-30  26% 1299 aa  VP75_SHV21 RecName: Full=Probable membrane antigen 75;AltName:
    6::266     4e-30  34%  272 aa  PURQ_METM7 RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::676     4e-30  29%  729 aa  PURL_STAAN RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::676     4e-30  29%  729 aa  PURL_STAAM RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::676     4e-30  29%  729 aa  PURL_STAA9 RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::676     4e-30  29%  729 aa  PURL_STAA2 RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::676     4e-30  29%  729 aa  PURL_STAA1 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::679     4e-30  26%  733 aa  PURL_METJA RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::716     4e-30  27%  739 aa  PURL_LACLM RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::716     4e-30  27%  739 aa  PURL_LACLC RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::664     4e-30  27%  734 aa  PURL_GLUOX RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::646     4e-30  28%  759 aa  PURL_ANASK RecName: Full=Phosphoribosylformylglycinamidine synthase
   27::646     4e-30  29%  767 aa  PURL_ANADF RecName: Full=Phosphoribosylformylglycinamidine synthase
   30::692     5e-30  26%  763 aa  PURL_COREF RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::676     8e-30  29%  729 aa  PURL_STAAW RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::676     8e-30  29%  729 aa  PURL_STAAT RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::676     8e-30  29%  729 aa  PURL_STAAS RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::676     8e-30  29%  729 aa  PURL_STAAE RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::676     8e-30  29%  729 aa  PURL_STAAC RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::676     8e-30  29%  729 aa  PURL_STAA8 RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::676     8e-30  29%  729 aa  PURL_STAA3 RecName: Full=Phosphoribosylformylglycinamidine synthase
   12::654     8e-30  29%  713 aa  PURL_PYRKO RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::693     1e-29  28%  742 aa  PURL_GEOSW RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::676     1e-29  28%  729 aa  PURL_STAAR RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::716     2e-29  27%  739 aa  PURL_LACLS RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::238     3e-29  34%  257 aa  PURQ_THEAC RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::690     3e-29  25%  723 aa  PURL_METST RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::696     3e-29  27%  761 aa  PURL_FRASC RecName: Full=Phosphoribosylformylglycinamidine synthase
   26::702     3e-29  27%  744 aa  PURL_ERYLH RecName: Full=Phosphoribosylformylglycinamidine synthase
   20::693     4e-29  25%  754 aa  PURL_MYCLE RecName: Full=Phosphoribosylformylglycinamidine synthase
   20::693     4e-29  25%  754 aa  PURL_MYCLB RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::699     5e-29  26%  742 aa  PURL_BACSU RecName: Full=Phosphoribosylformylglycinamidine synthase
   42::742     7e-29  27%  760 aa  PURL_TROWT RecName: Full=Phosphoribosylformylglycinamidine synthase
   42::742     7e-29  27%  760 aa  PURL_TROW8 RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::701     9e-29  26%  724 aa  PURL_THELT RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::485     9e-29  31%  728 aa  PURL_MACCJ RecName: Full=Phosphoribosylformylglycinamidine synthase
    8::732     9e-29  28%  742 aa  PURL_LACAC RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::492     1e-28  30%  729 aa  PURL_STAAB RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::710     1e-28  27%  739 aa  PURL_BACC2 RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::673     3e-28  28%  744 aa  PURL_MESSB RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::709     3e-28  25%  741 aa  PURL_BACSK RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::710     3e-28  27%  739 aa  PURL_BACCR RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::660     3e-28  29%  738 aa  PURL_LACC3 RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::406     3e-28  33%  724 aa  PURL_CALMQ RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::710     4e-28  27%  739 aa  PURL_BACC4 RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::652     7e-28  27%  735 aa  PURL_AZOC5 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     1e-27  33%  248 aa  PURQ_PICTO RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::688     1e-27  29%  729 aa  PURL_STAES RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::688     1e-27  29%  729 aa  PURL_STAEQ RecName: Full=Phosphoribosylformylglycinamidine synthase
    8::732     1e-27  27%  742 aa  PURL_LACRJ RecName: Full=Phosphoribosylformylglycinamidine synthase
    8::732     1e-27  27%  742 aa  PURL_LACRD RecName: Full=Phosphoribosylformylglycinamidine synthase
   12::630     2e-27  32%  704 aa  PURL_PYRFU RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::672     2e-27  26%  742 aa  PURL_BACA2 RecName: Full=Phosphoribosylformylglycinamidine synthase
  585::1309    2e-27  26% 1318 aa  MTP_EBVG RecName: Full=Major tegument protein;       
    4::693     3e-27  29%  742 aa  PURL_GEOTN RecName: Full=Phosphoribosylformylglycinamidine synthase
   12::630     4e-27  29%  705 aa  PURL_PYRHO RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::699     4e-27  26%  739 aa  PURL_BACWK RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::239     5e-27  31%  258 aa  PURQ_THEVO RecName: Full=Phosphoribosylformylglycinamidine synthase
   19::635     5e-27  28%  719 aa  PURL_RHOS5 RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::699     5e-27  26%  739 aa  PURL_BACCN RecName: Full=Phosphoribosylformylglycinamidine synthase
  603::1309    5e-27  26% 1318 aa  MTP_EBVA8 RecName: Full=Major tegument protein;       
   22::710     6e-27  28%  735 aa  PURL_BARHE RecName: Full=Phosphoribosylformylglycinamidine synthase
   20::679     8e-27  27%  774 aa  PURL_GLOVI RecName: Full=Phosphoribosylformylglycinamidine synthase
   30::701     8e-27  27%  769 aa  PURL_FRASN RecName: Full=Phosphoribosylformylglycinamidine synthase
   27::492     1e-26  30%  729 aa  PURL_STAHJ RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::713     1e-26  26%  737 aa  PURL_RHOP5 RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::646     1e-26  28%  759 aa  PURL_ANADE RecName: Full=Phosphoribosylformylglycinamidine synthase
  585::1309    1e-26  26% 1318 aa  MTP_EBVB9 RecName: Full=Major tegument protein;       
  566::1223    1e-26  27% 1246 aa  VP03_SHV21 RecName: Full=Probable membrane antigen 3;AltName:
    4::672     1e-26  27%  739 aa  PURL_LISMF RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::700     1e-26  28%  720 aa  PURL_HALMA RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::694     2e-26  26%  736 aa  PURL_RHOP2 RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::662     2e-26  29%  740 aa  PURL_LACCA RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::731     2e-26  27%  736 aa  PURL_BARQU RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::673     2e-26  27%  743 aa  PURL_BACP2 RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::649     2e-26  26%  736 aa  PURL_RHOPB RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::699     2e-26  27%  742 aa  PURL_GEOKA RecName: Full=Phosphoribosylformylglycinamidine synthase
   20::648     2e-26  27%  736 aa  PURL_BRASO RecName: Full=Phosphoribosylformylglycinamidine synthase
   77::700     3e-26  29%  709 aa  PURL_SULIY RecName: Full=Phosphoribosylformylglycinamidine synthase
   77::700     3e-26  29%  709 aa  PURL_SULIN RecName: Full=Phosphoribosylformylglycinamidine synthase
   77::700     3e-26  29%  709 aa  PURL_SULIL RecName: Full=Phosphoribosylformylglycinamidine synthase
   77::700     3e-26  28%  709 aa  PURL_SULIA RecName: Full=Phosphoribosylformylglycinamidine synthase
   19::485     3e-26  29%  720 aa  PURL_RHOSK RecName: Full=Phosphoribosylformylglycinamidine synthase
   77::693     4e-26  28%  709 aa  PURL_SULSO RecName: Full=Phosphoribosylformylglycinamidine synthase
   77::700     4e-26  28%  709 aa  PURL_SULIM RecName: Full=Phosphoribosylformylglycinamidine synthase
   77::700     4e-26  28%  709 aa  PURL_SULIK RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::653     4e-26  27%  735 aa  PURL_METSB RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::238     5e-26  35%  270 aa  PURQ_TREDE RecName: Full=Phosphoribosylformylglycinamidine synthase
   19::485     5e-26  29%  720 aa  PURL_RHOS4 RecName: Full=Phosphoribosylformylglycinamidine synthase
   12::686     5e-26  24%  732 aa  PURL_META3 RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::699     5e-26  26%  739 aa  PURL_BACC3 RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::699     5e-26  26%  739 aa  PURL_BACC0 RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::699     5e-26  26%  739 aa  PURL_BACAN RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::699     5e-26  26%  739 aa  PURL_BACAH RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::699     5e-26  26%  739 aa  PURL_BACAC RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::699     5e-26  26%  739 aa  PURL_BACAA RecName: Full=Phosphoribosylformylglycinamidine synthase
   20::683     7e-26  26%  750 aa  PURL_PROAC RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::698     7e-26  26%  740 aa  PURL_ANOFW RecName: Full=Phosphoribosylformylglycinamidine synthase
    9::678     9e-26  27%  733 aa  PURL_THERP RecName: Full=Phosphoribosylformylglycinamidine synthase
   31::705     9e-26  26%  765 aa  PURL_THEFY RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::699     9e-26  26%  739 aa  PURL_BACCZ RecName: Full=Phosphoribosylformylglycinamidine synthase
   26::698     9e-26  28%  783 aa  PURL_ACAM1 RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::675     1e-25  26%  740 aa  PURL_LACDB RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::675     1e-25  26%  740 aa  PURL_LACDA RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::699     1e-25  26%  739 aa  PURL_BACCQ RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::699     2e-25  27%  739 aa  PURL_BACHK RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::699     2e-25  26%  739 aa  PURL_BACC7 RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::243     2e-25  32%  271 aa  PURQ_ARCFU RecName: Full=Phosphoribosylformylglycinamidine synthase
   20::648     2e-25  27%  735 aa  PURL_BRASB RecName: Full=Phosphoribosylformylglycinamidine synthase
    6::711     2e-25  26%  743 aa  PURL_BACHD RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::699     2e-25  26%  739 aa  PURL_BACC1 RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::698     3e-25  27%  710 aa  PURL_SULAC RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::690     3e-25  25%  736 aa  PURL_RHOPA RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::642     3e-25  26%  737 aa  PURL_NITWN RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::716     3e-25  26%  739 aa  PURL_LACLA RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::671     3e-25  27%  739 aa  PURL_ENTFA RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::690     4e-25  25%  736 aa  PURL_RHOPT RecName: Full=Phosphoribosylformylglycinamidine synthase
   32::692     4e-25  27%  779 aa  PURL_PROM9 RecName: Full=Phosphoribosylformylglycinamidine synthase
   27::646     4e-25  27%  759 aa  PURL_ANAD2 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::673     6e-25  26%  725 aa  PURL_HALWD RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::694     8e-25  25%  736 aa  PURL_RHOPS RecName: Full=Phosphoribosylformylglycinamidine synthase
    7::699     8e-25  31%  727 aa  PURL_PETMO RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::724     8e-25  26%  738 aa  PURL_ALKMQ RecName: Full=Phosphoribosylformylglycinamidine synthase
   32::692     1e-24  26%  779 aa  PURL_PROMS RecName: Full=Phosphoribosylformylglycinamidine synthase
   20::653     1e-24  29%  736 aa  PURL_BEII9 RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::710     1e-24  28%  737 aa  PURL_BARBK RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::735     1e-24  25%  761 aa  PURL_CHLCH RecName: Full=Phosphoribosylformylglycinamidine synthase
   28::605     2e-24  29%  721 aa  PURL_SILST RecName: Full=Phosphoribosylformylglycinamidine synthase
   29::692     2e-24  27%  737 aa  PURL_SULDN RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::673     3e-24  28%  761 aa  PURL_THEEB RecName: Full=Phosphoribosylformylglycinamidine synthase
   25::660     3e-24  28%  778 aa  PURL_SYMTH RecName: Full=Phosphoribosylformylglycinamidine synthase
   28::485     3e-24  29%  719 aa  PURL_SILPO RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::674     3e-24  28%  743 aa  PURL_RHILO RecName: Full=Phosphoribosylformylglycinamidine synthase
   19::373     3e-24  31%  723 aa  PURL_PARDP RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::644     3e-24  27%  724 aa  PURL_GRABC RecName: Full=Phosphoribosylformylglycinamidine synthase
   34::667     5e-24  28%  772 aa  PURL_LEIXX RecName: Full=Phosphoribosylformylglycinamidine synthase
   23::697     5e-24  25%  725 aa  PURL_CAMLR RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::682     6e-24  26%  743 aa  PURL_SINMW RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::685     8e-24  28%  768 aa  PURL_SYNY3 RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::698     1e-23  27%  738 aa  PURL_LEUMM RecName: Full=Phosphoribosylformylglycinamidine synthase
   33::714     2e-23  29%  793 aa  PURL_PROMA RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::730     3e-23  25%  739 aa  PURL_LISW6 RecName: Full=Phosphoribosylformylglycinamidine synthase
   19::627     3e-23  28%  719 aa  PURL_JANSC RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::644     3e-23  26%  732 aa  PURL_CAMHC RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::674     4e-23  26%  743 aa  PURL_RHIME RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::672     4e-23  26%  739 aa  PURL_LISMC RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::672     4e-23  26%  739 aa  PURL_LISIN RecName: Full=Phosphoribosylformylglycinamidine synthase
   32::695     5e-23  26%  779 aa  PURL_PROMP RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::669     7e-23  27%  740 aa  PURL_OCHA4 RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::672     7e-23  26%  739 aa  PURL_LISMH RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::656     9e-23  26%  743 aa  PURL_RHIEC RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::689     1e-22  27%  716 aa  PURL_METS3 RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::672     2e-22  26%  739 aa  PURL_LISMO RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::684     2e-22  26%  744 aa  PURL_RHIL3 RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::635     2e-22  25%  744 aa  PURL_NITHX RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::669     2e-22  27%  740 aa  PURL_BRUME RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::669     2e-22  27%  740 aa  PURL_BRUMB RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::669     2e-22  27%  740 aa  PURL_BRUAB RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::669     2e-22  27%  740 aa  PURL_BRUA2 RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::669     2e-22  27%  740 aa  PURL_BRUA1 RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::646     2e-22  28%  727 aa  PURL_ACICJ RecName: Full=Phosphoribosylformylglycinamidine synthase
   32::692     3e-22  25%  779 aa  PURL_PROM0 RecName: Full=Phosphoribosylformylglycinamidine synthase
   94::712     3e-22  28%  739 aa  PURL_LACPL RecName: Full=Phosphoribosylformylglycinamidine synthase
   16::473     3e-22  29%  713 aa  PURL_IGNH4 RecName: Full=Phosphoribosylformylglycinamidine synthase
   13::705     4e-22  25%  733 aa  PURL_WOLSU RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::656     5e-22  27%  743 aa  PURL_RHILW RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::656     5e-22  26%  743 aa  PURL_RHIE6 RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::710     5e-22  27%  736 aa  PURL_BART1 RecName: Full=Phosphoribosylformylglycinamidine synthase
   24::684     6e-22  28%  768 aa  PURL_SYNJB RecName: Full=Phosphoribosylformylglycinamidine synthase
   53::724     6e-22  26%  775 aa  PURL_AGRT5 RecName: Full=Phosphoribosylformylglycinamidine synthase
   31::661     8e-22  27%  740 aa  PURL_SULNB RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::669     8e-22  27%  740 aa  PURL_BRUSU RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::669     8e-22  27%  740 aa  PURL_BRUSI RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::669     8e-22  27%  740 aa  PURL_BRUO2 RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::669     8e-22  27%  740 aa  PURL_BRUC2 RecName: Full=Phosphoribosylformylglycinamidine synthase
   23::141     1e-21  28%  761 aa  PURL_RHOSR RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::708     1e-21  25%  743 aa  PURL_RHIFR RecName: Full=Phosphoribosylformylglycinamidine synthase
   20::651     1e-21  26%  736 aa  PURL_BRAJA RecName: Full=Phosphoribosylformylglycinamidine synthase
   32::692     2e-21  26%  779 aa  PURL_PROM2 RecName: Full=Phosphoribosylformylglycinamidine synthase
   13::720     2e-21  24%  745 aa  PURL_AQUAE RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::673     2e-21  25%  742 aa  PURL_RHISN RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::251     3e-21  30%  255 aa  PURQ_DEHE1 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::710     4e-21  27%  761 aa  PURL_PELLD RecName: Full=Phosphoribosylformylglycinamidine synthase
   23::486     4e-21  29%  733 aa  PURL_MOOTA RecName: Full=Phosphoribosylformylglycinamidine synthase
   32::377     7e-21  32%  779 aa  PURL_PROM5 RecName: Full=Phosphoribosylformylglycinamidine synthase
   20::705     7e-21  25%  759 aa  PURL_CHLTE RecName: Full=Phosphoribosylformylglycinamidine synthase
   31::671     7e-21  26%  745 aa  PURL_AGRVS RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::345     1e-20  31%  603 aa  PURL_THEMA RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::665     1e-20  27%  713 aa  PURL_NATPD RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::686     1e-20  27%  777 aa  PURL_ANAVT RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::341     2e-20  30%  725 aa  PURL_THET8 RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::341     2e-20  30%  725 aa  PURL_THET2 RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::663     2e-20  26%  747 aa  PURL_DEIRA RecName: Full=Phosphoribosylformylglycinamidine synthase
   26::346     3e-20  33%  766 aa  PURL_SYNJA RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::351     3e-20  30%  697 aa  PURL_PYRAE RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::464     3e-20  27%  714 aa  PURL_METTH RecName: Full=Phosphoribosylformylglycinamidine synthase
   23::657     4e-20  26%  729 aa  PURL_CAMC1 RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::210     6e-20  37%  226 aa  PURQ_METKA RecName: Full=Phosphoribosylformylglycinamidine synthase
   28::348     6e-20  32%  768 aa  PURL_SYNPX RecName: Full=Phosphoribosylformylglycinamidine synthase
   23::141     6e-20  27%  761 aa  PURL_RHOOB RecName: Full=Phosphoribosylformylglycinamidine synthase
   19::362     6e-20  32%  724 aa  PURL_METKA RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::375     1e-19  29%  788 aa  PURL_NOSP7 RecName: Full=Phosphoribosylformylglycinamidine synthase
   20::348     2e-19  30%  782 aa  PURL_ANASP RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::473     2e-19  28%  728 aa  PURL_CAMJR RecName: Full=Phosphoribosylformylglycinamidine synthase
   29::349     3e-19  31%  766 aa  PURL_SYNS9 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::393     3e-19  32%  697 aa  PURL_PYRAR RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::341     4e-19  30%  765 aa  PURL_SYNPW RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::450     5e-19  28%  728 aa  PURL_CAMJD RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::440     6e-19  28%  777 aa  PURL_SYNP6 RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::440     6e-19  28%  777 aa  PURL_SYNE7 RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::724     1e-18  26%  745 aa  PURL_HELHP RecName: Full=Phosphoribosylformylglycinamidine synthase
   23::640     1e-18  27%  728 aa  PURL_CAMJE RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::350     1e-18  30%  743 aa  PURL_AGRRK RecName: Full=Phosphoribosylformylglycinamidine synthase
   27::446     2e-18  30%  794 aa  PURL_PROMM RecName: Full=Phosphoribosylformylglycinamidine synthase
   23::640     2e-18  27%  728 aa  PURL_CAMJJ RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::333     2e-18  31%  729 aa  PURL_CAMC5 RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::209     3e-18  31%  221 aa  PURQ_METST RecName: Full=Phosphoribosylformylglycinamidine synthase
   29::349     3e-18  30%  768 aa  PURL_SYNSC RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::205     4e-18  38%  221 aa  PURQ_SYNP6 RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::205     4e-18  38%  221 aa  PURQ_SYNE7 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::713     4e-18  25%  759 aa  PURL_HALLT RecName: Full=Phosphoribosylformylglycinamidine synthase
   23::473     5e-18  28%  728 aa  PURL_CAMJ8 RecName: Full=Phosphoribosylformylglycinamidine synthase
   27::446     9e-18  29%  794 aa  PURL_PROM3 RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::205     1e-17  33%  227 aa  PURQ_PELUB RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::317     2e-17  35%  782 aa  PURL_CYAP4 RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::208     2e-17  36%  236 aa  PURQ_THERP RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::324     3e-17  31%  693 aa  PURL_PYRCJ RecName: Full=Phosphoribosylformylglycinamidine synthase
   45::207     3e-17  34%  224 aa  PURQ_SYNY3 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::351     3e-17  31%  693 aa  PURL_THENV RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::625     6e-17  27%  716 aa  PURL_METMA RecName: Full=Phosphoribosylformylglycinamidine synthase
   23::213     8e-17  32%  235 aa  PURQ_SALRD RecName: Full=Phosphoribosylformylglycinamidine synthase
    9::555     8e-17  28%  739 aa  PURL_CAUCR RecName: Full=Phosphoribosylformylglycinamidine synthase
   25::695     1e-16  29%  735 aa  PURL_NITSB RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::199     1e-16  35%  223 aa  PURQ_PYRHO RecName: Full=Phosphoribosylformylglycinamidine synthase
   40::205     1e-16  35%  234 aa  PURQ_CARHZ RecName: Full=Phosphoribosylformylglycinamidine synthase
   45::742     1e-16  25%  803 aa  PURL_PROMT RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::204     2e-16  32%  225 aa  PURQ_CORAM RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::203     3e-16  36%  223 aa  PURQ_LACAC RecName: Full=Phosphoribosylformylglycinamidine synthase
   48::217     3e-16  35%  252 aa  PURQ_CHLP8 RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::199     4e-16  35%  223 aa  PURQ_PYRKO RecName: Full=Phosphoribosylformylglycinamidine synthase
   38::202     4e-16  34%  226 aa  PURQ_EXISA RecName: Full=Phosphoribosylformylglycinamidine synthase
   49::203     4e-16  39%  227 aa  PURQ_EXIS2 RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::684     4e-16  25%  703 aa  PURL_SULTO RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::211     5e-16  31%  224 aa  PURQ_SULDN RecName: Full=Phosphoribosylformylglycinamidine synthase
   45::733     5e-16  25%  803 aa  PURL_PROM1 RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::199     8e-16  33%  223 aa  PURQ_PYRFU RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::207     8e-16  33%  223 aa  PURQ_PYRAB RecName: Full=Phosphoribosylformylglycinamidine synthase
   35::211     8e-16  36%  236 aa  PURQ_MOOTA RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::203     1e-15  34%  223 aa  PURQ_RHIL3 RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::203     1e-15  33%  226 aa  PURQ_LACF3 RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::198     1e-15  37%  230 aa  PURQ_BREBN RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::200     2e-15  34%  223 aa  PURQ_RHIME RecName: Full=Phosphoribosylformylglycinamidine synthase
   16::708     2e-15  24%  768 aa  PURL_METTP RecName: Full=Phosphoribosylformylglycinamidine synthase
   52::217     2e-15  35%  234 aa  PURQ_CHLTE RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::197     3e-15  37%  217 aa  PURQ_PROMT RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::208     3e-15  30%  223 aa  PURQ_COREF RecName: Full=Phosphoribosylformylglycinamidine synthase
   42::201     4e-15  36%  225 aa  PURQ_SYNJA RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::206     4e-15  33%  235 aa  PURQ_ACAM1 RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::201     7e-15  34%  223 aa  PURQ_STAAS RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::672     7e-15  24%  715 aa  PURL_METBF RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::335     7e-15  32%  745 aa  PURL_LEPBL RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::335     7e-15  32%  745 aa  PURL_LEPBJ RecName: Full=Phosphoribosylformylglycinamidine synthase
   26::211     9e-15  32%  234 aa  PURQ_THELT RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::197     9e-15  39%  217 aa  PURQ_SYNS9 RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::201     9e-15  34%  223 aa  PURQ_STAAW RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::201     9e-15  34%  223 aa  PURQ_STAAN RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::201     9e-15  34%  223 aa  PURQ_STAAM RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::201     9e-15  34%  223 aa  PURQ_STAAC RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::201     9e-15  34%  223 aa  PURQ_STAA8 RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::201     9e-15  34%  223 aa  PURQ_STAA3 RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::205     9e-15  37%  224 aa  PURQ_HALSA RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::197     9e-15  32%  227 aa  PURQ_BACWK RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::196     1e-14  37%  216 aa  PURQ_SYNSC RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::201     1e-14  34%  223 aa  PURQ_STAAR RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::201     1e-14  34%  223 aa  PURQ_STAAB RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::197     2e-14  37%  218 aa  PURQ_PROMA RecName: Full=Phosphoribosylformylglycinamidine synthase
   48::205     2e-14  36%  224 aa  PURQ_NATPD RecName: Full=Phosphoribosylformylglycinamidine synthase
   38::198     2e-14  38%  223 aa  PURQ_LACLA RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::197     2e-14  32%  227 aa  PURQ_BACHK RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::197     2e-14  32%  227 aa  PURQ_BACC7 RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::197     2e-14  32%  227 aa  PURQ_BACC2 RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::197     2e-14  32%  227 aa  PURQ_BACC1 RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::197     2e-14  32%  227 aa  PURQ_BACC0 RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::197     2e-14  32%  227 aa  PURQ_BACAN RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::197     2e-14  32%  227 aa  PURQ_BACAC RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::197     2e-14  32%  227 aa  PURQ_BACAA RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::335     2e-14  31%  745 aa  PURL_LEPIC RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::425     2e-14  27%  741 aa  PURL_LACSS RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::197     2e-14  32%  227 aa  PURQ_BACCR RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::197     2e-14  32%  227 aa  PURQ_BACC4 RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::197     2e-14  32%  227 aa  PURQ_BACAH RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::335     2e-14  31%  745 aa  PURL_LEPIN RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::197     3e-14  37%  217 aa  PURQ_SYNPX RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::214     3e-14  29%  232 aa  PURQ_METAC RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::208     3e-14  32%  228 aa  PURQ_HALWD RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::201     4e-14  33%  223 aa  PURQ_STAS1 RecName: Full=Phosphoribosylformylglycinamidine synthase
   38::217     4e-14  32%  231 aa  PURQ_PELLD RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::206     4e-14  33%  233 aa  PURQ_NITWN RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::206     4e-14  31%  233 aa  PURQ_NITHX RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::214     4e-14  30%  232 aa  PURQ_METMA RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::206     4e-14  34%  233 aa  PURQ_BRAJA RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::197     4e-14  32%  227 aa  PURQ_BACC3 RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::206     5e-14  28%  218 aa  PURQ_WOLSU RecName: Full=Phosphoribosylformylglycinamidine synthase
   43::223     5e-14  34%  241 aa  PURQ_THEEB RecName: Full=Phosphoribosylformylglycinamidine synthase
   42::222     5e-14  34%  225 aa  PURQ_SYNJB RecName: Full=Phosphoribosylformylglycinamidine synthase
   10::208     5e-14  31%  230 aa  PURQ_RHORT RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::197     5e-14  31%  227 aa  PURQ_BACCZ RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::197     5e-14  31%  227 aa  PURQ_BACCQ RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::198     5e-14  34%  224 aa  PURQ_ANAVT RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::205     6e-14  33%  225 aa  PURQ_RHOSR RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::198     6e-14  31%  223 aa  PURQ_BARQU RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::215     6e-14  32%  227 aa  PURQ_AQUAE RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::198     6e-14  34%  224 aa  PURQ_ANASP RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::672     6e-14  25%  715 aa  PURL_METAC RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::203     8e-14  32%  223 aa  PURQ_RHIEC RecName: Full=Phosphoribosylformylglycinamidine synthase
   45::197     8e-14  36%  217 aa  PURQ_PROMM RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::203     8e-14  34%  218 aa  PURQ_METTH RecName: Full=Phosphoribosylformylglycinamidine synthase
   38::206     8e-14  37%  226 aa  PURQ_LACRJ RecName: Full=Phosphoribosylformylglycinamidine synthase
   38::206     8e-14  37%  226 aa  PURQ_LACRD RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::198     8e-14  32%  223 aa  PURQ_BARHE RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::202     8e-14  33%  227 aa  PURQ_BACCN RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::205     1e-13  30%  225 aa  PURQ_NOCFA RecName: Full=Phosphoribosylformylglycinamidine synthase
   40::204     1e-13  35%  226 aa  PURQ_STRCO RecName: Full=Phosphoribosylformylglycinamidine synthase
   10::197     1e-13  32%  222 aa  PURQ_SILPO RecName: Full=Phosphoribosylformylglycinamidine synthase
   38::204     1e-13  34%  224 aa  PURQ_MYCLE RecName: Full=Phosphoribosylformylglycinamidine synthase
   38::198     1e-13  34%  226 aa  PURQ_LACLC RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::197     1e-13  33%  222 aa  PURQ_JANSC RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::206     1e-13  39%  222 aa  PURQ_DEIGD RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::198     1e-13  36%  228 aa  PURQ_ANOFW RecName: Full=Phosphoribosylformylglycinamidine synthase
   28::725     1e-13  30%  748 aa  PURL_LEPBP RecName: Full=Phosphoribosylformylglycinamidine synthase
   28::725     1e-13  30%  748 aa  PURL_LEPBA RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::202     2e-13  36%  224 aa  PURQ_THETN RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::208     2e-13  33%  223 aa  PURQ_STAES RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::208     2e-13  33%  223 aa  PURQ_STAEQ RecName: Full=Phosphoribosylformylglycinamidine synthase
   34::205     2e-13  33%  225 aa  PURQ_LACPL RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::205     2e-13  32%  224 aa  PURQ_PROAC RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::213     2e-13  31%  230 aa  PURQ_METJA RecName: Full=Phosphoribosylformylglycinamidine synthase
   50::206     3e-13  34%  228 aa  PURQ_OCEIH RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::214     3e-13  30%  232 aa  PURQ_METBF RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::186     4e-13  36%  212 aa  PURQ_PYRAE RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::203     4e-13  31%  222 aa  PURQ_MESSB RecName: Full=Phosphoribosylformylglycinamidine synthase
   19::351     4e-13  29%  693 aa  PURL_PYRIL RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::206     5e-13  27%  224 aa  PURQ_SULSO RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::203     5e-13  33%  227 aa  PURQ_LISIN RecName: Full=Phosphoribosylformylglycinamidine synthase
   42::204     5e-13  35%  223 aa  PURQ_BRUSU RecName: Full=Phosphoribosylformylglycinamidine synthase
   42::204     5e-13  35%  223 aa  PURQ_BRUME RecName: Full=Phosphoribosylformylglycinamidine synthase
   42::204     5e-13  35%  223 aa  PURQ_BRUAB RecName: Full=Phosphoribosylformylglycinamidine synthase
   42::204     5e-13  35%  223 aa  PURQ_BRUA2 RecName: Full=Phosphoribosylformylglycinamidine synthase
   42::200     7e-13  38%  221 aa  PURQ_PROM9 RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::202     7e-13  32%  228 aa  PURQ_LACCB RecName: Full=Phosphoribosylformylglycinamidine synthase
   42::221     7e-13  31%  227 aa  PURQ_BACHD RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::197     1e-12  31%  222 aa  PURQ_SILST RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::203     1e-12  33%  227 aa  PURQ_LISW6 RecName: Full=Phosphoribosylformylglycinamidine synthase
   42::206     1e-12  33%  228 aa  PURQ_GEOSW RecName: Full=Phosphoribosylformylglycinamidine synthase
   46::208     1e-12  33%  223 aa  PURQ_CORGL RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::203     1e-12  34%  227 aa  PURQ_THET8 RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::203     1e-12  34%  227 aa  PURQ_THET2 RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::203     1e-12  32%  227 aa  PURQ_LISMH RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::202     1e-12  32%  228 aa  PURQ_LACC3 RecName: Full=Phosphoribosylformylglycinamidine synthase
   52::204     2e-12  36%  225 aa  PURQ_NOVAD RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::203     2e-12  32%  227 aa  PURQ_LISMO RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::203     2e-12  32%  227 aa  PURQ_LISMF RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::203     2e-12  32%  227 aa  PURQ_LISMC RecName: Full=Phosphoribosylformylglycinamidine synthase
   44::196     2e-12  36%  232 aa  PURQ_LEIXX RecName: Full=Phosphoribosylformylglycinamidine synthase
   38::203     2e-12  35%  224 aa  PURQ_LACDA RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::206     3e-12  32%  233 aa  PURQ_RHOP2 RecName: Full=Phosphoribosylformylglycinamidine synthase
   38::204     3e-12  37%  224 aa  PURQ_MYCPA RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::205     3e-12  30%  222 aa  PURQ_HELHP RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::408     3e-12  26%  700 aa  PURL_HALSA RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::408     3e-12  26%  700 aa  PURL_HALS3 RecName: Full=Phosphoribosylformylglycinamidine synthase
   38::205     4e-12  33%  228 aa  PURQ_LACSS RecName: Full=Phosphoribosylformylglycinamidine synthase
   38::205     4e-12  34%  227 aa  PURQ_BACP2 RecName: Full=Phosphoribosylformylglycinamidine synthase
   42::202     4e-12  31%  226 aa  PURQ_ALKMQ RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::204     6e-12  34%  221 aa  PURQ_SPHAL RecName: Full=Phosphoribosylformylglycinamidine synthase
   42::200     6e-12  35%  221 aa  PURQ_PROMP RecName: Full=Phosphoribosylformylglycinamidine synthase
   38::205     6e-12  37%  227 aa  PURQ_BACSU RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::203     7e-12  33%  227 aa  PURQ_LYSSC RecName: Full=Phosphoribosylformylglycinamidine synthase
   10::694     7e-12  28%  754 aa  PURL_SALRD RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::203     1e-11  30%  222 aa  PURQ_RHILO RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::201     1e-11  32%  223 aa  PURQ_STAHJ RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::212     1e-11  33%  233 aa  PURQ_RHOPB RecName: Full=Phosphoribosylformylglycinamidine synthase
   38::204     1e-11  35%  224 aa  PURQ_MYCTU RecName: Full=Phosphoribosylformylglycinamidine synthase
   38::204     1e-11  35%  224 aa  PURQ_MYCBO RecName: Full=Phosphoribosylformylglycinamidine synthase
   44::206     1e-11  32%  232 aa  PURQ_GLOVI RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::230     2e-11  30%  262 aa  PURQ_METTP RecName: Full=Phosphoribosylformylglycinamidine synthase
   50::206     2e-11  37%  221 aa  PURQ_DEIRA RecName: Full=Phosphoribosylformylglycinamidine synthase
   38::205     2e-11  36%  227 aa  PURQ_BACA2 RecName: Full=Phosphoribosylformylglycinamidine synthase
   42::206     2e-11  31%  228 aa  PURQ_GEOTN RecName: Full=Phosphoribosylformylglycinamidine synthase
   46::217     2e-11  30%  234 aa  PURQ_CHLCH RecName: Full=Phosphoribosylformylglycinamidine synthase
   38::205     2e-11  36%  227 aa  PURQ_BACLD RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::214     3e-11  30%  235 aa  PURQ_SYMTH RecName: Full=Phosphoribosylformylglycinamidine synthase
   38::204     4e-11  29%  224 aa  PURQ_ENTFA RecName: Full=Phosphoribosylformylglycinamidine synthase
   42::202     4e-11  29%  220 aa  PURQ_CAUCR RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::189     6e-11  32%  213 aa  PURQ_THEMA RecName: Full=Phosphoribosylformylglycinamidine synthase
   42::204     6e-11  31%  219 aa  PURQ_LEPIN RecName: Full=Phosphoribosylformylglycinamidine synthase
   42::204     6e-11  31%  219 aa  PURQ_LEPIC RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::204     6e-11  28%  223 aa  PURQ_CORJK RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::205     6e-11  29%  223 aa  PURQ_CAMJE RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::206     8e-11  30%  233 aa  PURQ_RHOPA RecName: Full=Phosphoribosylformylglycinamidine synthase
   42::206     8e-11  29%  228 aa  PURQ_GEOKA RecName: Full=Phosphoribosylformylglycinamidine synthase
   39::206     1e-10  29%  231 aa  PURQ_ACIBL RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::198     4e-10  27%  224 aa  PURQ_LACS1 RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::333     4e-10  39%  702 aa  PURL_METS5 RecName: Full=Phosphoribosylformylglycinamidine synthase
   42::199     7e-10  30%  221 aa  PURQ_ZYMMO RecName: Full=Phosphoribosylformylglycinamidine synthase
   36::196     9e-10  36%  220 aa  PURQ_RUBXD RecName: Full=Phosphoribosylformylglycinamidine synthase
   10::197     2e-09  30%  222 aa  PURQ_ROSDO RecName: Full=Phosphoribosylformylglycinamidine synthase
   40::206     2e-09  33%  234 aa  PURQ_STRAW RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::197     4e-09  29%  222 aa  PURQ_RHOS4 RecName: Full=Phosphoribosylformylglycinamidine synthase
   51::210     8e-09  30%  233 aa  PURQ_GLUOX RecName: Full=Phosphoribosylformylglycinamidine synthase
   45::203     1e-08  28%  218 aa  PURQ_ANADE RecName: Full=Phosphoribosylformylglycinamidine synthase
   38::197     4e-08  33%  227 aa  PURQ_BACSK RecName: Full=Phosphoribosylformylglycinamidine synthase
  189::340     6e-04  30%  724 aa  PURL_CALMQ RecName: Full=Phosphoribosylformylglycinamidine synthase(query 818->968)
    1::1290

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MITIFEGLSALSPFKREKILAAAKKISNKVESVSAQYIHVTELESELNSEQERIVKSLLNYNREYGIAQP
PUR4_PHOLL      ---ILRGSPALSAFRITKLLSVCQEQQLPVNDIYAEYVHFAEINASLSDVDSAKLQQLLKYGPSLAEHEP
PUR4_PSEHT      ---ILRGAPALSEFRVNKILARCQQSQLPVTNVYAEYAHFADLTSPLSSAEQTKLEKLLTYGPTIAEHTP
PUR4_PSEU2      ---ILRGAPALSAFRHSKLLEQLKQKVSAVSGLYAEFAHFADVNDVLTSEEQQVLDRLLKYGPSVPVQEP
PUR4_PSE14      ---ILRGAPALSAFRHSKLLEQLKQKVSAVSGLYAEFAHFADVNDVLTSEEQQVLDRLLKYGPSVPVQEP
PUR4_PSESM      ---ILRGAPALSAFRHSKLLEQLKQKVSAVSGLYAEFAHFADVNDVLTGEEQQVLDRLLKYGPSVPVQEP
PUR4_PASMU      MLQIFRGSPALSEFRLNQLAVRFQKANLPVSACYAEYIHFADLSDRLTEEETAKLDQLLHYGPTLAGHDP
PUR4_HAHCH      ------GAPALSPFRREKLLKNIQEQAPEVQSVYAEYMHFVDLEGDLSAEQRTVLDRLLQYGPQGQSEMP
PUR4_PHOPR      ---ILRGSPALSEFRVNKLLERCRELDLPVSGIYAEFMHFADVSAPLNSDEQSKLASLLTYGPTIAEHEP
PUR4_SHIDS      MMEILRGSPALSAFRINKLLARFQAARLPVHNIYAEYVHFADLNAPLNDDEHAQLERLLKYGPALASHAP
PUR4_ECOLI      MMEILRGSPALSAFRINKLLARFQAARLPVHNIYAEYVHFADLNAPLNDDEHAQLERLLKYGPALASHAP
PUR4_ECO57      MMEILRGSPALSAFRINKLLARFQAARLPVHNIYAEYVHFADLNAPLNDDEHAQLERLLKYGPALASHAP
PUR4_SHISS      MMEILRGSPALSAFRINKLLARFQAARLPVHNIYAEYVHFADLNAPLNDDEHAQLERLLKYGPALASHAP
PUR4_PSEAE      ---ILRGAPALSAFRHGKLLEQLTQHVPAVTGLYAEFAHFADVTGALTADEEQVLARLLKYGPSVPVQEP
PUR4_SHIBS      MMEILRGSPALSAFRINKLLARFQAARLPVHNIYAEYVHFADLNAPLNDDEHAQLERLLKYGPALASHAP
PUR4_PSEF5      ---ILRGAPALSAFRHSKLL---EQLSQKVPAVSAEFAHFAEVTGVLTGDEQQVLARLLKYGPSVPVQEP
PUR4_SHEDO      ---IIRGAPALSAFRVQQLMKACDAAAIPVRHIYAEFMHFAHLTNALNDTQTLQLASILTYGPAIEAHTP
PUR4_ECOL6      MMEILRGSPALSAFRINKLLARFQAARLPVHNIYAEYVHFADLNAPLNDDEHAQLERLLKYGPALASHAP
PUR4_COLP3      MIKNLRGAPALSDFRVKKLLAQCEQLQLPVNDIYAEFAHFTKLNEELSTSEEKVLQQLLTYGPTIEEHQP
PUR4_MANSM      MFQIFRGSPALSEFRLNQLSARFQKADLPVKSCYAEYLHFADLSAGLSAEETDELEQLLHYGPTLAQHES
PUR4_ECOUT      MMEILRGSPALSAFRINKLLARFQAARLLVHTIYAEYVHFADLNAPLNDDEHAQLERLLKYGPALASHAP
PUR4_ECOL5      MMEILRGSPALSAFRINKLLARFQAARLPVHTIYAEYVHFADLNAPLNDDEHAQLERLLKYGPALASHAP
PUR4_SALTY      MMEILRGSPALSAFRINKLLARFQAANLQVHNIYAEYVHFADLNAPLNDSEQAQLTRLLQYGPALSSHTP
PUR4_HAEI8      -VKTFRGSPALSEFRXXXXXXXXXXXXXPITSVYAEYLHFVEQKTSLVEDEIVKLQALLHYGSMFSELKP
PUR4_SALPA      MMEILRGSPALSAFRINKLLARFQAANLQVHNIYAEYVHFADLNAPLNDSEQAQLTRLLQYGPALNSHTP
PUR4_VIBCH      ---ILRGSPALSEFRVNKLLTACREQQLPVTGIYAEFMHFADLKAELNPQELEKLEKLLTYGPTIQEHEP
PUR4_PSEPK      ---ILRGAPALSAFRHGKLL---EQLSQKVPAVTAEFAHFADVDGELTADQQQVLGRLLKYGPSVPVQEP
PUR4_HAEIN      -VKTFRGSPALSEFRXXXXXXXXXXXXXPITSVYAEYLHFVEQKTSLVEDEIVKLQALLHYGSMFSELKP
PUR4_PSEA6      ---VLRGAPALSEFRTKKLMQSIEALNLPVHALFAEFVHFAQVSAQLEANDQQVLDKLLTYGPKIQEKQH
PUR4_SALCH      MMEILRGSPALSAFRINKLLARFQAANLQVHNIYAEYVHFADLNAPLNDSEQAQLTRLLQYGPALSSHTP
PUR4_SALTI      MMEILRGSPALSAFRINKLLARFQAANLQVHNIYAEYVHFADLNAPLNDSEQAQLTRLLQYGPALSSHTL
PUR4_YERPN      ---ILRGSPALSAFRITKLLSRCQDAHLPVSDIYAEYVHFADVSAPLSADEHARLQRLLQYGPSLPEHPP
PUR4_YERPE      ---ILRGSPALSAFRITKLLSRCQDAHLLVSDIYAEYVHFADVSAPLSADEHARLQRLLQYGPSLPEHPP
PUR4_YERPA      ---ILRGSPALSAFRITKLLSRCQDAHLLVSDIYAEYVHFADVSAPLSADEHARLQRLLQYGPSLPEHPP
PUR4_YERPS      ---ILRGSPALSAFRITKLLSRCQDAHLPVSDIYAEYVHFADVSAPLSADEHARLQRLLQYGPSLPEHPP
PUR4_VIBPA      ---ILRGSPALSEFRVNKLLELCREQDLPVTGIYAEFMHFAXXXXXXXXXXXXXXXXXXTYGPTIEEHEP
PUR4_SHEFN      ---IIRGAPALSAFRVQKLMEACENAALPVSQIYAEYVHLASLSEPLDDNERLQLETILTYGPAIESHAP
PUR4_VIBVU      ---ILRGSPALSEFRVNKLLELCREQDLPVTGIYAEFMHFADLTSXXXXXXXXXXXXXXTYGPTIEEHEP
PUR4_PSEPF      ---ILRGAPALSAFRHSKLL---EQLSQKVPAVSAEFAHFAEVTGVLTGDEQQVLARLLKYGPSVPVQEP
PUR4_ERWCT      ---ILRGSPALSAFRINKLLVRCKEHLLPVSDIYAEYVHFADVSTPLNNDEQAKLTRLLKYGPSLAEHEP
PUR4_VIBVY      ---ILRGSPALSEFRVNKLLELCREQDLPVTGIYAEFMHFADLTSXXXXXXXXXXXXXXTYGPTIEEHEP
PUR4_IDILO      ---IYRGAPALSAFKTTKQLEQLKQAGIPVKELYAEYQHFVDLHNELSDEHRSVLVQLLKYGPEMPAHEP
PUR4_VIBF1      ---ILRGSPALSEFRVNKLLELCRELSLPVTGIYAEFAHFADVTAELDASEVQKLEKLLTYGPTIXXXXX
PUR4_HAES1      MLHIFRGTPALSNFRLNQLFSGFQQDNLPIVSCYAEFLHFAHLSXXXXXXXXXXXXXXXRYGPTQKSQEP
PUR4_SHESR      ---IIRGAPALSTFRVQKLMEACVNAALPVRQIYAEYVHLADLSELLETNEREQLEKILTYGPAIEAHTP
PUR4_SHESM      ---IIRGAPALSTFRVQKLMEACVNAALPVRQIYAEYVHLADLSELLETNEREQLEKILTYGPAIEAHTP
PUR4_SHEON      ---IIRGAPALSTFRVQKLMEACVSAALPVRQIYAEYVHLADLSELLKPTEREQLEKILTYGPAIEAHTP
PUR4_METFK      ------GSAALSPFRIEKILAALKGSAPRITHLYAEFWHFAWSDQPLSEAQQEVLKQILTYGPRMSEEAP
PUR4_SODGM      ---ILRGSPALSAFRINKLLVRCRDARLAVDDIYAEYIHFADVSAALDEDALSRLQRLLKYGPSLAEHQP
PUR4_MYXXD      ------GAPALSDFRLAKLLAQCRERVPSVSSIYAEFVHLIDAPAPLSEADLATLGRLLDYGPRVATGAR
PUR4_RALSO      ----FPGALALSAFRQQRLLSTLKRIDPEIDAVSAQYLHFVXXXXXXXXXXXXRVQALLTYGSPAS-AET
PUR4_NEIMB      ------GVTALSDFRVEKLLQKAAALGLPEVKLSSEFWYFVGSEKALDAATVEKLQALLAAQEQTPKARE
PUR4_NEIG1      ------GVTALSDFRVEKLLQKAAALGLPEVKLSSEFWYFAGSEKALDAATVEKLQALLAAQEQTPEARE
PUR4_NEIMA      ------GVTALSDFRVEKLLQKAAALGLPEVKLSSEFWYFVGSEKALDAATVEKLQALLAAQEQTPKARE
PUR4_SCHPO      ---VYYGGSALSVQSKKKILELTV---SGVSDLNAVYFYLTKSNSSLNCESLRPILSDLQESE----FKP
PUR4_YEAST      ---ILPGPKALSQFRVDNLIKDINSYTNSINELRSCYIHVNGIAQNLSEQDTKLLEVLLTYDSALDIANP
PUR4_XYLFT      ---VLKGASALSPFRLARFESRLQTTVPELRIVGAWHCYLIQIKSGHTLDMSALHRIL---QAESVSELP
PUR4_XYLFA      ---VLKGASALSPFRLARFESRLQTTVPELHIVGAWHCYLIQIKSGHTLDMSALHRIL---QAESVSEPP
PUR4_XANAC      ---VLEGASALSPFRRARLETRLQTLVPALRITGAWHVYFIRPEAGQSPDQATLQRILQXXXXXXXXXXX
PUR4_XANCP      ---VLEGASALSPFRRARLETRLQTLVPALRLTGAWHVYFIRADAGRTPDQATLQRILQXXXXXXXXXXX
PUR4_ARATH      ----------------ELLKAVQTKISNQIVSLTTEQSFNIGLESKLKDEKLSVLKSFLERKKQEGL---
PUR4_DICDI      ----------------------------------------------------------------------
PUR4_DROME      ----------------------------------------------------------------------
PUR4_HUMAN      ----------------------------------------------------------------------
PUR4_MOUSE      ----------------------------------------------------------------------
PUR4_CAEEL      -----------------------KKFNRKID-VSVEYCHVITQEPELISSNWEKLVTLLSHSKESQLHPE
PURL_ARCFU      ----------------------------------------------------------------------
PURL_PICTO      ----------------------------------------------------------------------
PURL_THEAC      ----------------------------------------------------------------------
PURL_THEVO      ----------------------------------------------------------------------
PURL_MYCA9      ----------------------------------------------------------------------
PURL_NOCFA      ----------------------------------------------------------------------
PURL_LACS1      ----------------------------------------------------------------------
PURL_ZYMMO      ----------------------------------------------------------------------
PURL_THETN      ----------------------------------------------------------------------
PURL_CORGL      ----------------------------------------------------------------------
PURL_CORGB      ----------------------------------------------------------------------
PURL_THEPX      ----------------------------------------------------------------------
PURL_RHOE4      ----------------------------------------------------------------------
PURL_CARHZ      ----------------------------------------------------------------------
PURL_THEP3      ----------------------------------------------------------------------
PURL_RHORT      ----------------------------------------------------------------------
PURL_MYCPA      ----------------------------------------------------------------------
PURL_MYCA1      ----------------------------------------------------------------------
PURL_CORJK      ----------------------------------------------------------------------
PURL_OCEIH      ----------------------------------------------------------------------
PURL_MYCVP      ----------------------------------------------------------------------
PURL_NOCSJ      ----------------------------------------------------------------------
PURL_STAS1      ----------------------------------------------------------------------
PURL_MYCGI      ----------------------------------------------------------------------
PURL_LACH4      ----------------------------------------------------------------------
PURL_CORAM      ----------------------------------------------------------------------
PURL_THESM      ----------------------------------------------------------------------
PURL_PELUB      ----------------------------------------------------------------------
PURL_NOVAD      ----------------------------------------------------------------------
PURL_LACF3      ----------------------------------------------------------------------
PURQ_METM5      ----------------------------------------------------------------------
PURL_PYRAB      ----------------------------------------------------------------------
PURQ_METMP      ----------------------------------------------------------------------
PURL_STACT      ----------------------------------------------------------------------
PURL_BACLD      ----------------------------------------------------------------------
PURL_PARL1      ----------------------------------------------------------------------
PURL_MYCTU      ----------------------------------------------------------------------
PURL_MYCTA      ----------------------------------------------------------------------
PURL_MYCBT      ----------------------------------------------------------------------
PURL_MYCBP      ----------------------------------------------------------------------
PURL_MYCBO      ----------------------------------------------------------------------
PURL_RENSM      ----------------------------------------------------------------------
PURL_STRCO      ----------------------------------------------------------------------
PURL_CORA7      ----------------------------------------------------------------------
PURL_THEGJ      ----------------------------------------------------------------------
PURL_EXISA      ----------------------------------------------------------------------
PURL_STRAW      ----------------------------------------------------------------------
PURL_ROSDO      ----------------------------------------------------------------------
VP75_SHV21      ----------------------------------------------------------------------
PURQ_METM7      ----------------------------------------------------------------------
PURL_STAAN      ----------------------------------------------------------------------
PURL_STAAM      ----------------------------------------------------------------------
PURL_STAA9      ----------------------------------------------------------------------
PURL_STAA2      ----------------------------------------------------------------------
PURL_STAA1      ----------------------------------------------------------------------
PURL_METJA      ----------------------------------------------------------------------
PURL_LACLM      ----------------------------------------------------------------------
PURL_LACLC      ----------------------------------------------------------------------
PURL_GLUOX      ----------------------------------------------------------------------
PURL_ANASK      ----------------------------------------------------------------------
PURL_ANADF      ----------------------------------------------------------------------
PURL_COREF      ----------------------------------------------------------------------
PURL_STAAW      ----------------------------------------------------------------------
PURL_STAAT      ----------------------------------------------------------------------
PURL_STAAS      ----------------------------------------------------------------------
PURL_STAAE      ----------------------------------------------------------------------
PURL_STAAC      ----------------------------------------------------------------------
PURL_STAA8      ----------------------------------------------------------------------
PURL_STAA3      ----------------------------------------------------------------------
PURL_PYRKO      ----------------------------------------------------------------------
PURL_GEOSW      ----------------------------------------------------------------------
PURL_STAAR      ----------------------------------------------------------------------
PURL_LACLS      ----------------------------------------------------------------------
PURQ_THEAC      ----------------------------------------------------------------------
PURL_METST      ----------------------------------------------------------------------
PURL_FRASC      ----------------------------------------------------------------------
PURL_ERYLH      ----------------------------------------------------------------------
PURL_MYCLE      ----------------------------------------------------------------------
PURL_MYCLB      ----------------------------------------------------------------------
PURL_BACSU      ----------------------------------------------------------------------
PURL_TROWT      ----------------------------------------------------------------------
PURL_TROW8      ----------------------------------------------------------------------
PURL_THELT      ----------------------------------------------------------------------
PURL_MACCJ      ----------------------------------------------------------------------
PURL_LACAC      ----------------------------------------------------------------------
PURL_STAAB      ----------------------------------------------------------------------
PURL_BACC2      ----------------------------------------------------------------------
PURL_MESSB      ----------------------------------------------------------------------
PURL_BACSK      ----------------------------------------------------------------------
PURL_BACCR      ----------------------------------------------------------------------
PURL_LACC3      ----------------------------------------------------------------------
PURL_CALMQ      ----------------------------------------------------------------------
PURL_BACC4      ----------------------------------------------------------------------
PURL_AZOC5      ----------------------------------------------------------------------
PURQ_PICTO      ----------------------------------------------------------------------
PURL_STAES      ----------------------------------------------------------------------
PURL_STAEQ      ----------------------------------------------------------------------
PURL_LACRJ      ----------------------------------------------------------------------
PURL_LACRD      ----------------------------------------------------------------------
PURL_PYRFU      ----------------------------------------------------------------------
PURL_BACA2      ----------------------------------------------------------------------
MTP_EBVG        ----------------------------------------------------------------------
PURL_GEOTN      ----------------------------------------------------------------------
PURL_PYRHO      ----------------------------------------------------------------------
PURL_BACWK      ----------------------------------------------------------------------
PURQ_THEVO      ----------------------------------------------------------------------
PURL_RHOS5      ----------------------------------------------------------------------
PURL_BACCN      ----------------------------------------------------------------------
MTP_EBVA8       ----------------------------------------------------------------------
PURL_BARHE      ----------------------------------------------------------------------
PURL_GLOVI      ----------------------------------------------------------------------
PURL_FRASN      ----------------------------------------------------------------------
PURL_STAHJ      ----------------------------------------------------------------------
PURL_RHOP5      ----------------------------------------------------------------------
PURL_ANADE      ----------------------------------------------------------------------
MTP_EBVB9       ----------------------------------------------------------------------
VP03_SHV21      ----------------------------------------------------------------------
PURL_LISMF      ----------------------------------------------------------------------
PURL_HALMA      ----------------------------------------------------------------------
PURL_RHOP2      ----------------------------------------------------------------------
PURL_LACCA      ----------------------------------------------------------------------
PURL_BARQU      ----------------------------------------------------------------------
PURL_BACP2      ----------------------------------------------------------------------
PURL_RHOPB      ----------------------------------------------------------------------
PURL_GEOKA      ----------------------------------------------------------------------
PURL_BRASO      ----------------------------------------------------------------------
PURL_SULIY      ----------------------------------------------------------------------
PURL_SULIN      ----------------------------------------------------------------------
PURL_SULIL      ----------------------------------------------------------------------
PURL_SULIA      ----------------------------------------------------------------------
PURL_RHOSK      ----------------------------------------------------------------------
PURL_SULSO      ----------------------------------------------------------------------
PURL_SULIM      ----------------------------------------------------------------------
PURL_SULIK      ----------------------------------------------------------------------
PURL_METSB      ----------------------------------------------------------------------
PURQ_TREDE      ----------------------------------------------------------------------
PURL_RHOS4      ----------------------------------------------------------------------
PURL_META3      ----------------------------------------------------------------------
PURL_BACC3      ----------------------------------------------------------------------
PURL_BACC0      ----------------------------------------------------------------------
PURL_BACAN      ----------------------------------------------------------------------
PURL_BACAH      ----------------------------------------------------------------------
PURL_BACAC      ----------------------------------------------------------------------
PURL_BACAA      ----------------------------------------------------------------------
PURL_PROAC      ----------------------------------------------------------------------
PURL_ANOFW      ----------------------------------------------------------------------
PURL_THERP      ----------------------------------------------------------------------
PURL_THEFY      ----------------------------------------------------------------------
PURL_BACCZ      ----------------------------------------------------------------------
PURL_ACAM1      ----------------------------------------------------------------------
PURL_LACDB      ----------------------------------------------------------------------
PURL_LACDA      ----------------------------------------------------------------------
PURL_BACCQ      ----------------------------------------------------------------------
PURL_BACHK      ----------------------------------------------------------------------
PURL_BACC7      ----------------------------------------------------------------------
PURQ_ARCFU      ----------------------------------------------------------------------
PURL_BRASB      ----------------------------------------------------------------------
PURL_BACHD      ----------------------------------------------------------------------
PURL_BACC1      ----------------------------------------------------------------------
PURL_SULAC      ----------------------------------------------------------------------
PURL_RHOPA      ----------------------------------------------------------------------
PURL_NITWN      ----------------------------------------------------------------------
PURL_LACLA      ----------------------------------------------------------------------
PURL_ENTFA      ----------------------------------------------------------------------
PURL_RHOPT      ----------------------------------------------------------------------
PURL_PROM9      ----------------------------------------------------------------------
PURL_ANAD2      ----------------------------------------------------------------------
PURL_HALWD      ----------------------------------------------------------------------
PURL_RHOPS      ----------------------------------------------------------------------
PURL_PETMO      ----------------------------------------------------------------------
PURL_ALKMQ      ----------------------------------------------------------------------
PURL_PROMS      ----------------------------------------------------------------------
PURL_BEII9      ----------------------------------------------------------------------
PURL_BARBK      ----------------------------------------------------------------------
PURL_CHLCH      ----------------------------------------------------------------------
PURL_SILST      ----------------------------------------------------------------------
PURL_SULDN      ----------------------------------------------------------------------
PURL_THEEB      ----------------------------------------------------------------------
PURL_SYMTH      ----------------------------------------------------------------------
PURL_SILPO      ----------------------------------------------------------------------
PURL_RHILO      ----------------------------------------------------------------------
PURL_PARDP      ----------------------------------------------------------------------
PURL_GRABC      ----------------------------------------------------------------------
PURL_LEIXX      ----------------------------------------------------------------------
PURL_CAMLR      ----------------------------------------------------------------------
PURL_SINMW      ----------------------------------------------------------------------
PURL_SYNY3      ----------------------------------------------------------------------
PURL_LEUMM      ----------------------------------------------------------------------
PURL_PROMA      ----------------------------------------------------------------------
PURL_LISW6      ----------------------------------------------------------------------
PURL_JANSC      ----------------------------------------------------------------------
PURL_CAMHC      ----------------------------------------------------------------------
PURL_RHIME      ----------------------------------------------------------------------
PURL_LISMC      ----------------------------------------------------------------------
PURL_LISIN      ----------------------------------------------------------------------
PURL_PROMP      ----------------------------------------------------------------------
PURL_OCHA4      ----------------------------------------------------------------------
PURL_LISMH      ----------------------------------------------------------------------
PURL_RHIEC      ----------------------------------------------------------------------
PURL_METS3      ----------------------------------------------------------------------
PURL_LISMO      ----------------------------------------------------------------------
PURL_RHIL3      ----------------------------------------------------------------------
PURL_NITHX      ----------------------------------------------------------------------
PURL_BRUME      ----------------------------------------------------------------------
PURL_BRUMB      ----------------------------------------------------------------------
PURL_BRUAB      ----------------------------------------------------------------------
PURL_BRUA2      ----------------------------------------------------------------------
PURL_BRUA1      ----------------------------------------------------------------------
PURL_ACICJ      ----------------------------------------------------------------------
PURL_PROM0      ----------------------------------------------------------------------
PURL_LACPL      ----------------------------------------------------------------------
PURL_IGNH4      ----------------------------------------------------------------------
PURL_WOLSU      ----------------------------------------------------------------------
PURL_RHILW      ----------------------------------------------------------------------
PURL_RHIE6      ----------------------------------------------------------------------
PURL_BART1      ----------------------------------------------------------------------
PURL_SYNJB      ----------------------------------------------------------------------
PURL_AGRT5      ----------------------------------------------------------------------
PURL_SULNB      ----------------------------------------------------------------------
PURL_BRUSU      ----------------------------------------------------------------------
PURL_BRUSI      ----------------------------------------------------------------------
PURL_BRUO2      ----------------------------------------------------------------------
PURL_BRUC2      ----------------------------------------------------------------------
PURL_RHOSR      ----------------------------------------------------------------------
PURL_RHIFR      ----------------------------------------------------------------------
PURL_BRAJA      ----------------------------------------------------------------------
PURL_PROM2      ----------------------------------------------------------------------
PURL_AQUAE      ----------------------------------------------------------------------
PURL_RHISN      ----------------------------------------------------------------------
PURQ_DEHE1      ----------------------------------------------------------------------
PURL_PELLD      ----------------------------------------------------------------------
PURL_MOOTA      ----------------------------------------------------------------------
PURL_PROM5      ----------------------------------------------------------------------
PURL_CHLTE      ----------------------------------------------------------------------
PURL_AGRVS      ----------------------------------------------------------------------
PURL_THEMA      ----------------------------------------------------------------------
PURL_NATPD      ----------------------------------------------------------------------
PURL_ANAVT      ----------------------------------------------------------------------
PURL_THET8      ----------------------------------------------------------------------
PURL_THET2      ----------------------------------------------------------------------
PURL_DEIRA      ----------------------------------------------------------------------
PURL_SYNJA      ----------------------------------------------------------------------
PURL_PYRAE      ----------------------------------------------------------------------
PURL_METTH      ----------------------------------------------------------------------
PURL_CAMC1      ----------------------------------------------------------------------
PURQ_METKA      ----------------------------------------------------------------------
PURL_SYNPX      ----------------------------------------------------------------------
PURL_RHOOB      ----------------------------------------------------------------------
PURL_METKA      ----------------------------------------------------------------------
PURL_NOSP7      ----------------------------------------------------------------------
PURL_ANASP      ----------------------------------------------------------------------
PURL_CAMJR      ----------------------------------------------------------------------
PURL_SYNS9      ----------------------------------------------------------------------
PURL_PYRAR      ----------------------------------------------------------------------
PURL_SYNPW      ----------------------------------------------------------------------
PURL_CAMJD      ----------------------------------------------------------------------
PURL_SYNP6      ----------------------------------------------------------------------
PURL_SYNE7      ----------------------------------------------------------------------
PURL_HELHP      ----------------------------------------------------------------------
PURL_CAMJE      ----------------------------------------------------------------------
PURL_AGRRK      ----------------------------------------------------------------------
PURL_PROMM      ----------------------------------------------------------------------
PURL_CAMJJ      ----------------------------------------------------------------------
PURL_CAMC5      ----------------------------------------------------------------------
PURQ_METST      ----------------------------------------------------------------------
PURL_SYNSC      ----------------------------------------------------------------------
PURQ_SYNP6      ----------------------------------------------------------------------
PURQ_SYNE7      ----------------------------------------------------------------------
PURL_HALLT      ----------------------------------------------------------------------
PURL_CAMJ8      ----------------------------------------------------------------------
PURL_PROM3      ----------------------------------------------------------------------
PURQ_PELUB      ----------------------------------------------------------------------
PURL_CYAP4      ----------------------------------------------------------------------
PURQ_THERP      ----------------------------------------------------------------------
PURL_PYRCJ      ----------------------------------------------------------------------
PURQ_SYNY3      ----------------------------------------------------------------------
PURL_THENV      ----------------------------------------------------------------------
PURL_METMA      ----------------------------------------------------------------------
PURQ_SALRD      ----------------------------------------------------------------------
PURL_CAUCR      ----------------------------------------------------------------------
PURL_NITSB      ----------------------------------------------------------------------
PURQ_PYRHO      ----------------------------------------------------------------------
PURQ_CARHZ      ----------------------------------------------------------------------
PURL_PROMT      ----------------------------------------------------------------------
PURQ_CORAM      ----------------------------------------------------------------------
PURQ_LACAC      ----------------------------------------------------------------------
PURQ_CHLP8      ----------------------------------------------------------------------
PURQ_PYRKO      ----------------------------------------------------------------------
PURQ_EXISA      ----------------------------------------------------------------------
PURQ_EXIS2      ----------------------------------------------------------------------
PURL_SULTO      ----------------------------------------------------------------------
PURQ_SULDN      ----------------------------------------------------------------------
PURL_PROM1      ----------------------------------------------------------------------
PURQ_PYRFU      ----------------------------------------------------------------------
PURQ_PYRAB      ----------------------------------------------------------------------
PURQ_MOOTA      ----------------------------------------------------------------------
PURQ_RHIL3      ----------------------------------------------------------------------
PURQ_LACF3      ----------------------------------------------------------------------
PURQ_BREBN      ----------------------------------------------------------------------
PURQ_RHIME      ----------------------------------------------------------------------
PURL_METTP      ----------------------------------------------------------------------
PURQ_CHLTE      ----------------------------------------------------------------------
PURQ_PROMT      ----------------------------------------------------------------------
PURQ_COREF      ----------------------------------------------------------------------
PURQ_SYNJA      ----------------------------------------------------------------------
PURQ_ACAM1      ----------------------------------------------------------------------
PURQ_STAAS      ----------------------------------------------------------------------
PURL_METBF      ----------------------------------------------------------------------
PURL_LEPBL      ----------------------------------------------------------------------
PURL_LEPBJ      ----------------------------------------------------------------------
PURQ_THELT      ----------------------------------------------------------------------
PURQ_SYNS9      ----------------------------------------------------------------------
PURQ_STAAW      ----------------------------------------------------------------------
PURQ_STAAN      ----------------------------------------------------------------------
PURQ_STAAM      ----------------------------------------------------------------------
PURQ_STAAC      ----------------------------------------------------------------------
PURQ_STAA8      ----------------------------------------------------------------------
PURQ_STAA3      ----------------------------------------------------------------------
PURQ_HALSA      ----------------------------------------------------------------------
PURQ_BACWK      ----------------------------------------------------------------------
PURQ_SYNSC      ----------------------------------------------------------------------
PURQ_STAAR      ----------------------------------------------------------------------
PURQ_STAAB      ----------------------------------------------------------------------
PURQ_PROMA      ----------------------------------------------------------------------
PURQ_NATPD      ----------------------------------------------------------------------
PURQ_LACLA      ----------------------------------------------------------------------
PURQ_BACHK      ----------------------------------------------------------------------
PURQ_BACC7      ----------------------------------------------------------------------
PURQ_BACC2      ----------------------------------------------------------------------
PURQ_BACC1      ----------------------------------------------------------------------
PURQ_BACC0      ----------------------------------------------------------------------
PURQ_BACAN      ----------------------------------------------------------------------
PURQ_BACAC      ----------------------------------------------------------------------
PURQ_BACAA      ----------------------------------------------------------------------
PURL_LEPIC      ----------------------------------------------------------------------
PURL_LACSS      ----------------------------------------------------------------------
PURQ_BACCR      ----------------------------------------------------------------------
PURQ_BACC4      ----------------------------------------------------------------------
PURQ_BACAH      ----------------------------------------------------------------------
PURL_LEPIN      ----------------------------------------------------------------------
PURQ_SYNPX      ----------------------------------------------------------------------
PURQ_METAC      ----------------------------------------------------------------------
PURQ_HALWD      ----------------------------------------------------------------------
PURQ_STAS1      ----------------------------------------------------------------------
PURQ_PELLD      ----------------------------------------------------------------------
PURQ_NITWN      ----------------------------------------------------------------------
PURQ_NITHX      ----------------------------------------------------------------------
PURQ_METMA      ----------------------------------------------------------------------
PURQ_BRAJA      ----------------------------------------------------------------------
PURQ_BACC3      ----------------------------------------------------------------------
PURQ_WOLSU      ----------------------------------------------------------------------
PURQ_THEEB      ----------------------------------------------------------------------
PURQ_SYNJB      ----------------------------------------------------------------------
PURQ_RHORT      ----------------------------------------------------------------------
PURQ_BACCZ      ----------------------------------------------------------------------
PURQ_BACCQ      ----------------------------------------------------------------------
PURQ_ANAVT      ----------------------------------------------------------------------
PURQ_RHOSR      ----------------------------------------------------------------------
PURQ_BARQU      ----------------------------------------------------------------------
PURQ_AQUAE      ----------------------------------------------------------------------
PURQ_ANASP      ----------------------------------------------------------------------
PURL_METAC      ----------------------------------------------------------------------
PURQ_RHIEC      ----------------------------------------------------------------------
PURQ_PROMM      ----------------------------------------------------------------------
PURQ_METTH      ----------------------------------------------------------------------
PURQ_LACRJ      ----------------------------------------------------------------------
PURQ_LACRD      ----------------------------------------------------------------------
PURQ_BARHE      ----------------------------------------------------------------------
PURQ_BACCN      ----------------------------------------------------------------------
PURQ_NOCFA      ----------------------------------------------------------------------
PURQ_STRCO      ----------------------------------------------------------------------
PURQ_SILPO      ----------------------------------------------------------------------
PURQ_MYCLE      ----------------------------------------------------------------------
PURQ_LACLC      ----------------------------------------------------------------------
PURQ_JANSC      ----------------------------------------------------------------------
PURQ_DEIGD      ----------------------------------------------------------------------
PURQ_ANOFW      ----------------------------------------------------------------------
PURL_LEPBP      ----------------------------------------------------------------------
PURL_LEPBA      ----------------------------------------------------------------------
PURQ_THETN      ----------------------------------------------------------------------
PURQ_STAES      ----------------------------------------------------------------------
PURQ_STAEQ      ----------------------------------------------------------------------
PURQ_LACPL      ----------------------------------------------------------------------
PURQ_PROAC      ----------------------------------------------------------------------
PURQ_METJA      ----------------------------------------------------------------------
PURQ_OCEIH      ----------------------------------------------------------------------
PURQ_METBF      ----------------------------------------------------------------------
PURQ_PYRAE      ----------------------------------------------------------------------
PURQ_MESSB      ----------------------------------------------------------------------
PURL_PYRIL      ----------------------------------------------------------------------
PURQ_SULSO      ----------------------------------------------------------------------
PURQ_LISIN      ----------------------------------------------------------------------
PURQ_BRUSU      ----------------------------------------------------------------------
PURQ_BRUME      ----------------------------------------------------------------------
PURQ_BRUAB      ----------------------------------------------------------------------
PURQ_BRUA2      ----------------------------------------------------------------------
PURQ_PROM9      ----------------------------------------------------------------------
PURQ_LACCB      ----------------------------------------------------------------------
PURQ_BACHD      ----------------------------------------------------------------------
PURQ_SILST      ----------------------------------------------------------------------
PURQ_LISW6      ----------------------------------------------------------------------
PURQ_GEOSW      ----------------------------------------------------------------------
PURQ_CORGL      ----------------------------------------------------------------------
PURQ_THET8      ----------------------------------------------------------------------
PURQ_THET2      ----------------------------------------------------------------------
PURQ_LISMH      ----------------------------------------------------------------------
PURQ_LACC3      ----------------------------------------------------------------------
PURQ_NOVAD      ----------------------------------------------------------------------
PURQ_LISMO      ----------------------------------------------------------------------
PURQ_LISMF      ----------------------------------------------------------------------
PURQ_LISMC      ----------------------------------------------------------------------
PURQ_LEIXX      ----------------------------------------------------------------------
PURQ_LACDA      ----------------------------------------------------------------------
PURQ_RHOP2      ----------------------------------------------------------------------
PURQ_MYCPA      ----------------------------------------------------------------------
PURQ_HELHP      ----------------------------------------------------------------------
PURL_HALSA      ----------------------------------------------------------------------
PURL_HALS3      ----------------------------------------------------------------------
PURQ_LACSS      ----------------------------------------------------------------------
PURQ_BACP2      ----------------------------------------------------------------------
PURQ_ALKMQ      ----------------------------------------------------------------------
PURQ_SPHAL      ----------------------------------------------------------------------
PURQ_PROMP      ----------------------------------------------------------------------
PURQ_BACSU      ----------------------------------------------------------------------
PURQ_LYSSC      ----------------------------------------------------------------------
PURL_SALRD      ----------------------------------------------------------------------
PURQ_RHILO      ----------------------------------------------------------------------
PURQ_STAHJ      ----------------------------------------------------------------------
PURQ_RHOPB      ----------------------------------------------------------------------
PURQ_MYCTU      ----------------------------------------------------------------------
PURQ_MYCBO      ----------------------------------------------------------------------
PURQ_GLOVI      ----------------------------------------------------------------------
PURQ_METTP      ----------------------------------------------------------------------
PURQ_DEIRA      ----------------------------------------------------------------------
PURQ_BACA2      ----------------------------------------------------------------------
PURQ_GEOTN      ----------------------------------------------------------------------
PURQ_CHLCH      ----------------------------------------------------------------------
PURQ_BACLD      ----------------------------------------------------------------------
PURQ_SYMTH      ----------------------------------------------------------------------
PURQ_ENTFA      ----------------------------------------------------------------------
PURQ_CAUCR      ----------------------------------------------------------------------
PURQ_THEMA      ----------------------------------------------------------------------
PURQ_LEPIN      ----------------------------------------------------------------------
PURQ_LEPIC      ----------------------------------------------------------------------
PURQ_CORJK      ----------------------------------------------------------------------
PURQ_CAMJE      ----------------------------------------------------------------------
PURQ_RHOPA      ----------------------------------------------------------------------
PURQ_GEOKA      ----------------------------------------------------------------------
PURQ_ACIBL      ----------------------------------------------------------------------
PURQ_LACS1      ----------------------------------------------------------------------
PURL_METS5      ----------------------------------------------------------------------
PURQ_ZYMMO      ----------------------------------------------------------------------
PURQ_RUBXD      ----------------------------------------------------------------------
PURQ_ROSDO      ----------------------------------------------------------------------
PURQ_STRAW      ----------------------------------------------------------------------
PURQ_RHOS4      ----------------------------------------------------------------------
PURQ_GLUOX      ----------------------------------------------------------------------
PURQ_ANADE      ----------------------------------------------------------------------
PURQ_BACSK      ----------------------------------------------------------------------
PURL_CALMQ      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           MGHTFIIAPRVGTISPWSSKATDIIKNTGIKAVKRIERAILFGVEGQVSASELKQIQDIVHDRMVEEVFS
PUR4_PHOLL      QGTLLLVTPRPGTISPWSSKATDIAHNCGLSQVVRLERGVAYYIQGEMSDTQWQILSSLLHDRMMETVFT
PUR4_PSEHT      AGKLVLVTPRPGTISPWASKATDIAHNCGLKQVHRVERGIAYYVEGELNAEQLLQVTALLHDRMTEATHS
PUR4_PSEU2      SGRLFLVLPRFGTISPWSSKASDIARNCGLSKIQRLERGIAFYVEGQFSETEAQAIADSLHDRMTQLVLG
PUR4_PSE14      SGRLFLVLPRFGTISPWSSKASDIARNCGLTKIQRIERGIAFYVEGQFSEAQAQAIADSLHDRMTQLVLG
PUR4_PSESM      AGRLFLVLPRFGTISPWSSKASDIARNCGLTKIQRIERGIAFYVEGQFSDADAQAIADSLHDRMTQLVLG
PUR4_PASMU      VGHCFIVIPRIGTISSWSSKATDIAHNCGLNKVNRLERGLAFYFEFDLSSEEQQRLVSHIHDRMLEGIIH
PUR4_HAHCH      SGTLFLVVPRPGTISPWSSKATDIAHNCGLTAIRRIERGVAYGSSEQLSSERRAAIAAILHDRMTQSVFH
PUR4_PHOPR      TGTMLLVTPRPGTISPWSSKSTDIAQNCALGNVKRLERGTAYYVEADLTNAQLTDLKALIHDRMMEVVFT
PUR4_SHIDS      QGKLLLVTPRLGTISPWSSKATDIAHNCGLQQVNRLERGVAYYIEGTLTNEQWQQVTAELHDRMMETVFF
PUR4_ECOLI      QGKLLLVTPRPGTISPWSSKATDIAHNCGLQQVNRLERGVAYYIEGTLTNEQWQQVTAELHDRMMETVFF
PUR4_ECO57      QGKLLLVTPRPGTISPWSSKATDIAHNCGLQQVNRLERGVAYYIEGTLTNEQWQQVTAELHDRMMETVFF
PUR4_SHISS      QGKLLLVTPRPGTISPWSSKATDIAHNCGLQQVNRLERGVAYYIEGTLTNEQWQQVTAELHDRMMETVFF
PUR4_PSEAE      SGRLFLVVPRFGTISPWSSKASDIARNCGLAKIDRLERGIAYYVQGELSESDAQQVAARLHDRMTQLVLD
PUR4_SHIBS      QGKLLLVTPRPGTISPWSSKATDIAHNCGLQQVNRLERGVAYYIEGTLTNEQWQQVTAELHDRMMETVFF
PUR4_PSEF5      TGRLFLVLPRFGTISPWSSKASDIARNCGLAKIQRLERGIAFYVAGEFSEAEAQLIADALHDRMTQIVVA
PUR4_SHEDO      KGQLYLVTPRPGTISPWSSKATDIAHNCGLSQIKRLERGIAYYVEADLDASQQKALQALLYDRMVEVIFD
PUR4_ECOL6      QGKLLLVTPRPGTISPWSSKATDIAHNCGLQQVNRLERGVAYYIEGTLTNEQWQQVTAELHDRMMETVFF
PUR4_COLP3      AGLFLLVTPRPGTISPWSSKSTDIAHNCGLAKVERLERGIAYYVDAQLSTSQEAQLNTLLHDRMMESIFN
PUR4_MANSM      KGECFVVIPRVGTISSWSSKATDIAHNCGLDKVVRLERGIAFEFERTLSAEQQQRLVSHIHDRMMETVVR
PUR4_ECOUT      QGKLLLVTPRPGTISPWSSKATDIAHNCGLQQVNRLERGVAYYIEGTLTNEQWQQVTAELHDRMMETVFF
PUR4_ECOL5      QGKLLLVTPRPGTISPWSSKATDIAHNCGLQQVNRLERGVAYYIEGTLTNEQWQQVTAELHDRMMETVFF
PUR4_SALTY      AGKLLLVTPRPGTISPWSSKATDIAHNCGLQQVDRLERGVAYYIEASLTAEQWRQVAAELHDRMMETVFS
PUR4_HAEI8      AGYCLIVTPRVGTISSWSSKATDIAHNCGLSKVNRIERGIAFNIERDLTEAELATLKDLLHDRMLETVLN
PUR4_SALPA      AGKLLLVTPRPGTISPWSSKATDIAHNCGLQQVDRLERGVAYYIEASLTAEQWRQVAAELHDRMMETVFS
PUR4_VIBCH      QGLLLLVTPRPGTISPWSSKATDIAHNCGLHGIKRLERGTAYYVEAELTAAQIATLEALLHDRMMEVVFA
PUR4_PSEPK      TGRLFLVVPRLGTISPWASKASDIAHNCGLQSIQRLERGIAYYVAGTLSDADAELIAAELHDRMTQRVLG
PUR4_HAEIN      AGYCLIVTPRVGTISSWSSKATDIAHNCGLSKVNRIERGIAFNIERDLTEAELATLKDLLHDRMLETVLN
PUR4_PSEA6      KGLLLLVIPRAGTISPWSSKATDIAHNCGLNNVERLERGCAFYIDADLNDTQLIQLKNVLHDRMTQSVVS
PUR4_SALCH      AGKLLLVTPRPGTISPWSSKATDIAHNCGLQQVDRLERGVAYYIEASLTAEQWRQVAAELHDRMMETVFP
PUR4_SALTI      AGKLLLVTPRPGTISPWSSKATDIAHNCGLQQIDRLERGVAYYIEASLTAEQWRQVAAELHDRMMETVFS
PUR4_YERPN      AGRLLLVTPRPGTISPWSSKATDIAHNCGLSQILRLERGLAFSIQGDLNESQWKQLAALLHDRMMEAVFT
PUR4_YERPE      AGRLLLVTPRPGTISPWSSKATDIAHNCGLSQILRLERGLAFSIQGDLNESQWKQLAALLHDRMMEAVFT
PUR4_YERPA      AGRLLLVTPRPGTISPWSSKATDIAHNCGLSQILRLERGLAFSIQGDLNESQWKQLAALLHDRMMEAVFT
PUR4_YERPS      AGRLLLVTPRPGTISPWSSKATDIAHNCGLSQILRLERGLAFSIQGNLNEGQWKQLAALLHDRMMETVFT
PUR4_VIBPA      EGLLLLVTPRPGTISPWSSKSTDIAINCGLDTVKRLERGTAYYVESSVVLSEAQAVKALIHDRMMETVFT
PUR4_SHEFN      QGTLLFVTPRPGTISPWSSKATDIAHNCGLGKVSRLERGIAYYVEASVTAEQQKLLQGLLHDRMVEVMLP
PUR4_VIBVU      QGLLLLVTPRPGTISPWSSKATDIAQNCGLNAVKRLERAXXXXXXXXXXXXQIDIVKSIIHDRMMEAVFG
PUR4_PSEPF      TGRLFLVLPRFGTISPWSSKASDIARNCGLSKIQRLERGIAFYVAGQFSETEAQQIADVLHDRMTQIVLA
PUR4_ERWCT      QGHLLLVTPRPGTISPWSSKATDIAHNCGLSKVLRLERGLAFYIHAPLNDEQWQQLGALLHDRMMESVFS
PUR4_VIBVY      QGLLLLVTPRPGTISPWSSKATDIAQNCGLNAVKRLERAXXXXXXXXXXXXQIDIVKSIIHDRMMEAVFG
PUR4_IDILO      QGALVLVTPRIGTISPWASKATDIAHNCGLKSIHRVERGVAFYLQGDLSAEELKQAALLLHDRMTESVLY
PUR4_VIBF1      XXXXXXXXXXXXXISPWSSKSTDIAHNCGLDKIARLERGTAFXXXXXXXXXXXXXXKAILHDRMMEVVFT
PUR4_HAES1      YGECFVVIPRIGTISSWASKATDIAHNCDLNKVLRLERGIAFKFNRTLTAEEEQQLVFRIYDPMMESIVR
PUR4_SHESR      QGLLLFVTPRPGTISPWSSKATDIAHNCGLGKVKRLERGVAYYVESDTLTVEQQQLKGLLHDRMVEVVLD
PUR4_SHESM      QGSLLFVTPRPGTISPWSSKATDIAHNCGLGKVKRLERGVAYYVESDTLTVEQQQLKGLLHDRMVEVVLD
PUR4_SHEON      QGSLLFVTPRPGTISPWSSKATDIAHNCGLGKVKRLERGIAYYVESDLTAEQQRTLQGLLHDRMVEVVLN
PUR4_METFK      AGELFLVIPRPGTISPWSSRATDIARHCGIEAIQRLERGIAFYAASPLTDAEKAALRPLIHDRMTEAVFA
PUR4_SODGM      QGRLLLVTPRPGTRSPWSSKATDIAHNCGLPQIKRLERGLAYYIQAQLSEPQWGYLAALLHDRMMETVFT
PUR4_MYXXD      IGSLLLVLPRPGTISPWSSKATDIVHNCGLERVRRMERGTAFGPDGQLQDAELERLKPVLHDRMTQAVVG
PUR4_RALSO      EGDRFVVIPRFGTISPWASKATEIARHCALPQIHRIERGVEFTVTXXXDEATRAAVAAHLHDRMTEIVVA
PUR4_NEIMB      GLHLFLVTPRLGTISPWASKATNIAENCGLAGIERIERGMAVWLEGRLNDEQKQQWAALLHDRMTESVLP
PUR4_NEIG1      GLHLFLVTPRLGTISPWASKATNIAENCGLAGIERIERGMAVWLEGALTDEQKQQWAALLHDRMTESVLP
PUR4_NEIMA      GLHLFLVTPRLGTISPWASKATNIAENCGLAGIERIERGMAVWLEGALTDEQQQQWAALLHDRMTESVLP
PUR4_SCHPO      DGTTMVVFPRPGTISPWSSKATNIANVCGYKDVIRIERGIAYSVKDDISEEMLKSALNHLYDRMTEALRF
PUR4_YEAST      LARTYLIVPRSGTISPWSSKATNIAHVCGLQKVQRIERGLALLIKTVPGFPLLENLNDIVYDRMTQQLYL
PUR4_XYLFT      QKHVVYVMPRLGTHSPWSSKTTELLHGAD-QPIARIERGTRIDLLGSANAATCPAIAKQLYDPMTQSLLE
PUR4_XYLFA      QEHVVYVMPRLGTHSPWSSKTTELLHGAG-QPIARIERGTRIDLLGSANAATCPAIAKQLYDPMTQSLLE
PUR4_XANAC      XXXXYVV-PRLGTLSPWSSKATELVRGAG-QPIQRVERGTRIDLAGWPDASAQAAVAKLLHDPMTQSLLG
PUR4_XANCP      XXXXYVV-PRLGTLSPWSSKATELMRGAG-QPIQRVERGTRIDLAGWPEGADQAAVAKLLHDPMTQSLLG
PUR4_ARATH      --HAVIVGPRLSFTTAWSTNAVSICRACGLDEVTRLERSLLFSKEPLLE-NQIKEFAAMVHDRMTECVYT
PUR4_DICDI      ------VGPRMNFTTTYSSNATSICKSCNLSIIDRIERSRRYLVKSKLSEKQIDQFLELIHDRMTECLYP
PUR4_DROME      ------IGPRFNFSTPYSTNCVNIFQNLGYSEVRRMETSVTFG-EGS-KAPEAARFVPLLGDRMTQCLYT
PUR4_HUMAN      ------VGPRLNFSTPTSTNIVSVCRATGLGPVDRVETTRRYRLSAHPPSAEVEAIAATLHDRMTEQHFP
PUR4_MOUSE      ------VGPRLNFSTPASTNIVSVCQAAGLRAVDRVETTRRYRLSTDHPTAEMEAISAALHDRMTEQHYP
PUR4_CAEEL      HGKNIEIGPRTAVKTAACTNILSIFESSGIKNVERIERGIRYLVEDDVDVNEFFEI---AADKMTEAIYG
PURL_ARCFU      ----------------------------------------------------------------------
PURL_PICTO      ----------------------------------------------------------------------
PURL_THEAC      ----------------------------------------------------------------------
PURL_THEVO      ----------------------------------------------------------------------
PURL_MYCA9      ----------------------------------------------------------------------
PURL_NOCFA      ----------------------------------------------------------------------
PURL_LACS1      ----------------------------------------------------------------------
PURL_ZYMMO      ----------------------------------------------------------------------
PURL_THETN      ----------------------------------------------------------------------
PURL_CORGL      ----------------------------------------------------------------------
PURL_CORGB      ----------------------------------------------------------------------
PURL_THEPX      ----------------------------------------------------------------------
PURL_RHOE4      ----------------------------------------------------------------------
PURL_CARHZ      ----------------------------------------------------------------------
PURL_THEP3      ----------------------------------------------------------------------
PURL_RHORT      ----------------------------------------------------------------------
PURL_MYCPA      ----------------------------------------------------------------------
PURL_MYCA1      ----------------------------------------------------------------------
PURL_CORJK      ----------------------------------------------------------------------
PURL_OCEIH      ----------------------------------------------------------------------
PURL_MYCVP      ----------------------------------------------------------------------
PURL_NOCSJ      ----------------------------------------------------------------------
PURL_STAS1      ----------------------------------------------------------------------
PURL_MYCGI      ----------------------------------------------------------------------
PURL_LACH4      ----------------------------------------------------------------------
PURL_CORAM      ----------------------------------------------------------------------
PURL_THESM      ----------------------------------------------------------------------
PURL_PELUB      ----------------------------------------------------------------------
PURL_NOVAD      ----------------------------------------------------------------------
PURL_LACF3      ----------------------------------------------------------------------
PURQ_METM5      ----------------------------------------------------------------------
PURL_PYRAB      ----------------------------------------------------------------------
PURQ_METMP      ----------------------------------------------------------------------
PURL_STACT      ----------------------------------------------------------------------
PURL_BACLD      ----------------------------------------------------------------------
PURL_PARL1      ----------------------------------------------------------------------
PURL_MYCTU      ----------------------------------------------------------------------
PURL_MYCTA      ----------------------------------------------------------------------
PURL_MYCBT      ----------------------------------------------------------------------
PURL_MYCBP      ----------------------------------------------------------------------
PURL_MYCBO      ----------------------------------------------------------------------
PURL_RENSM      ----------------------------------------------------------------------
PURL_STRCO      ----------------------------------------------------------------------
PURL_CORA7      ----------------------------------------------------------------------
PURL_THEGJ      ----------------------------------------------------------------------
PURL_EXISA      ----------------------------------------------------------------------
PURL_STRAW      ----------------------------------------------------------------------
PURL_ROSDO      ----------------------------------------------------------------------
VP75_SHV21      ----------------------------------------------------------------------
PURQ_METM7      ----------------------------------------------------------------------
PURL_STAAN      ----------------------------------------------------------------------
PURL_STAAM      ----------------------------------------------------------------------
PURL_STAA9      ----------------------------------------------------------------------
PURL_STAA2      ----------------------------------------------------------------------
PURL_STAA1      ----------------------------------------------------------------------
PURL_METJA      ----------------------------------------------------------------------
PURL_LACLM      ----------------------------------------------------------------------
PURL_LACLC      ----------------------------------------------------------------------
PURL_GLUOX      ----------------------------------------------------------------------
PURL_ANASK      ----------------------------------------------------------------------
PURL_ANADF      ----------------------------------------------------------------------
PURL_COREF      ----------------------------------------------------------------------
PURL_STAAW      ----------------------------------------------------------------------
PURL_STAAT      ----------------------------------------------------------------------
PURL_STAAS      ----------------------------------------------------------------------
PURL_STAAE      ----------------------------------------------------------------------
PURL_STAAC      ----------------------------------------------------------------------
PURL_STAA8      ----------------------------------------------------------------------
PURL_STAA3      ----------------------------------------------------------------------
PURL_PYRKO      ----------------------------------------------------------------------
PURL_GEOSW      ----------------------------------------------------------------------
PURL_STAAR      ----------------------------------------------------------------------
PURL_LACLS      ----------------------------------------------------------------------
PURQ_THEAC      ----------------------------------------------------------------------
PURL_METST      ----------------------------------------------------------------------
PURL_FRASC      ----------------------------------------------------------------------
PURL_ERYLH      ----------------------------------------------------------------------
PURL_MYCLE      ----------------------------------------------------------------------
PURL_MYCLB      ----------------------------------------------------------------------
PURL_BACSU      ----------------------------------------------------------------------
PURL_TROWT      ----------------------------------------------------------------------
PURL_TROW8      ----------------------------------------------------------------------
PURL_THELT      ----------------------------------------------------------------------
PURL_MACCJ      ----------------------------------------------------------------------
PURL_LACAC      ----------------------------------------------------------------------
PURL_STAAB      ----------------------------------------------------------------------
PURL_BACC2      ----------------------------------------------------------------------
PURL_MESSB      ----------------------------------------------------------------------
PURL_BACSK      ----------------------------------------------------------------------
PURL_BACCR      ----------------------------------------------------------------------
PURL_LACC3      ----------------------------------------------------------------------
PURL_CALMQ      ----------------------------------------------------------------------
PURL_BACC4      ----------------------------------------------------------------------
PURL_AZOC5      ----------------------------------------------------------------------
PURQ_PICTO      ----------------------------------------------------------------------
PURL_STAES      ----------------------------------------------------------------------
PURL_STAEQ      ----------------------------------------------------------------------
PURL_LACRJ      ----------------------------------------------------------------------
PURL_LACRD      ----------------------------------------------------------------------
PURL_PYRFU      ----------------------------------------------------------------------
PURL_BACA2      ----------------------------------------------------------------------
MTP_EBVG        ----------------------------------------------------------------------
PURL_GEOTN      ----------------------------------------------------------------------
PURL_PYRHO      ----------------------------------------------------------------------
PURL_BACWK      ----------------------------------------------------------------------
PURQ_THEVO      ----------------------------------------------------------------------
PURL_RHOS5      ----------------------------------------------------------------------
PURL_BACCN      ----------------------------------------------------------------------
MTP_EBVA8       ----------------------------------------------------------------------
PURL_BARHE      ----------------------------------------------------------------------
PURL_GLOVI      ----------------------------------------------------------------------
PURL_FRASN      ----------------------------------------------------------------------
PURL_STAHJ      ----------------------------------------------------------------------
PURL_RHOP5      ----------------------------------------------------------------------
PURL_ANADE      ----------------------------------------------------------------------
MTP_EBVB9       ----------------------------------------------------------------------
VP03_SHV21      ----------------------------------------------------------------------
PURL_LISMF      ----------------------------------------------------------------------
PURL_HALMA      ----------------------------------------------------------------------
PURL_RHOP2      ----------------------------------------------------------------------
PURL_LACCA      ----------------------------------------------------------------------
PURL_BARQU      ----------------------------------------------------------------------
PURL_BACP2      ----------------------------------------------------------------------
PURL_RHOPB      ----------------------------------------------------------------------
PURL_GEOKA      ----------------------------------------------------------------------
PURL_BRASO      ----------------------------------------------------------------------
PURL_SULIY      ----------------------------------------------------------------------
PURL_SULIN      ----------------------------------------------------------------------
PURL_SULIL      ----------------------------------------------------------------------
PURL_SULIA      ----------------------------------------------------------------------
PURL_RHOSK      ----------------------------------------------------------------------
PURL_SULSO      ----------------------------------------------------------------------
PURL_SULIM      ----------------------------------------------------------------------
PURL_SULIK      ----------------------------------------------------------------------
PURL_METSB      ----------------------------------------------------------------------
PURQ_TREDE      ----------------------------------------------------------------------
PURL_RHOS4      ----------------------------------------------------------------------
PURL_META3      ----------------------------------------------------------------------
PURL_BACC3      ----------------------------------------------------------------------
PURL_BACC0      ----------------------------------------------------------------------
PURL_BACAN      ----------------------------------------------------------------------
PURL_BACAH      ----------------------------------------------------------------------
PURL_BACAC      ----------------------------------------------------------------------
PURL_BACAA      ----------------------------------------------------------------------
PURL_PROAC      ----------------------------------------------------------------------
PURL_ANOFW      ----------------------------------------------------------------------
PURL_THERP      ----------------------------------------------------------------------
PURL_THEFY      ----------------------------------------------------------------------
PURL_BACCZ      ----------------------------------------------------------------------
PURL_ACAM1      ----------------------------------------------------------------------
PURL_LACDB      ----------------------------------------------------------------------
PURL_LACDA      ----------------------------------------------------------------------
PURL_BACCQ      ----------------------------------------------------------------------
PURL_BACHK      ----------------------------------------------------------------------
PURL_BACC7      ----------------------------------------------------------------------
PURQ_ARCFU      ----------------------------------------------------------------------
PURL_BRASB      ----------------------------------------------------------------------
PURL_BACHD      ----------------------------------------------------------------------
PURL_BACC1      ----------------------------------------------------------------------
PURL_SULAC      ----------------------------------------------------------------------
PURL_RHOPA      ----------------------------------------------------------------------
PURL_NITWN      ----------------------------------------------------------------------
PURL_LACLA      ----------------------------------------------------------------------
PURL_ENTFA      ----------------------------------------------------------------------
PURL_RHOPT      ----------------------------------------------------------------------
PURL_PROM9      ----------------------------------------------------------------------
PURL_ANAD2      ----------------------------------------------------------------------
PURL_HALWD      ----------------------------------------------------------------------
PURL_RHOPS      ----------------------------------------------------------------------
PURL_PETMO      ----------------------------------------------------------------------
PURL_ALKMQ      ----------------------------------------------------------------------
PURL_PROMS      ----------------------------------------------------------------------
PURL_BEII9      ----------------------------------------------------------------------
PURL_BARBK      ----------------------------------------------------------------------
PURL_CHLCH      ----------------------------------------------------------------------
PURL_SILST      ----------------------------------------------------------------------
PURL_SULDN      ----------------------------------------------------------------------
PURL_THEEB      ----------------------------------------------------------------------
PURL_SYMTH      ----------------------------------------------------------------------
PURL_SILPO      ----------------------------------------------------------------------
PURL_RHILO      ----------------------------------------------------------------------
PURL_PARDP      ----------------------------------------------------------------------
PURL_GRABC      ----------------------------------------------------------------------
PURL_LEIXX      ----------------------------------------------------------------------
PURL_CAMLR      ----------------------------------------------------------------------
PURL_SINMW      ----------------------------------------------------------------------
PURL_SYNY3      ----------------------------------------------------------------------
PURL_LEUMM      ----------------------------------------------------------------------
PURL_PROMA      ----------------------------------------------------------------------
PURL_LISW6      ----------------------------------------------------------------------
PURL_JANSC      ----------------------------------------------------------------------
PURL_CAMHC      ----------------------------------------------------------------------
PURL_RHIME      ----------------------------------------------------------------------
PURL_LISMC      ----------------------------------------------------------------------
PURL_LISIN      ----------------------------------------------------------------------
PURL_PROMP      ----------------------------------------------------------------------
PURL_OCHA4      ----------------------------------------------------------------------
PURL_LISMH      ----------------------------------------------------------------------
PURL_RHIEC      ----------------------------------------------------------------------
PURL_METS3      ----------------------------------------------------------------------
PURL_LISMO      ----------------------------------------------------------------------
PURL_RHIL3      ----------------------------------------------------------------------
PURL_NITHX      ----------------------------------------------------------------------
PURL_BRUME      ----------------------------------------------------------------------
PURL_BRUMB      ----------------------------------------------------------------------
PURL_BRUAB      ----------------------------------------------------------------------
PURL_BRUA2      ----------------------------------------------------------------------
PURL_BRUA1      ----------------------------------------------------------------------
PURL_ACICJ      ----------------------------------------------------------------------
PURL_PROM0      ----------------------------------------------------------------------
PURL_LACPL      ----------------------------------------------------------------------
PURL_IGNH4      ----------------------------------------------------------------------
PURL_WOLSU      ----------------------------------------------------------------------
PURL_RHILW      ----------------------------------------------------------------------
PURL_RHIE6      ----------------------------------------------------------------------
PURL_BART1      ----------------------------------------------------------------------
PURL_SYNJB      ----------------------------------------------------------------------
PURL_AGRT5      ----------------------------------------------------------------------
PURL_SULNB      ----------------------------------------------------------------------
PURL_BRUSU      ----------------------------------------------------------------------
PURL_BRUSI      ----------------------------------------------------------------------
PURL_BRUO2      ----------------------------------------------------------------------
PURL_BRUC2      ----------------------------------------------------------------------
PURL_RHOSR      ----------------------------------------------------------------------
PURL_RHIFR      ----------------------------------------------------------------------
PURL_BRAJA      ----------------------------------------------------------------------
PURL_PROM2      ----------------------------------------------------------------------
PURL_AQUAE      ----------------------------------------------------------------------
PURL_RHISN      ----------------------------------------------------------------------
PURQ_DEHE1      ----------------------------------------------------------------------
PURL_PELLD      ----------------------------------------------------------------------
PURL_MOOTA      ----------------------------------------------------------------------
PURL_PROM5      ----------------------------------------------------------------------
PURL_CHLTE      ----------------------------------------------------------------------
PURL_AGRVS      ----------------------------------------------------------------------
PURL_THEMA      ----------------------------------------------------------------------
PURL_NATPD      ----------------------------------------------------------------------
PURL_ANAVT      ----------------------------------------------------------------------
PURL_THET8      ----------------------------------------------------------------------
PURL_THET2      ----------------------------------------------------------------------
PURL_DEIRA      ----------------------------------------------------------------------
PURL_SYNJA      ----------------------------------------------------------------------
PURL_PYRAE      ----------------------------------------------------------------------
PURL_METTH      ----------------------------------------------------------------------
PURL_CAMC1      ----------------------------------------------------------------------
PURQ_METKA      ----------------------------------------------------------------------
PURL_SYNPX      ----------------------------------------------------------------------
PURL_RHOOB      ----------------------------------------------------------------------
PURL_METKA      ----------------------------------------------------------------------
PURL_NOSP7      ----------------------------------------------------------------------
PURL_ANASP      ----------------------------------------------------------------------
PURL_CAMJR      ----------------------------------------------------------------------
PURL_SYNS9      ----------------------------------------------------------------------
PURL_PYRAR      ----------------------------------------------------------------------
PURL_SYNPW      ----------------------------------------------------------------------
PURL_CAMJD      ----------------------------------------------------------------------
PURL_SYNP6      ----------------------------------------------------------------------
PURL_SYNE7      ----------------------------------------------------------------------
PURL_HELHP      ----------------------------------------------------------------------
PURL_CAMJE      ----------------------------------------------------------------------
PURL_AGRRK      ----------------------------------------------------------------------
PURL_PROMM      ----------------------------------------------------------------------
PURL_CAMJJ      ----------------------------------------------------------------------
PURL_CAMC5      ----------------------------------------------------------------------
PURQ_METST      ----------------------------------------------------------------------
PURL_SYNSC      ----------------------------------------------------------------------
PURQ_SYNP6      ----------------------------------------------------------------------
PURQ_SYNE7      ----------------------------------------------------------------------
PURL_HALLT      ----------------------------------------------------------------------
PURL_CAMJ8      ----------------------------------------------------------------------
PURL_PROM3      ----------------------------------------------------------------------
PURQ_PELUB      ----------------------------------------------------------------------
PURL_CYAP4      ----------------------------------------------------------------------
PURQ_THERP      ----------------------------------------------------------------------
PURL_PYRCJ      ----------------------------------------------------------------------
PURQ_SYNY3      ----------------------------------------------------------------------
PURL_THENV      ----------------------------------------------------------------------
PURL_METMA      ----------------------------------------------------------------------
PURQ_SALRD      ----------------------------------------------------------------------
PURL_CAUCR      ----------------------------------------------------------------------
PURL_NITSB      ----------------------------------------------------------------------
PURQ_PYRHO      ----------------------------------------------------------------------
PURQ_CARHZ      ----------------------------------------------------------------------
PURL_PROMT      ----------------------------------------------------------------------
PURQ_CORAM      ----------------------------------------------------------------------
PURQ_LACAC      ----------------------------------------------------------------------
PURQ_CHLP8      ----------------------------------------------------------------------
PURQ_PYRKO      ----------------------------------------------------------------------
PURQ_EXISA      ----------------------------------------------------------------------
PURQ_EXIS2      ----------------------------------------------------------------------
PURL_SULTO      ----------------------------------------------------------------------
PURQ_SULDN      ----------------------------------------------------------------------
PURL_PROM1      ----------------------------------------------------------------------
PURQ_PYRFU      ----------------------------------------------------------------------
PURQ_PYRAB      ----------------------------------------------------------------------
PURQ_MOOTA      ----------------------------------------------------------------------
PURQ_RHIL3      ----------------------------------------------------------------------
PURQ_LACF3      ----------------------------------------------------------------------
PURQ_BREBN      ----------------------------------------------------------------------
PURQ_RHIME      ----------------------------------------------------------------------
PURL_METTP      ----------------------------------------------------------------------
PURQ_CHLTE      ----------------------------------------------------------------------
PURQ_PROMT      ----------------------------------------------------------------------
PURQ_COREF      ----------------------------------------------------------------------
PURQ_SYNJA      ----------------------------------------------------------------------
PURQ_ACAM1      ----------------------------------------------------------------------
PURQ_STAAS      ----------------------------------------------------------------------
PURL_METBF      ----------------------------------------------------------------------
PURL_LEPBL      ----------------------------------------------------------------------
PURL_LEPBJ      ----------------------------------------------------------------------
PURQ_THELT      ----------------------------------------------------------------------
PURQ_SYNS9      ----------------------------------------------------------------------
PURQ_STAAW      ----------------------------------------------------------------------
PURQ_STAAN      ----------------------------------------------------------------------
PURQ_STAAM      ----------------------------------------------------------------------
PURQ_STAAC      ----------------------------------------------------------------------
PURQ_STAA8      ----------------------------------------------------------------------
PURQ_STAA3      ----------------------------------------------------------------------
PURQ_HALSA      ----------------------------------------------------------------------
PURQ_BACWK      ----------------------------------------------------------------------
PURQ_SYNSC      ----------------------------------------------------------------------
PURQ_STAAR      ----------------------------------------------------------------------
PURQ_STAAB      ----------------------------------------------------------------------
PURQ_PROMA      ----------------------------------------------------------------------
PURQ_NATPD      ----------------------------------------------------------------------
PURQ_LACLA      ----------------------------------------------------------------------
PURQ_BACHK      ----------------------------------------------------------------------
PURQ_BACC7      ----------------------------------------------------------------------
PURQ_BACC2      ----------------------------------------------------------------------
PURQ_BACC1      ----------------------------------------------------------------------
PURQ_BACC0      ----------------------------------------------------------------------
PURQ_BACAN      ----------------------------------------------------------------------
PURQ_BACAC      ----------------------------------------------------------------------
PURQ_BACAA      ----------------------------------------------------------------------
PURL_LEPIC      ----------------------------------------------------------------------
PURL_LACSS      ----------------------------------------------------------------------
PURQ_BACCR      ----------------------------------------------------------------------
PURQ_BACC4      ----------------------------------------------------------------------
PURQ_BACAH      ----------------------------------------------------------------------
PURL_LEPIN      ----------------------------------------------------------------------
PURQ_SYNPX      ----------------------------------------------------------------------
PURQ_METAC      ----------------------------------------------------------------------
PURQ_HALWD      ----------------------------------------------------------------------
PURQ_STAS1      ----------------------------------------------------------------------
PURQ_PELLD      ----------------------------------------------------------------------
PURQ_NITWN      ----------------------------------------------------------------------
PURQ_NITHX      ----------------------------------------------------------------------
PURQ_METMA      ----------------------------------------------------------------------
PURQ_BRAJA      ----------------------------------------------------------------------
PURQ_BACC3      ----------------------------------------------------------------------
PURQ_WOLSU      ----------------------------------------------------------------------
PURQ_THEEB      ----------------------------------------------------------------------
PURQ_SYNJB      ----------------------------------------------------------------------
PURQ_RHORT      ----------------------------------------------------------------------
PURQ_BACCZ      ----------------------------------------------------------------------
PURQ_BACCQ      ----------------------------------------------------------------------
PURQ_ANAVT      ----------------------------------------------------------------------
PURQ_RHOSR      ----------------------------------------------------------------------
PURQ_BARQU      ----------------------------------------------------------------------
PURQ_AQUAE      ----------------------------------------------------------------------
PURQ_ANASP      ----------------------------------------------------------------------
PURL_METAC      ----------------------------------------------------------------------
PURQ_RHIEC      ----------------------------------------------------------------------
PURQ_PROMM      ----------------------------------------------------------------------
PURQ_METTH      ----------------------------------------------------------------------
PURQ_LACRJ      ----------------------------------------------------------------------
PURQ_LACRD      ----------------------------------------------------------------------
PURQ_BARHE      ----------------------------------------------------------------------
PURQ_BACCN      ----------------------------------------------------------------------
PURQ_NOCFA      ----------------------------------------------------------------------
PURQ_STRCO      ----------------------------------------------------------------------
PURQ_SILPO      ----------------------------------------------------------------------
PURQ_MYCLE      ----------------------------------------------------------------------
PURQ_LACLC      ----------------------------------------------------------------------
PURQ_JANSC      ----------------------------------------------------------------------
PURQ_DEIGD      ----------------------------------------------------------------------
PURQ_ANOFW      ----------------------------------------------------------------------
PURL_LEPBP      ----------------------------------------------------------------------
PURL_LEPBA      ----------------------------------------------------------------------
PURQ_THETN      ----------------------------------------------------------------------
PURQ_STAES      ----------------------------------------------------------------------
PURQ_STAEQ      ----------------------------------------------------------------------
PURQ_LACPL      ----------------------------------------------------------------------
PURQ_PROAC      ----------------------------------------------------------------------
PURQ_METJA      ----------------------------------------------------------------------
PURQ_OCEIH      ----------------------------------------------------------------------
PURQ_METBF      ----------------------------------------------------------------------
PURQ_PYRAE      ----------------------------------------------------------------------
PURQ_MESSB      ----------------------------------------------------------------------
PURL_PYRIL      ----------------------------------------------------------------------
PURQ_SULSO      ----------------------------------------------------------------------
PURQ_LISIN      ----------------------------------------------------------------------
PURQ_BRUSU      ----------------------------------------------------------------------
PURQ_BRUME      ----------------------------------------------------------------------
PURQ_BRUAB      ----------------------------------------------------------------------
PURQ_BRUA2      ----------------------------------------------------------------------
PURQ_PROM9      ----------------------------------------------------------------------
PURQ_LACCB      ----------------------------------------------------------------------
PURQ_BACHD      ----------------------------------------------------------------------
PURQ_SILST      ----------------------------------------------------------------------
PURQ_LISW6      ----------------------------------------------------------------------
PURQ_GEOSW      ----------------------------------------------------------------------
PURQ_CORGL      ----------------------------------------------------------------------
PURQ_THET8      ----------------------------------------------------------------------
PURQ_THET2      ----------------------------------------------------------------------
PURQ_LISMH      ----------------------------------------------------------------------
PURQ_LACC3      ----------------------------------------------------------------------
PURQ_NOVAD      ----------------------------------------------------------------------
PURQ_LISMO      ----------------------------------------------------------------------
PURQ_LISMF      ----------------------------------------------------------------------
PURQ_LISMC      ----------------------------------------------------------------------
PURQ_LEIXX      ----------------------------------------------------------------------
PURQ_LACDA      ----------------------------------------------------------------------
PURQ_RHOP2      ----------------------------------------------------------------------
PURQ_MYCPA      ----------------------------------------------------------------------
PURQ_HELHP      ----------------------------------------------------------------------
PURL_HALSA      ----------------------------------------------------------------------
PURL_HALS3      ----------------------------------------------------------------------
PURQ_LACSS      ----------------------------------------------------------------------
PURQ_BACP2      ----------------------------------------------------------------------
PURQ_ALKMQ      ----------------------------------------------------------------------
PURQ_SPHAL      ----------------------------------------------------------------------
PURQ_PROMP      ----------------------------------------------------------------------
PURQ_BACSU      ----------------------------------------------------------------------
PURQ_LYSSC      ----------------------------------------------------------------------
PURL_SALRD      ----------------------------------------------------------------------
PURQ_RHILO      ----------------------------------------------------------------------
PURQ_STAHJ      ----------------------------------------------------------------------
PURQ_RHOPB      ----------------------------------------------------------------------
PURQ_MYCTU      ----------------------------------------------------------------------
PURQ_MYCBO      ----------------------------------------------------------------------
PURQ_GLOVI      ----------------------------------------------------------------------
PURQ_METTP      ----------------------------------------------------------------------
PURQ_DEIRA      ----------------------------------------------------------------------
PURQ_BACA2      ----------------------------------------------------------------------
PURQ_GEOTN      ----------------------------------------------------------------------
PURQ_CHLCH      ----------------------------------------------------------------------
PURQ_BACLD      ----------------------------------------------------------------------
PURQ_SYMTH      ----------------------------------------------------------------------
PURQ_ENTFA      ----------------------------------------------------------------------
PURQ_CAUCR      ----------------------------------------------------------------------
PURQ_THEMA      ----------------------------------------------------------------------
PURQ_LEPIN      ----------------------------------------------------------------------
PURQ_LEPIC      ----------------------------------------------------------------------
PURQ_CORJK      ----------------------------------------------------------------------
PURQ_CAMJE      ----------------------------------------------------------------------
PURQ_RHOPA      ----------------------------------------------------------------------
PURQ_GEOKA      ----------------------------------------------------------------------
PURQ_ACIBL      ----------------------------------------------------------------------
PURQ_LACS1      ----------------------------------------------------------------------
PURL_METS5      ----------------------------------------------------------------------
PURQ_ZYMMO      ----------------------------------------------------------------------
PURQ_RUBXD      ----------------------------------------------------------------------
PURQ_ROSDO      ----------------------------------------------------------------------
PURQ_STRAW      ----------------------------------------------------------------------
PURQ_RHOS4      ----------------------------------------------------------------------
PURQ_GLUOX      ----------------------------------------------------------------------
PURQ_ANADE      ----------------------------------------------------------------------
PURQ_BACSK      ----------------------------------------------------------------------
PURL_CALMQ      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           CKDDLYRLFSVTAPKELEFVNVLEKGAQAIKEADRKLGLALSEQEIEYLADEYTKLGRNPTDTELYMFAQ
PUR4_PHOLL      QLEQAEKLFSRQQPVPLKRIDILQAGRSALETANIELGLALASDEIDYLMDAFQKLGRNPTDVELYMFAQ
PUR4_PSEHT      QFEDAAQLFRSDAPRQMSSVDILSGGREALAIANVEQGFALADDEIDYLVENFIKLGRNPNDIELFMFAQ
PUR4_PSEU2      DLEQAANLFSHAQPKPLTAVDILGGGRAALEKANVELGLALAEDEIDYLITSFNGLGRNPHDIELMMFAQ
PUR4_PSE14      DHEQAASLFSHAQPKPLTAVDILGGGRAALEKANVELGLALAEDEIDYLITSFNGLGRNPHDIELMMFAQ
PUR4_PSESM      DHAQAAGLFSHAEPKPLTAVDILGGGRAALEKANVELGLALAEDEIDYLITSFNGLGRNPHDIELMMFAQ
PUR4_PASMU      TPEEAKVLFDQQAPKPFTTVDILSGGRQALENANVELGLALAEDEIDYLVENFTALGRNPNDIELYMFAQ
PUR4_HAHCH      EIAGAELLFAHAEPKPMTTVDILADGRDALAEANRSMGLALAEDEIDYLTSAFTELGRNPTDVELMMFAQ
PUR4_PHOPR      DVDSAAALFTQAEPAPVQSVDILVGGRKALEDANLKLGLALAEDEIDYLVENFTMLGRNPNDIELMMFAQ
PUR4_SHIDS      ALDDAEQLFAHHQPTPVTSVDLLGQGRQALIDANLRLGLALAEDEIDYLQDAFTKLGRNPNDIELYMFAQ
PUR4_ECOLI      ALDDAEQLFAHHQPTPVTSVDLLGQGRQALIDANLRLGLALAEDEIDYLQDAFTKLGRNPNDIELYMFAQ
PUR4_ECO57      ALDDAEQLFAHHQPTPVTSVDLLGQGRQALIDANLRLGLALAEDEIDYLQDAFTKLGRNPNDIELYMFAQ
PUR4_SHISS      ALDDAEQLFAHHQPTPVTSVDLLGQGRQALIDANLRLGLALAEDEIDYLQDAFTKLGRNPNDIELYMFAQ
PUR4_PSEAE      RLEGAAELFSHAQPRPLTAVDVLGGGRAALEKANVELGLALAEDEIDYLLKSFGELGRNPHDVELMMFAQ
PUR4_SHIBS      DLDDAEQLFAHHQPTPVTSVDLLGQGRQALIDANLRLGLALAEDEIDYLQDAFTKLGRNPNDIELYMFAQ
PUR4_PSEF5      NLEQAAGLFSHAEPKPLTAIDILGGGRAALEQANSELGLALAEDEIDYLMNAFQGLKRNPHDIELMMFAQ
PUR4_SHEDO      DMAAAETLFDRTEPKALASVNVLGEGRRALEVANSRLGLALAEDEIDYLVDNFVRLKRNPNDIELMMFAQ
PUR4_ECOL6      ALDDAEQLFAHHQPTPVTSVDLLGQGRQALIDANLRLGLALAEDEIDYLQDAFTKLGRNPNDIELYMFAQ
PUR4_COLP3      DFAQASTLFASSEPGELTAIDIESGGKNALVQANIELGLALAEDEVNYLFENFTKLGRNPHDIELYMFAQ
PUR4_MANSM      APEQAAVLFDSQDPKPFTTVDILNGGRKALEIANVELGLALASDEMDYLVENFTALGRNPNDIELYMFAQ
PUR4_ECOUT      ALDDAEQLFAHHQPTPVTSVDLLGQGRQALIDANLRLGLALAEDEIDYLQDAFTRLGRNPNDIELYMFAQ
PUR4_ECOL5      ALDDAEQLFAHHQPTPVTSVDLLGQGRQALIDANLRLGLALAEDEIDYLQDAFTKLGRNPNDIELYMFAQ
PUR4_SALTY      SLTDAEKLFIHHQPAPVSSVDLLGEGRQALIDANLRLGLALAEDEIDYLQEAFTKLGRNPNDIELYMFAQ
PUR4_HAEI8      HETEAALLFTQQEPKALTTIDILNGGRQALERANIALGLALADDEMDYLVESFTALKRNPQDVELYMFAQ
PUR4_SALPA      SLTDAEKLFIHHQPAPVSSVDLLGEGRQALIDANLRLGLALAEDEIDYLQEAFTKLGRNPNDIELYMFAQ
PUR4_VIBCH      ELTDAQQLFSVAEPAPMSQVDVLAGGRRALEEANVSLGLALAEDEIDYLVESFTKLGRNPNDIELMMFAQ
PUR4_PSEPK      QLEQAADLFSHAQPKPMTSVDILAGGRDALAKANIDLGLALAEDEIDYLVNAFQGLKRNPNDIELMMFAQ
PUR4_HAEIN      HETEAALLFTQQEPKALTTIDILNGGRQALEQANIALGLALADDEMDYLVESFTALKRNPQDVELYMFAQ
PUR4_PSEA6      DLQDASILFKHEAPKPLTSIDVLGGGREELVSANVRLGLALAEDEVDYLVSSFEKLGRNPNDIELYMFAQ
PUR4_SALCH      SLTDAEKLFIHHQPAPVSSVDLLGEGRQALIDANLRLGLALAEDEIDYLQEAFTKLGRNPNDIELYMFAQ
PUR4_SALTI      SLTDAEKLFIHHQPAPVSSVDLLGEGRQALIDANLRLGLALAEDEIDYLQEAFTKLGRNPNDIELYMFAQ
PUR4_YERPN      DLQQAEQLFSHHQPAPVQRVDILGQGRSALEQANIKLGLALAQDEIDYLLTAFTGLGRNPTDIELYMFAQ
PUR4_YERPE      DLQQAEQLFSHHQPAPVQRVDILGQGRSALEQANIKLGLALAQDEIDYLLTAFTGLGRNPTDIELYMFAQ
PUR4_YERPA      DLQQAEQLFSHHQPAPVQRVDILGQGRSALEQANIKLGLALAQDEIDYLLTAFTGLGRNPTDIELYMFAQ
PUR4_YERPS      DLQQAEQLFSHHQPAPVQRVDILGQGRSALEQANIKLGLALAQDEIDYLLTAFTGLGRNPTDIELYMFAQ
PUR4_VIBPA      ELEAASALFTVAEPKPVAHVDILAGGRLALEEANVSLGLALAEDEIDYLVENFTKLGRNPNDIELMMFAQ
PUR4_SHEFN      AFEAAEVLFARTEPAKFSSVNILAEGRRALEVANIKLGLALADDEIDYLIENFVRLKRNPNDIELMMFAQ
PUR4_VIBVU      DLEAAAALFSVAQPAPMTQVDILSGGRLALEEANVSLGLALAEDEIDYLVENFTKLGRNPNDIELMMFAQ
PUR4_PSEPF      NLEQAAGLFSHAEPKPLTAIDILGGGRAALEKANVELGLALAEDEIDYLVNAFNGLKRNPHDIELMMFAQ
PUR4_ERWCT      DLKQAAALFSHHQPAPFKRIEILLQGRQALEEANVRLGLALAEDEIDYLLEAFNNLGRNPTDIELYMFAQ
PUR4_VIBVY      DLEAAAALFSVAQPAPMTQVDILSGGRLALEEANVSLGLALAEDEIDYLVENFTKLGRNPNDIELMMFAQ
PUR4_IDILO      DMNDAQQLFRSQEPQPLSSVDILAGGREALAQANISLGLALADDEIDYLVENFRKLDRNPNDIELYMFAQ
PUR4_VIBF1      DFESASALFAVSEPAPYTEVDLLTGGRKALEDANVTLGLALAEDEIDYLLESFTKLERNPTDIELMMFAQ
PUR4_HAES1      SPQEAAVLFEQHDPKPFTTVDILTGGHVALEKANVTLGLALAKDEIDYLVENFTALGRNPTDVELYMFAQ
PUR4_SHESR      DFAKADVLFKRTEPAPFKSVNVLAEGRRALEVANVEMGLALAEDEIDYLVENFVRLNRNPNDIELMMFAQ
PUR4_SHESM      DFAKADVLFKRTEPAPFKSVNVLAEGRRALEVANVEMGLALAEDEIDYLVENFVRLNRNPNDIELMMFAQ
PUR4_SHEON      DFAKADVLFKRTEPAPFKSVNVLAEGRRALEVANVEMGLALAEDEIDYLVENFVRLNRNPNDIELMMFAQ
PUR4_METFK      SLTDAQKLYHTAEPAPLSTVDILSGGKAALEAANAEMGLALSPDEVDYLIENFQRMGRNPTDVELMMFAQ
PUR4_SODGM      RLEEXXXXXXXXXXXPVTLVDVXXXXXXXXXXXXXXXXXXXXQDEIDYLFAAFTRLGRNPSDVELYMFAQ
PUR4_MYXXD      RLEDAAILFAGHTPRPFTTVDVLGGGRAALVTANRELGLALADDEMDYLVARFTELKRNPTDVELMMFAQ
PUR4_RALSO      TREAGYGLFDVLPAKALRFVDLXXXXXXXXXXXNTEMGLALSDDEIDYLVDAYRKLGRNPTDVELMMFAQ
PUR4_NEIMB      DFQTASKLFHHLESETFSGVDVLGGGKEALVKANTEMGLALSADEIDYLVENYQALQRNPSDVELMMFAQ
PUR4_NEIG1      DFQTASKLFHHLKSETFSTVDVLGGGKEALVKANTETGLALSADEIDYLVENYQALQRNPSDVELMMFAQ
PUR4_NEIMA      DFQTASKLFHHLESETFSTVDVLGGGKEALVKANTEMGLALSADEIDYLVENYQALQRNPSDVELMMFAQ
PUR4_SCHPO      KLPEEDEVFDKHEPAPLVRIELKQAATERLNHANKKFGLALAPDEIDYLVECYTSKSREPTDVELFMFGQ
PUR4_YEAST      TEPNTMSIFTHEEPKPLVHVPLTPKDTKQLSKANTELGLALDSGEMEYLIHAFVEMKRDPTDVELFMFAQ
PUR4_XYLFT      SEDEVKTLFNVPEPRPLERIALID-----LEHANTRLGLALTADEIDYLRTRYTELNRVPSDVELMMFAQ
PUR4_XYLFA      SEDEVKTLFNVPEPLSLERIALID-----LEHANTRWGLALTADEIDYLRTRYTELNRVPSDVELMMFAQ
PUR4_XANAC      SXXXXXXLFNVPDPGQLRRVPL-----DGLEQANRDLGLALAQDEIDYLRERFGALGRDPADVELMMFAQ
PUR4_XANCP      SXXXXXXLFNVPDPGQLERIPL-----DALEQANGDLGLALAQDEIDYLRERFAALGRDPADVELMMFAQ
PUR4_ARATH      QK--LVSFETNVVPEEVKYVPVMEKGRKALEEINQEMGLAFDEQDLQYYTRLFREIKRDPTNVELFDIAQ
PUR4_DICDI      TPIKSFDTGII--PKAVVYIPVVEEGRAALERVNKEMGLAFDEQDLALYTDLFNQLKRNPSDVECFDIGQ
PUR4_DROME      EENTPKASFDEQLPERQHFVPVLEEGRAALERINQELGLAFNDYDLDYYHDLFAKLGRNPTTVELFDCAQ
PUR4_HUMAN      HPIQSFSPESMPEPLNGP-INILGEGRLALEKANQELGLALDSWDLDFYTKRFQELQRNPSTVEAFDLAQ
PUR4_MOUSE      DPIQSFSPQSIPAPLKGS-IDILAEGRPALEKANQELGLALDSWDLDFYTKRFQELQRNPSTVEVFDLAQ
PUR4_CAEEL      FDDESHQI------EKVFLIDVLESKQNLIKANEELGXXXXXXXXXXXXXXXVNKVKKNPTDVELFDLAQ
PURL_ARCFU      ----MYR--KVDVPFELYEVEILDASEEELAKISEEMGLALSVDEMKRIQDYFRQKGRNPYDIELQSLAQ
PURL_PICTO      --------------------------------------LALSHDEMLLIKKYFTEIKRNPSDVELQAIAQ
PURL_THEAC      ----------------------------------KRLGLALSLDEMKAVRSYFERLGRDPIDAEIHAVAQ
PURL_THEVO      ----------------------------------KRHGLSLSLDEMKAVRDYFIKEGRDPIDAEIHAIAQ
PURL_MYCA9      --------------------------------------------------DEYARLGRRPTDAELAMYSV
PURL_NOCFA      -------------------------------------------KELGLKDDEYARLGRRPTDAELAMYSV
PURL_LACS1      ---------------------------EQIKEQKVYLEWGLTQKEYEYICDKL--LGRLPNYTETGLFSV
PURL_ZYMMO      -------------------------------------------------------LGRTPNLVELGIFSA
PURL_THETN      -------------------------------------------RELGLTDEEYEKLGREPNITELGMYSV
PURL_CORGL      --------------------------------------------------DEYARLGRRPTDAELTVYSV
PURL_CORGB      --------------------------------------------------DEYARLGRRPTDAELTVYSV
PURL_THEPX      -------------------------------------------RELGLTDEEYEKLGREPNITEIGMYSV
PURL_RHOE4      -------------------------------------------KELGLKDDEYARLGRRPTDAELAMYSV
PURL_CARHZ      --------------------------------------MGLTDEEYRRIV-EY--LGREPNEVELGMCAV
PURL_THEP3      -------------------------------------------RELGLTDEEYEKLGREPNITEIGMYSV
PURL_RHORT      ---------------------------------------------------EYAKMGREPNLVELGIFSV
PURL_MYCPA      --------------------------------------------------DEYQRLGRRPTDTELAMYSV
PURL_MYCA1      --------------------------------------------------DEYQRLGRRPTDTELAMYSV
PURL_CORJK      --------------------------------ADAKANPDLEQHELGLKDDEYARLGRRPTDAELAMYSV
PURL_OCEIH      -------------------------------EKDRLLDMGLSDEEFQRIKQI---LGRHPNFTETGIFSV
PURL_MYCVP      -------------------VDTVERAAATPDHPQPYRELGLKDDEYERIREI---LGRRPTDAELAMYSV
PURL_NOCSJ      -------------------------------------------------ADEYARLGRRPTSSELAMYSV
PURL_STAS1      ----------------------IEPSSEDIKIEQLYKDMGLSDEEYAKVCDI---LGREPNFTEIGIFSV
PURL_MYCGI      -------------------VDTVERAAATPGQPQPYRELGLKDDEYERIREI---LGRRPTDAELAMYSV
PURL_LACH4      ---------------------------EEIKEKKPYLDWSLTEHEYDYICDKLLK--RLPNYTEIGLFSA
PURL_CORAM      -------------------------------------------EELGLKQDEYDKLGRRPTDAELTVYSV
PURL_THESM      ------------------------------------------------------RLGREPNEVEKAMLEV
PURL_PELUB      ----------------------------------------------------------------------
PURL_NOVAD      ----------------------------------------LSEEEYQRVLHA---LGREPNLVELGIFSV
PURL_LACF3      ---------------------------EQIKEQKPYLDWSLSEREYDYISEKL--LGRLPNFTETGLFSA
PURQ_METM5      ----------------------------------------------------------------------
PURL_PYRAB      ------------------------------------------------------RLGREPNEVEKAMLEV
PURQ_METMP      ----------------------------------------------------------------------
PURL_STACT      ----------------------IEPSIEEIKAEKLYSDMGLTDAEYDKVVDI---LGREPNFTEVGIFSV
PURL_BACLD      ---------------------LLEPSQEQIKEEKLYQQMGVSDDEFAMIE---SILGRLPNYTEIGIFSV
PURL_PARL1      --------------------------------------------------DEYQRIGREPTLTELGIFSA
PURL_MYCTU      --------------------------------------------------DEYRRLGRRPTDTELAMYSV
PURL_MYCTA      --------------------------------------------------DEYRRLGRRPTDTELAMYSV
PURL_MYCBT      --------------------------------------------------DEYRRLGRRPTDTELAMYSV
PURL_MYCBP      --------------------------------------------------DEYRRLGRRPTDTELAMYSV
PURL_MYCBO      --------------------------------------------------DEYRRLGRRPTDTELAMYSV
PURL_RENSM      -------------------------------------------------------LGRRPTAAELAMYSV
PURL_STRCO      --------------------------------------------ELGLKKDEYERLGRRPTGAELAMYSV
PURL_CORA7      -----------------------------VEQAAAQPELEQPYRELGLKDDEYAHLGRRPTDAELTMYSV
PURL_THEGJ      ------------------------------------------------------RLGREPNELEWAMLEV
PURL_EXISA      --------------------------------------------------DEYSLLGREPNYTEIGLFSV
PURL_STRAW      --------------------------------------------ELGLKKDEYERLGRRPTGAELAMYSV
PURL_ROSDO      --------------------------------------------------DEYDRIGRTPTFTELGIFSA
VP75_SHV21      ----------------------------------------------------------------------
PURQ_METM7      ----------------------------------------------------------------------
PURL_STAAN      ----------------------IEPSVEEIKLEKVYQDMGLSDQEYEKVCDI---LGRQPNFTETGIFSV
PURL_STAAM      ----------------------IEPSVEEIKLEKVYQDMGLSDQEYEKVCDI---LGRQPNFTETGIFSV
PURL_STAA9      ----------------------IEPSVEEIKLEKVYQDMGLSDQEYEKVCDI---LGRQPNFTETGIFSV
PURL_STAA2      ----------------------IEPSVEEIKLEKVYQDMGLSDQEYEKVCDI---LGRQPNFTETGIFSV
PURL_STAA1      ----------------------IEPSVEEIKLEKVYQDMGLSDQEYEKVCDI---LGRQPNFTETGIFSV
PURL_METJA      ----------------------------------------MDENDLKYIEKV---LGRKPNHIELAMFEN
PURL_LACLM      ----------------------LEMSPEQIQESKIYREWGLTDEEYLKIKDEILG-GRLPNFTETGMYAV
PURL_LACLC      ----------------------LEMSPEQIQESKIYREWGLTDEEYLKIKDEILG-GRLPNFTETGMYAV
PURL_GLUOX      -------------------------------------------QSFGLTGEEYDKLGRTPSFTELGIFSV
PURL_ANASK      --------------------------------------------------DEYQRLGRTPTLTELGVFSV
PURL_ANADF      -------------------------------------------------------LGREPNLTELGVFSV
PURL_COREF      --------------------------------------------------DEYARLGRRPTDAELTVYSV
PURL_STAAW      ----------------------IEPSVEEIKLEKVYQDMGLSDQEYEKVCDI---LGRQPNFTETGIFSV
PURL_STAAT      ----------------------IEPSVEEIKLEKVYQDMGLSDQEYEKVCDI---LGRQPNFTETGIFSV
PURL_STAAS      ----------------------IEPSVEEIKLEKVYQDMGLSDQEYEKVCDI---LGRQPNFTETGIFSV
PURL_STAAE      ----------------------IEPSVEEIKLEKVYQDMGLSDQEYEKVCDI---LGRQPNFTETGIFSV
PURL_STAAC      ----------------------IEPSVEEIKLEKVYQDMGLSDQEYEKVCDI---LGRQPNFTETGIFSV
PURL_STAA8      ----------------------IEPSVEEIKLEKVYQDMGLSDQEYEKVCDI---LGRQPNFTETGIFSV
PURL_STAA3      ----------------------IEPSVEEIKLEKVYQDMGLSDQEYEKVCDI---LGRQPNFTETGIFSV
PURL_PYRKO      ------------------------------------------------------RLGREPNEVEKAMLEV
PURL_GEOSW      ---------------------LLEPTPTMIKEEKLYREMGLTDEEFAMIEKI---LGRLPNYTETGIFSV
PURL_STAAR      ----------------------IEPSVEEIKLEKVYQDMGLSDQEYEKVCDI---LGRQPNFTETGIFSV
PURL_LACLS      ----------------------LEMLPEQIQESKIYREWGLTDEEYLKIKDEILG-GRLPNFTETGMYAV
PURQ_THEAC      ----------------------------------------------------------------------
PURL_METST      --------------------------------------MVLTDDELKYIEEV---LGRKPNELELGMMDV
PURL_FRASC      -------------------------------------------QELGLTDDEYARLGRRPSDAELAMYSV
PURL_ERYLH      -------------------------------------------------------LGREPNLVELGIFSV
PURL_MYCLE      --------------------------------------------ELGLREDEYQRLGRRPTDTELAMYSV
PURL_MYCLB      --------------------------------------------ELGLREDEYQRLGRRPTDTELAMYSV
PURL_BACSU      ---------------------LLEPSKEQIKEEKLYQQMGVSDDEFALIE---SILGRLPNYTEIGIFSV
PURL_TROWT      ---------------------------------------------------EYTQLKRSPTKSELAIYSV
PURL_TROW8      ---------------------------------------------------EYTQLKRSPTKSELAIYSV
PURL_THELT      ----------------------------------------LSHRDLGLTDKEYEKLHREPNEVELGMFSV
PURL_MACCJ      -------------------VKFLEPTANEIKENKLYQDMGLSDKEYDKVVDI---LGRMPNYTEIGIFSV
PURL_LACAC      ---------------------------EEIKEKKPYLDWSLSEHEYDYICDHL--LHRLPNYTEIGLFSA
PURL_STAAB      ----------------------IEPSVEEIKLEKVYQDMGLSDQEYEKVCDI---LGRQPNFTETGIFSV
PURL_BACC2      ---------------------MLEPNPTQIKEERIYAEMGLTDEEFAMVE---RILGRLPNYTETGLFSV
PURL_MESSB      --------------------------------------------------DEYQRIGREPTFTELGIFSA
PURL_BACSK      ---------------------LLEPSAETIKAERLYREMGLTDDEFA-LAEKI--VGRPLNFTETGLFSV
PURL_BACCR      ---------------------MLEPNPTQIKEERIYAEMGLTDEEFAMVEKI---LGRLPNYTETGLFSV
PURL_LACC3      ----------------------VEMSPEAIATQKPYLDLGLTEAEYDRFAE---LIGHQPNDTEIGLASG
PURL_CALMQ      -------------------------------------------------------LGRNPTEAEWLIFEA
PURL_BACC4      ---------------------MLEPNPTQIKEERIYAEMGLTDEEFAMVEKI---LGRLPNYTETGLFSV
PURL_AZOC5      --------------------------------------------------DEYQRIGREPTITELGIVSA
PURQ_PICTO      ----------------------------------------------------------------------
PURL_STAES      -----------------------------IEPSNEEIKLEKLYQDMGLSDKEYDKLGREPNFTEVGIFSV
PURL_STAEQ      -----------------------------IEPSNEEIKLEKLYQDMGLSDKEYDKLGREPNFTEVGIFSV
PURL_LACRJ      ---------------------------EEIKEKKPYLDWSLTEAEYDYIRTQL--LGRLPNYTETGLFSA
PURL_LACRD      ---------------------------EEIKEKKPYLDWSLTEAEYDYIRTQL--LGRLPNYTETGLFSA
PURL_PYRFU      ------------------------------------------------------KLGREPNDLEKAMLEV
PURL_BACA2      ---------------------LLEPSKEQIKEEKLYQQMGVSDDEFALIE---SIIGRLPNYTEIGIFSV
MTP_EBVG        ----------------------------------------------------------------------
PURL_GEOTN      ---------------------LLEPNAAMIKEQKLYREMGLTDEEFARIE---AILGRLPNYTETGIFSV
PURL_PYRHO      ------------------------------------------------------RLGREPNDVERAMLEV
PURL_BACWK      ---------------------MLEPNPTQIKEERIYAEMGLTDEEFAMVEKI---LGRLPNYTETGLFSV
PURQ_THEVO      ----------------------------------------------------------------------
PURL_RHOS5      --------------------------------------------------DEYERIGREPSFTELGIFSA
PURL_BACCN      ---------------------MLEPNPTQIKEERIYAEMGLTDEEFAMIEKI---LGRLPNYTETGLFSV
MTP_EBVA8       ----------------------------------------------------------------------
PURL_BARHE      --------------------------------------------------DEYTLIGREPTFTELGIFSA
PURL_GLOVI      ----------------------------------------LSPQEYRRITE---LIGRHPNLNELGMFSV
PURL_FRASN      -------------------------------------------RELGLTDDEYERLGRVPTDAELAMYSV
PURL_STAHJ      ---------------------------------------------------EYNKLGREPNFTEVGIFSV
PURL_RHOP5      --------------------------------------------------DEYERIGREPSLTELGIFSA
PURL_ANADE      --------------------------------------------------DEYQRLGRVPTLTELGVFSV
MTP_EBVB9       ----------------------------------------------------------------------
VP03_SHV21      ----------------------------------------------------------------------
PURL_LISMF      ----------------------MEPTTKEIKEQKIYQEMGLTDSEYELVC---SILGREPNYTETGLFSV
PURL_HALMA      --------------------------------------MSLSDADHELVVEE---IGREPTRAEAALFEN
PURL_RHOP2      --------------------------------------------------DEYQRIGREPTFTELGIFSA
PURL_LACCA      ------------------YVVHVEMSPEAIATQKPYLDLGLTEAEYDRFAE---LIGHQPNDTEIGLASG
PURL_BARQU      -------------------------------------------------SDEYTLIGREPTFTELGIFSA
PURL_BACP2      ---------------------LLEPSHKQIKEEKLYQQMGLSDEEFALIE---SIIGRLPNYTETGIFSV
PURL_RHOPB      --------------------------------------------------DEYQRIGREPSLTELGIFSA
PURL_GEOKA      ---------------------LLEPSAAMIKEQKLYREMGLTDEEFARIE---AILGRLPNYTETGIFAV
PURL_BRASO      --------------------------------------------------DEYERIGREPTFTELGIFSA
PURL_SULIY      ----------------------------------------------------------------------
PURL_SULIN      ----------------------------------------------------------------------
PURL_SULIL      ----------------------------------------------------------------------
PURL_SULIA      ----------------------------------------------------------------------
PURL_RHOSK      --------------------------------------------------DEYQRIGRAPTFTELGIFSA
PURL_SULSO      ----------------------------------------------------------------------
PURL_SULIM      ----------------------------------------------------------------------
PURL_SULIK      ----------------------------------------------------------------------
PURL_METSB      --------------------------------------------------DEYQRIGRVPTFTELGIFSA
PURQ_TREDE      ----------------------------------------------------------------------
PURL_RHOS4      --------------------------------------------------DEYQRIGRAPTFTELGIFSA
PURL_META3      ------------------------------------------------------QLGRKPNDVEIGMFEN
PURL_BACC3      ---------------------MLEPNPTQIKEERIYAEMGLTDEEFAMVEKI---LGRLPNYTETGLFSV
PURL_BACC0      ---------------------MLEPNPTQIKEERIYAEMGLTDEEFAMVEKI---LGRLPNYTETGLFSV
PURL_BACAN      ---------------------MLEPNPTQIKEERIYAEMGLTDEEFAMVEKI---LGRLPNYTETGLFSV
PURL_BACAH      ---------------------MLEPNPTQIKEERIYAEMGLTDEEFAMVEKI---LGRLPNYTETGLFSV
PURL_BACAC      ---------------------MLEPNPTQIKEERIYAEMGLTDEEFAMVEKI---LGRLPNYTETGLFSV
PURL_BACAA      ---------------------MLEPNPTQIKEERIYAEMGLTDEEFAMVEKI---LGRLPNYTETGLFSV
PURL_PROAC      --------------------------------------------ELGLSADEYQRLGRRPTGGELAMYSV
PURL_ANOFW      ---------------------LLEPSPTMIKEQKMYRDMGLTDEEFAMIE---RILGRLPNYTETGIFSV
PURL_THERP      -------------------------------------------REVALTEEEYARLGREPNLIELGMIGA
PURL_THEFY      --------------------------------------------------EEYARLGRRPTSAELAIYSV
PURL_BACCZ      ---------------------MLEPNPTQIKEERIYAEMGLTDEEFAMVEKI---LGRLPNYTETGLFSV
PURL_ACAM1      --------------------------------------------------DIVQRLGRHPNRAELGMFGV
PURL_LACDB      -----------------------EMTPEEIKEKKPYLDWSLSEEEYDYICDKL--LHRLPNYTETGLFAA
PURL_LACDA      -----------------------EMTPEEIKEKKPYLDWSLSEEEYDYICDKL--LHRLPNYTETGLFAA
PURL_BACCQ      ---------------------MLEPNPTQIKEERIYAEMGLTDEEFAMVEKI---LGRLPNYTETGLFSV
PURL_BACHK      ---------------------MLEPNPTQIKEERIYAEMGLTDEEFAMVEKI---LGRLPNYTETGLFSV
PURL_BACC7      ---------------------MLEPNPTQIKEERIYAEMGLTDEEFAMVEKI---LGRLPNYTETGLFSV
PURQ_ARCFU      ----------------------------------------------------------------------
PURL_BRASB      --------------------------------------------------DEYERIGRVPTFTELGIFSA
PURL_BACHD      -----------------------EPTATEVKEQKIYREMGLTDEEFALVE---SILGRLPNYTETGLFSV
PURL_BACC1      ---------------------MLEPNPTQIKEERIYAEMGLTDEEFAMVEKI---LGRLPNYTETGLFSV
PURL_SULAC      --------------------------------------LSLSSQEMELVRKF---LGREPKEEEWLVVDA
PURL_RHOPA      --------------------------------------------------DEYQRIGREPTFTELGIFSA
PURL_NITWN      --------------------------------------------------DEYERLGRTPTFTELGIFSA
PURL_LACLA      ----------------------LEMSPEQIQESKIYREWGLTDEEYLKIKDEILD-GRLPNFTETGMYAV
PURL_ENTFA      -----------------------EPTPKEIKETRLYAEWGLTDEEYHQIE---TILQREPNYTETGLFSV
PURL_RHOPT      --------------------------------------------------DEYQRIGREPTFTELGIFSA
PURL_PROM9      ------------------------------------------------------RLKRKPNRTELGMFGV
PURL_ANAD2      -------------------------------------------------------LGRTPTLTELGVFSV
PURL_HALWD      --------------------------------------MTLSDSDLELIT---TELGRELTPAEAALFEN
PURL_RHOPS      --------------------------------------------------DEYQRIGREPSFTELGIFSA
PURL_PETMO      -----------------------------IKEIALELGI--SREEFDLIEE---KLGRIPNEFETYLFSA
PURL_ALKMQ      -------------------------------------------------------LGREPNELELNLYGV
PURL_PROMS      ------------------------------------------------------RLKRKPNRTELGMFGV
PURL_BEII9      --------------------------------------------------DEYTLIGREPSFTELGIFSA
PURL_BARBK      --------------------------------------------------DEYQRIGREPTFTELGIFSA
PURL_CHLCH      -----------------------------MKHTDIEVTLTHAEEHAEEFSQICTILGRTPTITELGIFSV
PURL_SILST      -------------------------------------------------------IGREPTFTELGIFSA
PURL_SULDN      -------------------------------------------------------LGREPNLVEIGIFSA
PURL_THEEB      ---------------------------------------------------EYTRLGRHPNRAELGMFGV
PURL_SYMTH      -------------------------------------------------------LGREPNPTELHMFGV
PURL_SILPO      -------------------------------------------------------IGREPTFTELGIFSA
PURL_RHILO      --------------------------------------------------DEYQRIGREPSFTELGIFSA
PURL_PARDP      --------------------------------------------------DEYQRIGREPSFTELGIFSA
PURL_GRABC      ----------------------------------RDVTLSLA-QEFGLDAAEYQRMGRTPSFTELGIFSV
PURL_LEIXX      --------------------------------------------------DEYASLGRRPTNGELAMYSV
PURL_CAMLR      -------------------------------------------------------LGREPNLLELGVISA
PURL_SINMW      --------------------------------------------------DEYERIGREPTFTELGIFSA
PURL_SYNY3      ----------------------------------------------EEYEDIVQRLGRHPNKAELGMFGV
PURL_LEUMM      -----------------------ELSPEEVRDSKIYIEWGLTEQEYDLIVKELKRL---PNFTETGIFSG
PURL_PROMA      ------------------------------------------------------RLKRSPNRTELGMFGV
PURL_LISW6      ----------------------MEPTTKEIKEQKIYQEMGLTDSEYELVC---SILGREPNYTETGLFSV
PURL_JANSC      --------------------------------------------------DEYAELGRAPNYTEMGIFSA
PURL_CAMHC      ---------------------------------------------------EYKKLGREPNLLELGIFSS
PURL_RHIME      --------------------------------------------------DEYERIGREPTFTELGIFSA
PURL_LISMC      ----------------------MEPTTKEIKEQKIYQEMGLTDSEYELVC---SILGREPNYTETGLFSV
PURL_LISIN      ----------------------MEPTTKEIKEQKIYQEMGLTDSEYELVC---SILGREPNYTETGLFSV
PURL_PROMP      ------------------------------------------------------RLGRKPNRTELGMFGV
PURL_OCHA4      --------------------------------------------------DEYQRIGREPTFTELGIFSA
PURL_LISMH      ----------------------MEPTTKEIKEQKIYQEMGLTDSEYELVC---SILGREPNYTETGLFSV
PURL_RHIEC      --------------------------------------------------DEYQRIGREPTFTELGIFSA
PURL_METS3      --------------------------------------MTLTDSEMEYIEGI---LGRKMNELEEGMLDV
PURL_LISMO      ----------------------MEPTTKEIKEQKIYQEMGLTDSEYELVC---SILGREPNYTETGLFSV
PURL_RHIL3      --------------------------------------------------DEYQRIGREPTFTELGIFSA
PURL_NITHX      --------------------------------------------------DEYERIGRVPTFTELGIFSA
PURL_BRUME      --------------------------------------------------DEYQRIGREPTFTELGIFSA
PURL_BRUMB      --------------------------------------------------DEYQRIGREPTFTELGIFSA
PURL_BRUAB      --------------------------------------------------DEYQRIGREPTFTELGIFSA
PURL_BRUA2      --------------------------------------------------DEYQRIGREPTFTELGIFSA
PURL_BRUA1      --------------------------------------------------DEYQRIGREPTFTELGIFSA
PURL_ACICJ      -------------------------------------------------AEEYDRMGRVPTLTELGIFSV
PURL_PROM0      ------------------------------------------------------RLKKKPNRTELGMFGV
PURL_LACPL      ----------------------------------------------------------------------
PURL_IGNH4      --------------------------------------------------------GRKPNQVELAMFEA
PURL_WOLSU      ----------------------------------------LSQADYEHIVQI---LGREPNLVELGVFSA
PURL_RHILW      --------------------------------------------------DEYQRIGREPTFTELGIFSA
PURL_RHIE6      --------------------------------------------------DEYQRIGREPTFTELGIFSA
PURL_BART1      --------------------------------------------------DEYTLIGREPTFTELGIFSA
PURL_SYNJB      ------------------------------------------------------QLGRDPNPNELAMFGV
PURL_AGRT5      --------------------------------------------------DEYQRIGREPSFTELGIFSA
PURL_SULNB      --------------------------------------------------------GRHPNIVEIGIFSA
PURL_BRUSU      --------------------------------------------------DEYQRIGREPTFTELGIFSA
PURL_BRUSI      --------------------------------------------------DEYQRIGREPTFTELGIFSA
PURL_BRUO2      --------------------------------------------------DEYQRIGREPTFTELGIFSA
PURL_BRUC2      --------------------------------------------------DEYQRIGREPTFTELGIFSA
PURL_RHOSR      -------------------------------------------KELGLKDDEYARLGRRPTEAELAMYSV
PURL_RHIFR      --------------------------------------------------DEYERIRREPTFTELGIFSA
PURL_BRAJA      --------------------------------------------------DEYERIGREPTFTELGIFSA
PURL_PROM2      ------------------------------------------------------RLKRKPNRTELGMFGV
PURL_AQUAE      --------------------------------------------------EEYRKLKREPNHVELGVLGA
PURL_RHISN      --------------------------------------------------DEYERIGREPTFTELGIFSA
PURQ_DEHE1      ----------------------------------------------------------------------
PURL_PELLD      -----------------------------MKTIEPEVNLALAAEH-GLNAEEYQKLGRTPTFTELGIFSV
PURL_MOOTA      -------------------------------------------------------LGREPNYVELGMFAV
PURL_PROM5      ------------------------------------------------------RLGRKPNRTELGMFGV
PURL_CHLTE      --------------------------------------------------EEYAKLGRTPSFTELGIYSV
PURL_AGRVS      -------------------------------------------------------IGREPTFTELGIFSA
PURL_THEMA      --------------------------------------------KLRYLNILKEKLGREPTFVELQAFSV
PURL_NATPD      --------------------------------------MSLSPSDRELVTEE---LGREPTPAEEALFEN
PURL_ANAVT      ----------------------------------------------EEYAEIVRRLGRHPNKAELGMFGV
PURL_THET8      ------------------------------------------------------RLGREPNRVELLLFKV
PURL_THET2      ------------------------------------------------------RLGREPNRVELLLFKV
PURL_DEIRA      --------------------------SQSLRDQAATFGLTTEEYDLFV-----SQLGREPNALEAAIVGA
PURL_SYNJA      ------------------------------------------------------QLGRDPNPTELAMFGV
PURL_PYRAE      --------------------------------------MALSPGELELIR---SALGREPTEVEYALFRS
PURL_METTH      --------------------------------------MVLTDSEMEFIRKE---LGRDPNPLEYGMLDV
PURL_CAMC1      -------------------------------------------------------LGREPNLLELGIFSA
PURQ_METKA      ----------------------------------------------------------------------
PURL_SYNPX      ------------------------------------------------------RLGREPNRAELGMFGV
PURL_RHOOB      -------------------------------------------KELGLKDDEYARLGRRPTEAELAMYSV
PURL_METKA      -----------------------------------------------------------PNATERAMFEN
PURL_NOSP7      ----------------------------------------------EEYAEIVRRLGRHPNKAELGMFGV
PURL_ANASP      ----------------------------------------------EEYAEIVRRLGRHPNKAELGMFGV
PURL_CAMJR      --------------------------------------------------EEYTQLGREPNLLELGVISA
PURL_SYNS9      ------------------------------------------------------RLGREPNRAELGMFGV
PURL_PYRAR      --------------------------------------MALSREELEVIE---RGLGRPPSEVELALFRS
PURL_SYNPW      ------------------------------------------------------RLGRDPNRAELGMFGV
PURL_CAMJD      --------------------------------------------------EEYTQLGREPNLLELGVISA
PURL_SYNP6      --------------------------------ADEIAGEGIKPEEYDAIVE---RLGRHPNKAELGMFGV
PURL_SYNE7      --------------------------------ADEIAGEGIKPEEYDAIVE---RLGRHPNKAELGMFGV
PURL_HELHP      -----------------------------IKDIDETLKVKLSKQDYEEILKI---LKRPPNLIELGIFAA
PURL_CAMJE      -------------------------------------------------------LGREPNLLELGVISA
PURL_AGRRK      --------------------------------------------------DEYQRIGREPSFTELGIFSA
PURL_PROMM      ------------------------------------------------------RLQRAPNRVELGMFGV
PURL_CAMJJ      -------------------------------------------------------LGREPNLLELGVISA
PURL_CAMC5      ----------------------------------------INEQEYEEILKI---LGREPNLLELGIFSA
PURQ_METST      ----------------------------------------------------------------------
PURL_SYNSC      ------------------------------------------------------RLGREPNRAELGMFGV
PURQ_SYNP6      ----------------------------------------------------------------------
PURQ_SYNE7      ----------------------------------------------------------------------
PURL_HALLT      --------------------------------------MSLSEPDHELVVAE---LGREPTAAEVALFEN
PURL_CAMJ8      -------------------------------------------------------LGREPNLLELGVISA
PURL_PROM3      ------------------------------------------------------RLQRAPNRVELGMFGV
PURQ_PELUB      ----------------------------------------------------------------------
PURL_CYAP4      ----------------------------------------------EEYAEIVQRLGRHPNLAELGMFGV
PURQ_THERP      ----------------------------------------------------------------------
PURL_PYRCJ      --------------------------------------MALTAAELEAIR---RGLGRGPTPVELALFTA
PURQ_SYNY3      ----------------------------------------------------------------------
PURL_THENV      --------------------------------------MALTRQELELIR---RGLGREPTAAELAFFTS
PURL_METMA      ----------------------------------------LPEEDLKIIKKE---LGREPTLVEQGCFLN
PURQ_SALRD      ----------------------------------------------------------------------
PURL_CAUCR      --------------------------AKPMAEMAAEFGLKPAEYDVVL-----KRLGREPNLVELGVFSV
PURL_NITSB      -------------------------------------------------------LGREPNLVEIGIFSA
PURQ_PYRHO      ----------------------------------------------------------------------
PURQ_CARHZ      ----------------------------------------------------------------------
PURL_PROMT      ------------------------------------------------------RLNRAPNRNELGMFGV
PURQ_CORAM      ----------------------------------------------------------------------
PURQ_LACAC      ----------------------------------------------------------------------
PURQ_CHLP8      ----------------------------------------------------------------------
PURQ_PYRKO      ----------------------------------------------------------------------
PURQ_EXISA      ----------------------------------------------------------------------
PURQ_EXIS2      ----------------------------------------------------------------------
PURL_SULTO      --------------------------------------ITLSSYEMELVRK---KLAREPNEAEWLTIDA
PURQ_SULDN      ----------------------------------------------------------------------
PURL_PROM1      ------------------------------------------------------RLNRGPNRNELGMFGV
PURQ_PYRFU      ----------------------------------------------------------------------
PURQ_PYRAB      ----------------------------------------------------------------------
PURQ_MOOTA      ----------------------------------------------------------------------
PURQ_RHIL3      ----------------------------------------------------------------------
PURQ_LACF3      ----------------------------------------------------------------------
PURQ_BREBN      ----------------------------------------------------------------------
PURQ_RHIME      ----------------------------------------------------------------------
PURL_METTP      ----------------------------------RKAGIGMSASEARSIA---SILGRDPTLAELFCYDA
PURQ_CHLTE      ----------------------------------------------------------------------
PURQ_PROMT      ----------------------------------------------------------------------
PURQ_COREF      ----------------------------------------------------------------------
PURQ_SYNJA      ----------------------------------------------------------------------
PURQ_ACAM1      ----------------------------------------------------------------------
PURQ_STAAS      ----------------------------------------------------------------------
PURL_METBF      ----------------------------------------LPEEDLKIIKKE---LGREPTLVEQGCFLN
PURL_LEPBL      -------------------------------------------------AEEFQKLGRIPNSTELGIFSA
PURL_LEPBJ      -------------------------------------------------AEEFQKLGRIPNSTELGIFSA
PURQ_THELT      ----------------------------------------------------------------------
PURQ_SYNS9      ----------------------------------------------------------------------
PURQ_STAAW      ----------------------------------------------------------------------
PURQ_STAAN      ----------------------------------------------------------------------
PURQ_STAAM      ----------------------------------------------------------------------
PURQ_STAAC      ----------------------------------------------------------------------
PURQ_STAA8      ----------------------------------------------------------------------
PURQ_STAA3      ----------------------------------------------------------------------
PURQ_HALSA      ----------------------------------------------------------------------
PURQ_BACWK      ----------------------------------------------------------------------
PURQ_SYNSC      ----------------------------------------------------------------------
PURQ_STAAR      ----------------------------------------------------------------------
PURQ_STAAB      ----------------------------------------------------------------------
PURQ_PROMA      ----------------------------------------------------------------------
PURQ_NATPD      ----------------------------------------------------------------------
PURQ_LACLA      ----------------------------------------------------------------------
PURQ_BACHK      ----------------------------------------------------------------------
PURQ_BACC7      ----------------------------------------------------------------------
PURQ_BACC2      ----------------------------------------------------------------------
PURQ_BACC1      ----------------------------------------------------------------------
PURQ_BACC0      ----------------------------------------------------------------------
PURQ_BACAN      ----------------------------------------------------------------------
PURQ_BACAC      ----------------------------------------------------------------------
PURQ_BACAA      ----------------------------------------------------------------------
PURL_LEPIC      ----------------------MEKDVVSLEDA---LEHGLTKEEFQKIQEI---LGRIPNSTELGIFSA
PURL_LACSS      ----------------------------------------LTDSEYELICTKILK--RLPNYTETGLFSV
PURQ_BACCR      ----------------------------------------------------------------------
PURQ_BACC4      ----------------------------------------------------------------------
PURQ_BACAH      ----------------------------------------------------------------------
PURL_LEPIN      ----------------------MEKDVVSLEDA---LEHGLTKEEFQKIQEI---LGRIPNSTELGIFSA
PURQ_SYNPX      ----------------------------------------------------------------------
PURQ_METAC      ----------------------------------------------------------------------
PURQ_HALWD      ----------------------------------------------------------------------
PURQ_STAS1      ----------------------------------------------------------------------
PURQ_PELLD      ----------------------------------------------------------------------
PURQ_NITWN      ----------------------------------------------------------------------
PURQ_NITHX      ----------------------------------------------------------------------
PURQ_METMA      ----------------------------------------------------------------------
PURQ_BRAJA      ----------------------------------------------------------------------
PURQ_BACC3      ----------------------------------------------------------------------
PURQ_WOLSU      ----------------------------------------------------------------------
PURQ_THEEB      ----------------------------------------------------------------------
PURQ_SYNJB      ----------------------------------------------------------------------
PURQ_RHORT      ----------------------------------------------------------------------
PURQ_BACCZ      ----------------------------------------------------------------------
PURQ_BACCQ      ----------------------------------------------------------------------
PURQ_ANAVT      ----------------------------------------------------------------------
PURQ_RHOSR      ----------------------------------------------------------------------
PURQ_BARQU      ----------------------------------------------------------------------
PURQ_AQUAE      ----------------------------------------------------------------------
PURQ_ANASP      ----------------------------------------------------------------------
PURL_METAC      ----------------------------------------LPEEDLKIIRKE---LGREPTLVEQGCFLN
PURQ_RHIEC      ----------------------------------------------------------------------
PURQ_PROMM      ----------------------------------------------------------------------
PURQ_METTH      ----------------------------------------------------------------------
PURQ_LACRJ      ----------------------------------------------------------------------
PURQ_LACRD      ----------------------------------------------------------------------
PURQ_BARHE      ----------------------------------------------------------------------
PURQ_BACCN      ----------------------------------------------------------------------
PURQ_NOCFA      ----------------------------------------------------------------------
PURQ_STRCO      ----------------------------------------------------------------------
PURQ_SILPO      ----------------------------------------------------------------------
PURQ_MYCLE      ----------------------------------------------------------------------
PURQ_LACLC      ----------------------------------------------------------------------
PURQ_JANSC      ----------------------------------------------------------------------
PURQ_DEIGD      ----------------------------------------------------------------------
PURQ_ANOFW      ----------------------------------------------------------------------
PURL_LEPBP      -------------------------------------------------------LGRIPNSTELGIFSA
PURL_LEPBA      -------------------------------------------------------LGRIPNSTELGIFSA
PURQ_THETN      ----------------------------------------------------------------------
PURQ_STAES      ----------------------------------------------------------------------
PURQ_STAEQ      ----------------------------------------------------------------------
PURQ_LACPL      ----------------------------------------------------------------------
PURQ_PROAC      ----------------------------------------------------------------------
PURQ_METJA      ----------------------------------------------------------------------
PURQ_OCEIH      ----------------------------------------------------------------------
PURQ_METBF      ----------------------------------------------------------------------
PURQ_PYRAE      ----------------------------------------------------------------------
PURQ_MESSB      ----------------------------------------------------------------------
PURL_PYRIL      -----------------------------------------------------------PTAAELAFFTS
PURQ_SULSO      ----------------------------------------------------------------------
PURQ_LISIN      ----------------------------------------------------------------------
PURQ_BRUSU      ----------------------------------------------------------------------
PURQ_BRUME      ----------------------------------------------------------------------
PURQ_BRUAB      ----------------------------------------------------------------------
PURQ_BRUA2      ----------------------------------------------------------------------
PURQ_PROM9      ----------------------------------------------------------------------
PURQ_LACCB      ----------------------------------------------------------------------
PURQ_BACHD      ----------------------------------------------------------------------
PURQ_SILST      ----------------------------------------------------------------------
PURQ_LISW6      ----------------------------------------------------------------------
PURQ_GEOSW      ----------------------------------------------------------------------
PURQ_CORGL      ----------------------------------------------------------------------
PURQ_THET8      ----------------------------------------------------------------------
PURQ_THET2      ----------------------------------------------------------------------
PURQ_LISMH      ----------------------------------------------------------------------
PURQ_LACC3      ----------------------------------------------------------------------
PURQ_NOVAD      ----------------------------------------------------------------------
PURQ_LISMO      ----------------------------------------------------------------------
PURQ_LISMF      ----------------------------------------------------------------------
PURQ_LISMC      ----------------------------------------------------------------------
PURQ_LEIXX      ----------------------------------------------------------------------
PURQ_LACDA      ----------------------------------------------------------------------
PURQ_RHOP2      ----------------------------------------------------------------------
PURQ_MYCPA      ----------------------------------------------------------------------
PURQ_HELHP      ----------------------------------------------------------------------
PURL_HALSA      -------------------------------------------------------LGRDPTPAEAALFEN
PURL_HALS3      -------------------------------------------------------LGRDPTPAEAALFEN
PURQ_LACSS      ----------------------------------------------------------------------
PURQ_BACP2      ----------------------------------------------------------------------
PURQ_ALKMQ      ----------------------------------------------------------------------
PURQ_SPHAL      ----------------------------------------------------------------------
PURQ_PROMP      ----------------------------------------------------------------------
PURQ_BACSU      ----------------------------------------------------------------------
PURQ_LYSSC      ----------------------------------------------------------------------
PURL_SALRD      -------------------------------EVDRDLALGLTDDEYDEILD---RLGRTPTFTELGIYSV
PURQ_RHILO      ----------------------------------------------------------------------
PURQ_STAHJ      ----------------------------------------------------------------------
PURQ_RHOPB      ----------------------------------------------------------------------
PURQ_MYCTU      ----------------------------------------------------------------------
PURQ_MYCBO      ----------------------------------------------------------------------
PURQ_GLOVI      ----------------------------------------------------------------------
PURQ_METTP      ----------------------------------------------------------------------
PURQ_DEIRA      ----------------------------------------------------------------------
PURQ_BACA2      ----------------------------------------------------------------------
PURQ_GEOTN      ----------------------------------------------------------------------
PURQ_CHLCH      ----------------------------------------------------------------------
PURQ_BACLD      ----------------------------------------------------------------------
PURQ_SYMTH      ----------------------------------------------------------------------
PURQ_ENTFA      ----------------------------------------------------------------------
PURQ_CAUCR      ----------------------------------------------------------------------
PURQ_THEMA      ----------------------------------------------------------------------
PURQ_LEPIN      ----------------------------------------------------------------------
PURQ_LEPIC      ----------------------------------------------------------------------
PURQ_CORJK      ----------------------------------------------------------------------
PURQ_CAMJE      ----------------------------------------------------------------------
PURQ_RHOPA      ----------------------------------------------------------------------
PURQ_GEOKA      ----------------------------------------------------------------------
PURQ_ACIBL      ----------------------------------------------------------------------
PURQ_LACS1      ----------------------------------------------------------------------
PURL_METS5      --------------------------------------LTLSKTEMEVVR---RVLGREPKEAEWKLVDA
PURQ_ZYMMO      ----------------------------------------------------------------------
PURQ_RUBXD      ----------------------------------------------------------------------
PURQ_ROSDO      ----------------------------------------------------------------------
PURQ_STRAW      ----------------------------------------------------------------------
PURQ_RHOS4      ----------------------------------------------------------------------
PURQ_GLUOX      ----------------------------------------------------------------------
PURQ_ANADE      ----------------------------------------------------------------------
PURQ_BACSK      ----------------------------------------------------------------------
PURL_CALMQ      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ANSEHCRHKIFNAKWTIDGQEQDKSLFKMIRNTTEKSPQGVLSAYKDNAAVIEGATAQRFYPNTQTGVYS
PUR4_PHOLL      ANSEHCRHKIFNADWIIDSQAQPKSLFKMIKNTYEQTPDYVLSAYKDNAAVMEGSAVGRFFASAENGSYD
PUR4_PSEHT      ANSEHCRHKIFNADWTIDGEEQPKSLFKMIKNTFEKNPENVLSAYKDNAAVMKGSKAGRFFPNTQ-GEYA
PUR4_PSEU2      ANSEHCRHKIFNASWDIDGQSQEKSLFGMIKNTYQMHSEGVLSAYKDNASVIVGNVAGRFFPDPETRQYG
PUR4_PSE14      ANSEHCRHKIFNASWDIDGQSQEKSLFGMIKNTYQMHSEGVLSAYKDNASVIVGNVAGRFFPDPETRQYG
PUR4_PSESM      ANSEHCRHKIFNASWDIDGQSQEKSLFGMIKNTYEMHSEGVLSAYKDNASVIVGSVAGRFFPDPDTRQYG
PUR4_PASMU      ANSEHCRHKIFNADWIIDGEKQEKSLFKMIKNTFEKTPDHVLSAYKDNAAVMEGSKVGRFFPD-QDGQYR
PUR4_HAHCH      ANSEHCRHKIFNATWEIDGEVQSHSLFGMIRNTYEQGGQDVLSAYCDNAAVIKGGQGGRFFPDHRTKIYG
PUR4_PHOPR      ANSEHCRHKIFNADWTIDGVEQEKSLFKMIKNTYEKNHEHVLSAYKDNAAVMEGSEVGRFFPNPESRQYN
PUR4_SHIDS      ANSEHCRHKIFNADWIIDGEQQPKSLFKMIKNTFETTPDHVLSAYKDNAAVMEGSEVGRYFADHETGRYD
PUR4_ECOLI      ANSEHCRHKIFNADWVIDGEQQPKSLFKMIKNTFETTPDHVLSAYKDNAAVMEGSEVGRYFADHETGRYD
PUR4_ECO57      ANSEHCRHKIFNADWIIDGEQQPKSLFKMIKNTFETTPDHVLSAYKDNAAVMEGSEVGRYFADHETGRYD
PUR4_SHISS      ANSEHCRHKIFNADWIIDGEQQPKSLFKMIKNTFETTPDHVLSAYKDNAAVMEGSEVGRYFADHETGRYD
PUR4_PSEAE      ANSEHCRHKIFNASWDIDGQAQDKSLFGMIKNTYEMNREGVLSAYKDNAAVIVGHVAGRFFPDPQTREYA
PUR4_SHIBS      ANSEHCRHKIFNADWIIDGEQQPKSLFRMIKNTFETTPDHVLSAYKDNAAVMEGSEVGRYFADHETGRYD
PUR4_PSEF5      ANSEHCRHKIFNASWDIDGQSQEKSLFGMIKNTYQMHNEGVLSAYKDNAAVIVGSVAGRFYPNPETRQYG
PUR4_SHEDO      ANSEHCRHKIFNADWTIDGVVQDKSLFKMIKNTYAVTPDNVLSAYKDNAAVMTGSVAGRFFPD-ETGVYA
PUR4_ECOL6      ANSEHCRHKIFNADWIIDGEQQPKSLFKMIKNTFETTPDHVLSAYKDNAAVMEGSEVGRYFADHETGRYD
PUR4_COLP3      ANSEHCRHKIFNAEWTIDGVKQEKSLFKMIRNTHEINPDYVLSAYKDNAAVMVGNKGGRFFPNPETNVYG
PUR4_MANSM      ANSEHCRHKIFNADWVIDGEKQEKSLFKMIKNTFEKTPDHVLSAYKDNAAVMEGSKVGRFFAD-QDGQYR
PUR4_ECOUT      ANSEHCRHKIFNADWVIDGEQQPKSLFKMIKNTFETTPDHVLSAYKDNAAVMEGSEVGRYFADHETGRYD
PUR4_ECOL5      ANSEHCRHKIFNADWVIDGEQQPKSLFKMIKNTFETTPDHVLSAYKDNAAVMEGSEVGRYFADHETGRYD
PUR4_SALTY      ANSEHCRHKIFNADWIIDGKPQPKSLFKMIKNTFETTPDYVLSAYKDNAAVMEGSAVGRYFADHNTGRYD
PUR4_HAEI8      ANSEHCRHKIFNADWIIDGKKQDKSLFKMIKNTFEQTPDFVLSAYKDNAAVMEGSKVGRWFPDPD-GQYR
PUR4_SALPA      ANSEHCRHKIFNADWIIDGKPQPKSLFKMIKNTFETTPDYVLSAYKDNAAVMEGSAVGRYFADHNTGRYD
PUR4_VIBCH      ANSEHCRHKIFNADWTIDGVKQDKSLFKMIKNTFEQTPDYVLSAYKDNAAVMTGSTVGRFFPDPESRQYT
PUR4_PSEPK      ANSEHCRHKIFNASWDIDGQAQEKSLFGMIKNTYQMHNEGVLSAYKDNASVIVGNVAGRFFPNPETRQYG
PUR4_HAEIN      ANSEHCRHKIFNADWIIDGKKQDKSLFKMIKNTFEQTPDFVLSAYKDNAAVMEGSKVGRWFPDPD-GQYR
PUR4_PSEA6      ANSEHCRHKIFNADWTIDGQTQPKSLFKMIKNTYEKCPDYVHSAYADNAAVMEGSFAGRFFPQADNNQYR
PUR4_SALCH      ANSEHCRHKIFNADWIIDGKPQPKSLFKMIKNTFETTPDYVLSAYKDNAAVMEGSAVGRYFADHNTGRYD
PUR4_SALTI      ANSEHCRHKIFNADWIIDGKPQPKSLFKMIKNTFETTPDYVLSAYKDNAAVMEGSAVGRYFADHNTGRYD
PUR4_YERPN      ANSEHCRHKIFNADWVIDGVVQPKTLFKMIKNTFEHTPDYVLSAYKDNAAVMEGSQVGRFYATAEKGIYD
PUR4_YERPE      ANSEHCRHKIFNADWVIDGVVQPKTLFKMIKNTFEHTPDYVLSAYKDNAAVMEGSQVGRFYATAEKGIYD
PUR4_YERPA      ANSEHCRHKIFNADWVIDGVVQPKTLFKMIKNTFEHTPDYVLSAYKDNAAVMEGSQVGRFYATAEKGIYD
PUR4_YERPS      ANSEHCRHKIFNADWVIDGVAQPKTLFKMIKNTFEHTPDYVLSAYKDNAAVMEGSQVGRFYATAEKGIYD
PUR4_VIBPA      ANSEHCRHKIFNADWTIDGVDQEKSLFKMIKNTFETTPDHVLSAYKDNAAVMTGSKVGRFFPDPKSRQYT
PUR4_SHEFN      ANSEHCRHKIFNADWTIDGEVQLKSLFKMIKNTFEVTPDYVLSAYKDNAAVMTGSVAGRFFPDPD-GIYN
PUR4_VIBVU      ANSEHCRHKIFNADWTIDGVEQPKSLFKMIKNTFETTPDHVLSAYKDNAAVMTGSKVGRFFPDPETRQYN
PUR4_PSEPF      ANSEHCRHKIFNASWDIDGESQEKSLFGMIKNTYQMHSEGVLSAYKDNASVIVGNVAGRFFPDPETRQYG
PUR4_ERWCT      ANSEHCRHKIFNADWVIDGVTQPKSLFKMIKNTFEHTPDHVLSAYKDNAAVMEGSAVGRFYTDAN-GQYD
PUR4_VIBVY      ANSEHCRHKIFNADWTIDGVEQPKSLFKMIKNTFETTPDHVLSAYKDNAAVMTGSKVGRFFPDPETRQYN
PUR4_IDILO      ANSEHCRHKIFNADWTIDGAEQPKSLFKMIKNTFETTPDYVLSAYKDNAAVMEGHEAGRFYPQPDSMSYG
PUR4_VIBF1      ANSEHCRHKIFNADWTIDGVKQEKSLFKMIKNTFEVTPDNVLSAYKDNAAVMTGSEVGRFFPDPETRQYN
PUR4_HAES1      ANSEHCRHKIFNADWIIDGKKQDKSLFKMIKNTFEKTPDYVLSAYKDNAAVMEGSKVGRFFPD-QDGQYR
PUR4_SHESR      ANSEHCRHKIFNADWTIDGEAQPKSLFKMIKNTFETTPDHVLSAYKDNAAVMEGSVAGRFFPDPN-GVYS
PUR4_SHESM      ANSEHCRHKIFNADWTIDGEAQPKSLFKMIKNTFETTPDHVLSAYKDNAAVMEGSVAGRFFPDPN-GVYS
PUR4_SHEON      ANSEHCRHKIFNADWTIDGKAQPKSLFKMIKNTFEVTPDHVLSAYKDNAAVMEGSVAGRFFPDPN-GVYS
PUR4_METFK      ANSEHCRHKIFNADWVIDGVAQAQSLFGMIRNTHKLNPGKTVVAYADNASIVEGGKTKRFYPLAD-GQYG
PUR4_SODGM      ANSEHCRHKIFNADWVIDGQPQAKSLFKMIKNTFEQTPEYVLSAYKDNASVMEGSAVGRFFPDAQAGRYD
PUR4_MYXXD      ANSEHCRHKIFNASWTIDGKPQERSLFQAIKNTYVQHKEGVLGAYKDNAAVIEGFEVDRFFPSPESGEWG
PUR4_RALSO      ANSEHCRHKIFNADWTIDGETQDKSLFAMIRNTHQLAPQGTVVAYSDNAAVMEGGMAERWFPHAETGVPQ
PUR4_NEIMB      ANSEHCRHKIFNADFILNGEKQPKSLFGMIRDTHNAHPEGTVVAYKDNSSVIEGAKIERFYPNAENQGYR
PUR4_NEIG1      ANSEHCRHKIFNADFILNGEKQPKSLFGMIRDTHNAHPEGTVVAYKDNSSVIKGAKIERFYPNAENQGYR
PUR4_NEIMA      ANSEHCRHKIFNADFILNGEKQPKSLFGMIRDTHNAHPEGTVVAYKDNSSVIEGAKVERFYPNAENQGYR
PUR4_SCHPO      VNSEHCRHKIFNADWTIDGEKKDYSLFKMIRNTHLKNPQYTISAYSDNAAVFEGNSGTLFAP--VNGIWS
PUR4_YEAST      VNSEHCRHKIFNADWTIDGIKQQFTLFQMIRNTHKLNPEYTISAYSDNAAVLDSENDAFFFPNSTTKEWT
PUR4_XYLFT      ANSEHCRHKIFNATWTIDDKEQPYSLFQMIKHTHQHTPQYTLSAYADNAAVIEGHPTTRYRPDPITGEY-
PUR4_XYLFA      ANSEHCRHKIFNATWTINDKEQQHSLFQMIKHTHQHTPQYTLSAYADNAAVIEGHPTARYRPDPITGEY-
PUR4_XANAC      ANSEHCRHKIFNATWTIDGKPQERSLFRMIKHTHQQTPQHTLSAYSDNAAVVEGVPAARYRPDPATGQY-
PUR4_XANCP      ANSEHCRHKIFNASWTIDGKPQERSLFRMIKHTHQQTPQHTLSAYSDNAAVVEGVPAARFRPDPATGEY-
PUR4_ARATH      SNSEHSRHWFFAGNMVIDGKPMDKSLMQIVKSTWEANRNNSVIGFKDNSSAIRGFLVNQLRPLLPGSVLD
PUR4_DICDI      SNSEHSRHWFFNGKLIVDGNMSDKTLFQIVKNTLKANPQNSLIAFSDNSSSIKGFKTKVLIPKSQASEYL
PUR4_DROME      SNSEHSRHWFFRGRMVIDGVEQPKSLIRMIMDTQAHTNPNNTIKFSDNSSAMVGFDHQTIVPSSVVGAVR
PUR4_HUMAN      SNSEHSRHWFFKGQLHVDGQKLVHSLFESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSR
PUR4_MOUSE      SNSEHSRHWFFKGQLHVDGKKLAHSLFESIMSTQASSNPNNVLKFCDNSSAIQGKKVKFLRPEDSTRPSC
PUR4_CAEEL      SDSEHSRHWFFRGEIWIDDRKRDGSLMKTIRETLDSSNDNSLIAFCDNSSAIRGESVCRLRPNDPTTVSP
PURL_ARCFU      AWSEHCCYK--------------SSKYYLRQYLLEASKADVISAIEEDAGVVEF----------------
PURL_PICTO      SWSEH--------SCXXXXXXXXXXXXXXXRN------ERTILAMEDDA-----------------GVVK
PURL_THEAC      SWSEHCXXXXXXXXXXXXXXXXXTDY--------------TILAMEDDAGVVDF-----------DGEYA
PURL_THEVO      SWSEHCXXXXXXXXXXXXX-------------TNLKTDYTIL-AMEDDAGVVE-----------------
PURL_MYCA9      MWSEHCSYKSSKVHLRYFGQ-----------TTTEEMRSAMLAGIGENAGVVDIGDGWA-----------
PURL_NOCFA      MWSEHCSYKSSKVHLRYFGE-----------TTTEEMRKSMLAGIGENAXXXXXXXXWA-----------
PURL_LACS1      MWSEHCSYK------------KSKPVLKLFPNKNERVLQG---------------------PGEGAGIVD
PURL_ZYMMO      MWSEHCSYK---------------SSRKHLRELPTTGSQ-VICGPGENAGVVDIGDGQA-----------
PURL_THETN      MWSEHCSYK------------NSKPLLKYLPTKGERVIQG---------------------PGENAGVLD
PURL_CORGL      MWSEHCSYKSSKVHLRYFGE-----------TTTEEMASKILAGIGENAGVVDIGDGNA-----------
PURL_CORGB      MWSEHCSYKSSKVHLRYFGE-----------TTTEEMASKILAGIGENAGVVDIGDGNA-----------
PURL_THEPX      MWSEHCAYK------------NSKPLLKYLPTKGERVIQG---------------------PGENAGVLD
PURL_RHOE4      MWSEHCSYKSSKVHLGYFG-----------KTTTDEMRANMLAGIGENAGVVDIGDGWA-----------
PURL_CARHZ      MWSEHCSYKSSKIH---------------LKKLPTRGP-----------AVVQG-------PGENAGVVD
PURL_THEP3      MWSEHCAYK------------NSKPLLKYLPTKGERVIQG---------------------PGENAGVLD
PURL_RHORT      MWSEHCSYKS-SKKWL---------------KTLPTTAPWVIQGPGENAGVIDGLTA-------------
PURL_MYCPA      MWSEHCSYKSSKVHLRYFGE-----------TTTDEMRAGMLAGIGENAGVVDIGDGWA-----------
PURL_MYCA1      MWSEHCSYKSSKVHLRYFGE-----------TTTDEMRAGMLAGIGENAGVVDIGDGWA-----------
PURL_CORJK      MWSEHCSYKSSKTHLRYFGE-----------TTTEEMKSKMLAGIGENAGVIDIGDGHA-----------
PURL_OCEIH      MWSEHCSYKT------------SKPLLK-------KFPT-------DGPHVLQG-------PGEGAGVID
PURL_MYCVP      MWSEHCSYKSSKVHLRYFGE-----------TTTEKMRETMLAGIGENAGVVDIGDGWA-----------
PURL_NOCSJ      MWSEHCSYK--------SSKVHLKQFSELAEVLAQRQPDALLAGIGENAGVVDIGQGYA-----------
PURL_STAS1      MWSEHCSYK------------HSKPFLTQFPTSGEHVLMG---------------------PGEGAGVVD
PURL_MYCGI      MWSEHCSYKSSKVHLRYFGE-----------TTTEKMREIMLAGIGENAGVVDIGDGWA-----------
PURL_LACH4      MWSEHCSYK------------KSKPVLRLFPTKGKRVVQG---------------------PGEGAGVVD
PURL_CORAM      MWSEHCSYKSSKTHLRYFGE-----------TTTEEMASKILAGIGENAGVVDIGDGDA-----------
PURL_THESM      MWSEHASYKS-SRKW-----------LKLLPT--------------ENEHVILG-------PGEDAGVVK
PURL_PELUB      ----------------------------------------------------------------------
PURL_NOVAD      MWSEHCSYK--------------SSRIHLKKLPT--SAPWVICGPGENAGVIDIGDGQA-----------
PURL_LACF3      MWSEHCSYK------------KSKPVLRLFPNQNDRVLQG---------------------PGEGAGVVD
PURQ_METM5      ----------------------------------------------------------------------
PURL_PYRAB      MWSEHVSYKS-SRKW-----------LKLLPTKNEH--------------VILG-------PGEDAGVVK
PURQ_METMP      ----------------------------------------------------------------------
PURL_STACT      MWSEHCSYK------------HSKPFLKQFPTTSEHVLMG---------------------PGEGAGVVD
PURL_BACLD      MWSEHCSYK------------NSKPILKKFPTKGERVLQG---------------------PGEGAGIVD
PURL_PARL1      MWNEHCSYKS-SKKW--------------LRTLPTTGPR-VICGPGENAGVVDIGDGQA-----------
PURL_MYCTU      MWSEHCSYKSSKVHLRYFGE-----------TTSDEMRAAMLAGIGENAGVVDIGDGWA-----------
PURL_MYCTA      MWSEHCSYKSSKVHLRYFGE-----------TTSDEMRAAMLAGIGENAGVVDIGDGWA-----------
PURL_MYCBT      MWSEHCSYKSSKVHLRYFGE-----------TTSDEMRAAMLAGIGENAGVVDIGDGWA-----------
PURL_MYCBP      MWSEHCSYKSSKVHLRYFGE-----------TTSDEMRAAMLAGIGENAGVVDIGDGWA-----------
PURL_MYCBO      MWSEHCSYKSSKVHLRYFGE-----------TTSDEMRAAMLAGIGENAGVVDIGDGWA-----------
PURL_RENSM      MWSEHCSYKSSKVHLSQFGEK-----------VTEEMKKHLLVGIGENAGVVDIGDGWA-----------
PURL_STRCO      MWSEHCSYKSSKVH---------------LRQFGEKAPQSMLVGIGENAGVVDVGQGYA-----------
PURL_CORA7      MWSEHCSYKSSKTHLRYFGETM-----------TEEMGSKILAGIGENAGVVDIGDGNA-----------
PURL_THEGJ      MWSEHASYK------------SSRPWLKLLPT--------------ENEHVILG-------PGEDAGIVK
PURL_EXISA      MWSEHCSYK------------NSKPVLRKFPTTGKHVLQG---------------------PGEGAGIVD
PURL_STRAW      MWSEHCSYKSSKVH---------------LRQFGEKAPQSLLVGIGENAGVVDVGQGYA-----------
PURL_ROSDO      MWNEHCSYKS-SKKW--------------LRTLPTTGPQ-VICGPGENAGVVDIGDGQA-----------
VP75_SHV21      ----------------------------------------------------------------------
PURQ_METM7      ----------------------------------------------------------------------
PURL_STAAN      MWSEHCSYK------------HSKPFLKQFPTSGEHVLMG---------------------PGEGAGVVD
PURL_STAAM      MWSEHCSYK------------HSKPFLKQFPTSGEHVLMG---------------------PGEGAGVVD
PURL_STAA9      MWSEHCSYK------------HSKPFLKQFPTSGEHVLMG---------------------PGEGAGVVD
PURL_STAA2      MWSEHCSYK------------HSKPFLKQFPTSGEHVLMG---------------------PGEGAGVVD
PURL_STAA1      MWSEHCSYK------------HSKPFLKQFPTSGEHVLMG---------------------PGEGAGVVD
PURL_METJA      LWSEHCAYRT------------SKKLLRMFAKTVEKTSKNIVVGIGDDAAVIR-----------------
PURL_LACLM      MWSEHCCYK------------NSKPVLKKFPTT---GPQVLMG------------------PGEGAGVVD
PURL_LACLC      MWSEHCCYK------------NSKPVLKKFPTT---GPQVLMG------------------PGEGAGVVD
PURL_GLUOX      MWSEHCSYKSSRIH---------------LKTLPTKAPW-----------VIHG-------PGENAGVVD
PURL_ANASK      MWSEHCSYKSS----------------RVHLKTFPTSGPRVLQGPGENAGVVDLG---------------
PURL_ANADF      MWSEHCSYKSS----------------RVHLKTFPTSGPRVLQGPGENAGVVDLG---------------
PURL_COREF      MWSEHCSYKSSKVHLRYFGE-----------TTTPEMAEKILAGIGENAGVVDIGDGNA-----------
PURL_STAAW      MWSEHCSYK------------HSKPFLKQFPTSGDHVLMG---------------------PGEGAGVVD
PURL_STAAT      MWSEHCSYK------------HSKPFLKQFPTSGDHVLMG---------------------PGEGAGVVD
PURL_STAAS      MWSEHCSYK------------HSKPFLKQFPTSGDHVLMG---------------------PGEGAGVVD
PURL_STAAE      MWSEHCSYK------------HSKPFLKQFPTSGDHVLMG---------------------PGEGAGVVD
PURL_STAAC      MWSEHCSYK------------HSKPFLKQFPTSGDHVLMG---------------------PGEGAGVVD
PURL_STAA8      MWSEHCSYK------------HSKPFLKQFPTSGDHVLMG---------------------PGEGAGVVD
PURL_STAA3      MWSEHCSYK------------HSKPFLKQFPTSGDHVLMG---------------------PGEGAGVVD
PURL_PYRKO      MWSEHASYK------------SSRPFLKLLPT--------------ENEHVVLG-------PGEDAGIVK
PURL_GEOSW      MWSEHCSYK--NSKPVL-----------------KKFPT-------EGKHVLQG-------PGEGAGIVD
PURL_STAAR      MWSEHCSYK------------HSKPFLKQFPTSGEHVLMG---------------------PGEGAGVVD
PURL_LACLS      MWSEHCCYK------------NSKPVLKKFPTT---GPQVLMG------------------PGEGAGVVD
PURQ_THEAC      ----------------------------------------------------------------------
PURL_METST      MFSEHCSYK---------------SSKPILRNFPTDGPDVILG------------------PGDDAGIVS
PURL_FRASC      MWSEHCSYK------------SSKVHLRQFRDTP--LTDRLLVGMGENAGVVDVG---------------
PURL_ERYLH      MWSEHCSYK--------------SSRLHLKKLPTEAP--WVICGPGENAGVIDIGDGHA-----------
PURL_MYCLE      MWSEHCSYKSSKVHLRYFGXXXXXXM-----------RTGMLAGIGENAGVVDIGDGWA-----------
PURL_MYCLB      MWSEHCSYKSSKVHLRYFGXXXXXXM-----------RTGMLAGIGENAGVVDIGDGWA-----------
PURL_BACSU      MWSEHCSYK------------NSKPILRKFPTSGERVLQG---------------------PGEGAGIVD
PURL_TROWT      LWSEHCSYK------------SSRRHLRQLADLTEVTKKHLLVGIGQNAGVVDGGWAAAF----------
PURL_TROW8      LWSEHCSYK------------SSRRHLRQLADLTEVTKKHLLVGIGQNAGVVDGGWAAAF----------
PURL_THELT      MWSEHCSYK------------HTKHLLRDLPTSGERVIQG---------------------PGENAGVVD
PURL_MACCJ      MWSEHCSYK------------HSKPFLKQFPTTGERVLMG---------------------PGEGAGVVD
PURL_LACAC      MWSEHCSYK------------KSKPVLKLFPTKGKRVVQG---------------------PGEGAGVVD
PURL_STAAB      MWSEHCSYK------------HSKPFLKQFPTSGEHVLMG---------------------PGEGAGVVD
PURL_BACC2      MWSEHCSYK------------NSKPVLRKFPTTGERVLQG---------------------PGEGAGIVD
PURL_MESSB      MWNEHCSYKS-SKRW--------------LRTLPTSGPQ-----------VIQG-------PGENAGVVD
PURL_BACSK      MWSEHCSYK------------NSKVLLKKFPTDGENVLQG---------------------PGEGAGIID
PURL_BACCR      MWSEHCSYK------------NSKPVLRKFPTTGERVLQG---------------------PGEGAGIVD
PURL_LACC3      MWSEHCAYKY------------SKPVLRQFWTKNERVLMG---------------------PGEGAGVID
PURL_CALMQ      EWSEHCSYKSSRA-W--------------IRLLPSKSP-----------LVIRGS-------GLDAPIIR
PURL_BACC4      MWSEHCSYK------------NSKPVLRKFPTTGERVLQG---------------------PGEGAGIVD
PURL_AZOC5      MWNEHCSYKSSKV-W--------------LRTLPTKGPR-----------VIQG-------PGENAGVVD
PURQ_PICTO      ----------------------------------------------------------------------
PURL_STAES      MWSEHCSYK------------HSKPFLKQFPTTGEHVLMG---------------------PGEGAGVVD
PURL_STAEQ      MWSEHCSYK------------HSKPFLKQFPTTGEHVLMG---------------------PGEGAGVVD
PURL_LACRJ      MWSEHCSYK------------KSKPVLRLFPNKNERVLQG---------------------PGEGAGVVD
PURL_LACRD      MWSEHCSYK------------KSKPVLRLFPNKNERVLQG---------------------PGEGAGVVD
PURL_PYRFU      MWSEHVSYKS-SRKW-----------LKLLPTKNEH--------------VILG-------PGEDAGIIK
PURL_BACA2      MWSEHCSYK------------NSKPVLRKFPTSGERVLQG---------------------PGEGAGIVD
MTP_EBVG        ----------------------------------------------------------------------
PURL_GEOTN      MWSEHCSYK--NSKPVL-----------------KKFPT-------DGPHVLQG-------PGEGAGIVD
PURL_PYRHO      MWSEHVSYKS-SRKW-----------LKLLPTKNEHVVLG---------------------PGEDAGIIK
PURL_BACWK      MWSEHCSYK------------NSKPVLRKFPTTGERVLQG---------------------PGEGAGIVD
PURQ_THEVO      ----------------------------------------------------------------------
PURL_RHOS5      MWNEHCSYKS-SKKW--------------LRTLPTTGPQ-VICGPGENAGVVDIGDGQA-----------
PURL_BACCN      MWSEHCSYK------------NSKPVLRKFPTTGERVLQG---------------------PGEGAGIVD
MTP_EBVA8       ----------------------------------------------------------------------
PURL_BARHE      MWNEHCSYKS-SKKWL---------------KTLPTKGNCVIQGPGENAGVVDIGEGQC-----------
PURL_GLOVI      MWSEHCCYK------------NSRPLLKGFPTTGPR----VLVGPGENAGVIDIGDGLR-----------
PURL_FRASN      MWSEHCSYK------------SSKVHLRQFRDTP--ATDRLLVGMGENAGVVDVG---------------
PURL_STAHJ      MWSEHCSYK------------HSKPFLKQFPTTGEHVLMG---------------------PGEGAGVVD
PURL_RHOP5      MWNEHCSYKSSRIH---------------LKGLPTKAPW-VLQGPGENAGVIDIGDNQA-----------
PURL_ANADE      MWSEHCSYKSS----------------RVHLKTFPTSGPRVLQGPGENAGVVDLG---------------
MTP_EBVB9       ----------------------------------------------------------------------
VP03_SHV21      ----------------------------------------------------------------------
PURL_LISMF      MWSEHCSYK--NSK-------------PVLRKFPTEGKQ-----------VLQG-------PGEGAGIVD
PURL_HALMA      LWSEHCAYRSSRPLLSAFDSEGDQ----------------VVIGPGDDAAVVS-------LPSHGDG---
PURL_RHOP2      MWNEHCSYKSSRIH---------------LKGLPTKAPW-VLQGPGENAGVIDIGDNQA-----------
PURL_LACCA      MWSEHCAYKY------------SKPVLRQFWTKNERVLMG---------------------PGEGAGVID
PURL_BARQU      MWNEHCSYKS-SKKWL---------------KTLPIKGKCVIQGPGENAGVIDIGKGQC-----------
PURL_BACP2      MWSEHCSYK---------------------------NSKPVLSKFPTKGEVLQG-------PGEGAGIVD
PURL_RHOPB      MWNEHCSYK---------------SSRLHLKGLPTKAPW-----------VLQG-------PGENAGVID
PURL_GEOKA      MWSEHCSYK--NSKPVL-----------------KKFPT-------DGPHVLQG-------PGEGAGIVD
PURL_BRASO      MWNEHCSYKSSRIH---------------LKGLPTKAPW-VIQGPGENAGVIDIGDGQA-----------
PURL_SULIY      ----------------------------------------------------------------------
PURL_SULIN      ----------------------------------------------------------------------
PURL_SULIL      ----------------------------------------------------------------------
PURL_SULIA      ----------------------------------------------------------------------
PURL_RHOSK      MWNEHCSYKS-SKKW--------------LRTLPTTGPQ-VICGPGENAGVVDIGDGQA-----------
PURL_SULSO      ----------------------------------------------------------------------
PURL_SULIM      ----------------------------------------------------------------------
PURL_SULIK      ----------------------------------------------------------------------
PURL_METSB      MWNEHCSYK---------------SSRLHLRALPTKAPW-----------VIQG-------PGENAGVID
PURQ_TREDE      ----------------------------------------------------------------------
PURL_RHOS4      MWNEHCSYKS-SKKW--------------LRTLPTTGPQ-VICGPGENAGVVDIGDGQA-----------
PURL_META3      LWSEHCSYR------------STKKLLSMFGKTVKEN-QNIVVGPGDDAALIK----------------I
PURL_BACC3      MWSEHCSYK------------NSKPVLRKFPTTGERVLQG---------------------PGEGAGIVD
PURL_BACC0      MWSEHCSYK------------NSKPVLRKFPTTGERVLQG---------------------PGEGAGIVD
PURL_BACAN      MWSEHCSYK------------NSKPVLRKFPTTGERVLQG---------------------PGEGAGIVD
PURL_BACAH      MWSEHCSYK------------NSKPVLRKFPTTGERVLQG---------------------PGEGAGIVD
PURL_BACAC      MWSEHCSYK------------NSKPVLRKFPTTGERVLQG---------------------PGEGAGIVD
PURL_BACAA      MWSEHCSYK------------NSKPVLRKFPTTGERVLQG---------------------PGEGAGIVD
PURL_PROAC      MWSEHCSYK------------SSKKYLRRFGDLPQQTPLGLLAGIGDNAGVVDIGNG-------------
PURL_ANOFW      MWSEHCSYK--NSKPVL-----------------KKFPT-------EGKHVLQG-------PGEGAGIVD
PURL_THERP      LWSEHCGYKHSRP---------------LLRKLPTSGPH-----------VVQG-------PGENAGAVE
PURL_THEFY      MWSEHCSYKSSKVH---------------LRQFGEKAP--------DTDVLLVGIG--------ENAXXX
PURL_BACCZ      MWSEHCSYK------------NSKPVLRKFPTTGERVLQG---------------------PGEGAGIVD
PURL_ACAM1      MWSEHCCYK---------------------------NSRPLLSQFPEGKHVLVG-------PGENAGVVD
PURL_LACDB      MWSEHCSYK------------KSKSVLRLF---PTKGPR-ILQGPGEGAGVVDIGDGQA-----------
PURL_LACDA      MWSEHCSYK------------KSKSVLRLF---PTKGPR-ILQGPGEGAGVVDIGDGQA-----------
PURL_BACCQ      MWSEHCSYK------------NSKPVLRKFPTTGERVLQG---------------------PGEGAGIVD
PURL_BACHK      MWSEHCSYK------------NSKPVLRKFPTTGERVLQG---------------------PGEGAGIVD
PURL_BACC7      MWSEHCSYK------------NSKPVLRKFPTTGERVLQG---------------------PGEGAGIVD
PURQ_ARCFU      ----------------------------------------------------------------------
PURL_BRASB      MWNEHCSYKSSRIH---------------LRGLPTKAPW-VIQGPGENAGVIDIGDGQA-----------
PURL_BACHD      MWSEHCSYKVLLKKFPIDGDKVLQXXXXXXXXXXXXXXQAVV----------------------------
PURL_BACC1      MWSEHCSYK------------NSKPVLRKFPTTGERVLQG---------------------PGEGAGIVD
PURL_SULAC      LWSEHCSYK------------SSKIFLRSFPSEGERVVMGI-EDWQDAGALDVG----------------
PURL_RHOPA      MWNEHCSYKSSRIH---------------LKGLPTKAPW-VLQGPGENAGVIDIGDNQA-----------
PURL_NITWN      MWNEHCSYKSSRIH---------------LRGLPTKAPW-VIQGPGENAGVIDIGDGQA-----------
PURL_LACLA      MWSEHCCYK------------NSKPVLKKFPTT---GPQVLMG------------------PGEGAGVVD
PURL_ENTFA      MWSEHCSYK--NSK-------------PVLKKFPTEGPQ-----------VLQG-------PGEGAGIVD
PURL_RHOPT      MWNEHCSYKSSRIH---------------LKGLPTKAPW-VLQGPGENAGVIDIGDNQA-----------
PURL_PROM9      MWSEHCCYR--NSK-------------PLLSNFPTKG-KNILVGPGENAGVIDVGNNQK-----------
PURL_ANAD2      MWSEHCSYKSS----------------RVHLKTFPTSGPRVLQGPGENAGVVDLG---------------
PURL_HALWD      LWSEHCAYR--------SSRPLLQSFTTGDDSANDEGAEHVVIGPGDDAAVVR---LPRVDEASETPIY-
PURL_RHOPS      MWNEHCSYKSSRIH---------------LRGLPTKAPW-VLQGPGENAGVIDIGDNQA-----------
PURL_PETMO      QWSEHC------------GYKHSKHYLKKINESYES----------ENAGYVQGGKA-------------
PURL_ALKMQ      MWSEHCSYK------------HSRSMFKHFPT----SGPSVLQGPGENAGIVDIG---------------
PURL_PROMS      MWSEHCCYR--NSK--------------PLLSKFPTKGKNVLVGPGENAGVIDVGNNQK-----------
PURL_BEII9      MWNEHCSYKSSRIH---------------LRKLPTKAPW-----------VIQG-------PGENAGVID
PURL_BARBK      MWNEHCSYKS-SKKWL---------------KTLPTKGKCVIQGPGENAGVVDIGNGQC-----------
PURL_CHLCH      MWSEHCSYK---------------NSIAVLKTLPREGGALLTSAGEENAGLVDIG---------------
PURL_SILST      MWNEHCSYKS-SKKW--------------LRTLPTSGPQ-VICGPGENAGIVDIGDGDA-----------
PURL_SULDN      MWSEHCSYK--SSKVHLSG-------------FPTKAPW-VIQGPGENAGVIDIG-----------GGYA
PURL_THEEB      MWSEHCCYK--NSRL-------------LLKQFPTQGPR-VLVGPGENAGVVDLGDGLR-----------
PURL_SYMTH      MWSEHCAYK------------HSKAALRRLPTRGEHVLQG---------------------PGENAGVVR
PURL_SILPO      MWNEHCSYKS-SKKW--------------LRTLPTSGPQ-VICGPGENAGVVDIGDGQA-----------
PURL_RHILO      MWNEHCSYKS-SKKW--------------LRTLPTTGPQ-----------VIQGPG--------ENAXXX
PURL_PARDP      MWNEHCSYKS-SKKW--------------LRTLPTTGPQ-VICGPGENAGVVDIGDGQA-----------
PURL_GRABC      MWSEHCSYKS-SRHW--------------LKQLPTKAPW-----------VIHG-------PGENAGVVD
PURL_LEIXX      MWSEHCSYKSSKIYLRQFGQK-------------------VTPAMKKNLMVGMGENA---------GVVD
PURL_CAMLR      MWSEHCSYK---------------------------SSKKYLSGFPTKAPVIQG-------PGENAGVID
PURL_SINMW      MWNEHCSYKS-SKKW--------------LRTLPTKGPR-----------VIQGPG--------ENAXXX
PURL_SYNY3      MWSEHCCYK------------NSRPLLSNFPTEGER----ILVGPGENAGVVDLGDGLR-----------
PURL_LEUMM      MWSEHVSYK--------------------------KSKPILRKFWSSNERVLQG-------PGEGAGILD
PURL_PROMA      MWSEHCCYR------------NSRSLLSNFPTTGKN----ILVGPGENAGVVDLGEGQR-----------
PURL_LISW6      MWSEHCSYK--NSK-------------PVLRKFPTEGKQ-----------VLQG-------PGEGAGIVD
PURL_JANSC      MWNEHCSYKS-SKKW--------------LRTLPTEGPQ-VICGPGENAGIVDIGDGQC-----------
PURL_CAMHC      MWSEHCSYK---------------SSKKYLNGFPTKAPW-----------VIQG-------PGENAGVID
PURL_RHIME      MWNEHCSYKS-SKKW--------------LRTLPTKGPR-----------VIQGPG--------ENAXXX
PURL_LISMC      MWSEHCSYK--NSK-------------PVLRKFPTEGKQ-----------VLQG-------PGEGAGIVD
PURL_LISIN      MWSEHCSYK--NSK-------------PVLRKFPTEGKQ-----------VLQG-------PGEGAGIVD
PURL_PROMP      MWSEHCCYR--NSK-------------PLLANTTGKN---VLVGPGENAGVIDVGNDQK-----------
PURL_OCHA4      MWNEHCSYKS-SKKW--------------LRTLPTTGPR-----------VIQGPG--------ENAXXX
PURL_LISMH      MWSEHCSYK--NSK-------------PVLRKFPTEGKQ-----------VLQG-------PGEGAGIVD
PURL_RHIEC      MWNEHCSYKS-SKKW--------------LRTLPTKGPR-----------VIQGPG--------ENAXXX
PURL_METS3      MFSEHCSYK---------------------------SSRPILGTFPEGENIILG-------PGDDAGLVS
PURL_LISMO      MWSEHCSYK--NSK-------------PVLRKFPTEGKQ-----------VLQG-------PGEGAGIVD
PURL_RHIL3      MWNEHCSYKS-SKKW--------------LRTLPTKGPR-----------VIQGPG--------ENAXXX
PURL_NITHX      MWNEHCSYKSSRIH---------------LRGLPTKAPW-VIQGPGENAGVIDIGDGQA-----------
PURL_BRUME      MWNEHCSYKS-SKKW--------------LRTLPTSGPR-----------VIQGPG--------ENAXXX
PURL_BRUMB      MWNEHCSYKS-SKKW--------------LRTLPTSGPR-----------VIQGPG--------ENAXXX
PURL_BRUAB      MWNEHCSYKS-SKKW--------------LRTLPTSGPR-----------VIQGPG--------ENAXXX
PURL_BRUA2      MWNEHCSYKS-SKKW--------------LRTLPTSGPR-----------VIQGPG--------ENAXXX
PURL_BRUA1      MWNEHCSYKS-SKKW--------------LRTLPTSGPR-----------VIQGPG--------ENAXXX
PURL_ACICJ      MWSEHCSYK------------SSRIWLKTLPTTAPW--------------VIHG-------PGENAGVVD
PURL_PROM0      MWSEHCCYR--NS--------------KPLLSKFPTKGKNVLVGPGENAGVIDVGNNQK-----------
PURL_LACPL      ----------------------------------------------------------------------
PURL_IGNH4      QWSEHCSYK---------------SSRKHLRKLKMDSPWVVKGG---DAAVVDFGS--------------
PURL_WOLSU      MWSEHCSYK---------------------------SSKKYLRGFPTEAAVIQG-------PGENAGVID
PURL_RHILW      MWNEHCSYKS-SKKW--------------LRTLPTKGPR-----------VIQGPG--------ENAXXX
PURL_RHIE6      MWNEHCSYKS-SKKW--------------LRTLPTKGPR-----------VIQGPG--------ENAXXX
PURL_BART1      MWNEHCSYKS-SKKW-------------------------LKTLPTEGKCVIQG-------PGENAGVVD
PURL_SYNJB      MWSEHCCYK------------NSRPLLKNFPTTGERVVVG---------------------PGENAGVVD
PURL_AGRT5      MWNEHCSYKS-SKKW--------------LKTLPTTGPR-----------VIQGPG--------ENAXXX
PURL_SULNB      MWSEHCSYK---------------SSKKYLNGFPTKAPW-----------VIQG-------PGENAGVID
PURL_BRUSU      MWNEHCSYKS-SKKW--------------LRTLPTSGPR-----------VIQGPG--------ENAXXX
PURL_BRUSI      MWNEHCSYKS-SKKW--------------LRTLPTSGPR-----------VIQGPG--------ENAXXX
PURL_BRUO2      MWNEHCSYKS-SKKW--------------LRTLPTSGPR-----------VIQGPG--------ENAXXX
PURL_BRUC2      MWNEHCSYKS-SKKW--------------LRTLPTSGPR-----------VIQGPG--------ENAXXX
PURL_RHOSR      MWSEHCSYKSSKVHLKYFGE-----------TTTDEMRSSMLAGIGENAGVVDIGDGWA-----------
PURL_RHIFR      MWNEHCSYKS-SKKW--------------LRTLPTKGPR-----------VIQGPG--------ENAXXX
PURL_BRAJA      MWNEHCSYKSSRIH---------------LRGLPTKAPW-VIQGPGENAGVIDIGDGQA-----------
PURL_PROM2      MWSEHCNSKPLLSKFPTEGKH-------------------VLVGPGENAGVIDVGNNQK-----------
PURL_AQUAE      LWSEHCSYK------------SSKKHLKKFPTKAEWVVQG---------------------PGENAGVVK
PURL_RHISN      MWNEHCSYKS-SKKW--------------LRMLPTKGPR-----------VIQGPG--------ENAXXX
PURQ_DEHE1      ----------------------------------------------------------------------
PURL_PELLD      MWSEHC-------------------------------------SYKNSIAVLK--TLPRXXXXXXXXXXX
PURL_MOOTA      MWSEHC------------GYKSSRSVLKLFPT---KAPW-VLQGPGENAGIVDIGDGQA-----------
PURL_PROM5      MWSEHCCYR--NSK-------------PLLANTTGKN---VLVGPGENAGVIDVGNDQK-----------
PURL_CHLTE      MWSEHCSYK---------------NSIAVLKTLPRDGASLLTQAGEENAGLVDIG---------------
PURL_AGRVS      MWNEHCSYK------------SSKRWLRTLPTT--------------GARVIQGPG--------ENAXXX
PURL_THEMA      MWSEHC------------GYSHTKKYIRRLPKT----------GFEGNAGVVN-----------------
PURL_NATPD      LWSEHCAYR---------------------------SSQPLLSAFESEXXXXXXXXXXXXXPDPETGENS
PURL_ANAVT      MWSEHCCYK------------NSRPLLKQFPTTGPR----ILVGPGENAGVVDLG---------------
PURL_THET8      MWSEHCAYK------------NSRPLLKALP--------------KEGEAVLQG-------PGENAGVVR
PURL_THET2      MWSEHCAYK------------NSRPLLKALP--------------KEGEAVLQG-------PGENAGVVR
PURL_DEIRA      MWSEHC------------GYKNSRPLFRAFPTT---GPQ-VLQGPGENAGVVDIGDGW------------
PURL_SYNJA      MWSEHCCYK------------NSRPLLKHFPTTGERVVVG---------------------PGENAGVVD
PURL_PYRAE      HWSEHCSYK---------------STRMWLRRLPSKAPWVVRGPGTD-APLVEIAE----------GLYA
PURL_METTH      MFSEHCSYK---------------------------SSRPVLGLFPEGEDVIIG-------PGDDAGVVE
PURL_CAMC1      MWSEHCSYK---------------SSKKYLNGFPTKAPW-----------VIQGPG--------ENXXXX
PURQ_METKA      ----------------------------------------------------------------------
PURL_SYNPX      MWSEHCCYR--NSR-------------PLLRGFPTEGPR-ILVGPGENAGVVDLGEGHR-----------
PURL_RHOOB      MWSEHCSYKSSKVHLRYFGE-----------TTTDEMRSSMLAGIGENAGVVDIGDGWA-----------
PURL_METKA      MWSEHCAYR---------------STRHLLRQLPSEADH-VIVGPGDDAAVVA-----------------
PURL_NOSP7      MWSEHCCYK--NSR-------------PLLKQFPTEGPR-ILVGPGENAGVVDLG---------------
PURL_ANASP      MWSEHCCYK------------NSRPLLKQFPTTGPR----ILVGPGENAGVVDLG---------------
PURL_CAMJR      MWSEHCSYK---------------SSKKYLNGFPTKAPW-----------VIQG-------PGENAGVID
PURL_SYNS9      MWSEHCCYR--NSRPLLSGFPTE-------------GPR-ILVGPGENAGVVDLGDGHR-----------
PURL_PYRAR      HWSEHCSYK---------------STRMWLRRLPSRAPWVVRGPGTD-APLVEIA---------------
PURL_SYNPW      MWSEHCCYR--NSR-------------PLLRGFPTDGPR-ILVGPGENAGVVDLGEGHR-----------
PURL_CAMJD      MWSEHCSYK---------------SSKKYLNGFPTKAPW-----------VIQG-------PGENAGVID
PURL_SYNP6      MWSEHCCYK---------------------------NSRPLLSQFPEGLRILVG-------PGENAGVVD
PURL_SYNE7      MWSEHCCYK---------------------------NSRPLLSQFPEGLRILVG-------PGENAGVVD
PURL_HELHP      MWSEHCSYK---------------SSKKYLNGFPTKAPW-----------VVQG-------PGENAGIID
PURL_CAMJE      MWSEHCSYK---------------SSKKYLNGFPTKAPW-----------VIQG-------PGENAGVID
PURL_AGRRK      MWNEHCSYKS-SKKW--------------LRTLPTKGPR-----------VIQGPG--------ENAXXX
PURL_PROMM      MWSEHCCYR--NSR--------------PLLSSFPTSGHRILVGPGENAGVVDLGDGQ------------
PURL_CAMJJ      MWSEHCSYK---------------SSKKYLNGFPTKAPW-----------VIQG-------PGENAGVID
PURL_CAMC5      MWSEHCSYK---------------SSKKYLNGFPTKAPW-----------VIQGPG--------ENXXXX
PURQ_METST      ----------------------------------------------------------------------
PURL_SYNSC      MWSEHCCYR--NSRPLLSGFPTE-------------GPR-ILVGPGENAGVVDLGGGHR-----------
PURQ_SYNP6      ----------------------------------------------------------------------
PURQ_SYNE7      ----------------------------------------------------------------------
PURL_HALLT      LWSEHCAYRSSRPLLSAFESEGDQ----------------VVVGPGDDAAVXXXXXXXXXXXXXXXXXXX
PURL_CAMJ8      MWSEHCSYK---------------SSKKYLNGFPTKAPW-----------VIQG-------PGENAGVID
PURL_PROM3      MWSEHCCYR------------NSRPLLSSFPTTGHR----ILVGPGENAGVVDLGDGQ------------
PURQ_PELUB      ----------------------------------------------------------------------
PURL_CYAP4      MWSEHCCYK------------NSRPLLKQF----PTQGQRVLVGPGENAGVVDLG---------------
PURQ_THERP      ----------------------------------------------------------------------
PURL_PYRCJ      HWSEHCAYK---------------------------STRGRLSRLPSKAPVVKGPGTDAPLVEVAPGLY-
PURQ_SYNY3      ----------------------------------------------------------------------
PURL_THENV      HWSEHCSYK---------------STRRWLRELPGSAPWVVRGRGTD-APLVEVAP----------GLY-
PURL_METMA      LWSEHCSYR------------SSAPLLKTFTTTGE----NVIIGPGDDAAIIK-----------------
PURQ_SALRD      ----------------------------------------------------------------------
PURL_CAUCR      MWSEHCS-------------------YKSSKNQLKKFPI-------DGPRVICGPG--------ENXXXX
PURL_NITSB      MWSEHCSYK---------------SSKKYLKGFPTEAPW-----------VIQG-------PGENAGVID
PURQ_PYRHO      ----------------------------------------------------------------------
PURQ_CARHZ      ----------------------------------------------------------------------
PURL_PROMT      MWSEHCCYR------------NSRPLLKNFPTTGSR----ILVGPGENAGVVDIGFGQR-----------
PURQ_CORAM      ----------------------------------------------------------------------
PURQ_LACAC      ----------------------------------------------------------------------
PURQ_CHLP8      ----------------------------------------------------------------------
PURQ_PYRKO      ----------------------------------------------------------------------
PURQ_EXISA      ----------------------------------------------------------------------
PURQ_EXIS2      ----------------------------------------------------------------------
PURL_SULTO      LWSEHCSYK------------SSKVFLRSFPSEGEKVLMGI-EDWQDAGALDVG----------------
PURQ_SULDN      ----------------------------------------------------------------------
PURL_PROM1      MWSEHCCYR------------NSRPLLKNLPTTGSR----ILVGPGENAGVVDIGFGQR-----------
PURQ_PYRFU      ----------------------------------------------------------------------
PURQ_PYRAB      ----------------------------------------------------------------------
PURQ_MOOTA      ----------------------------------------------------------------------
PURQ_RHIL3      ----------------------------------------------------------------------
PURQ_LACF3      ----------------------------------------------------------------------
PURQ_BREBN      ----------------------------------------------------------------------
PURQ_RHIME      ----------------------------------------------------------------------
PURL_METTP      MWSEHCSYK------------SSRAVLREFLPT--EGPNVVLGPVED------------------AGIVS
PURQ_CHLTE      ----------------------------------------------------------------------
PURQ_PROMT      ----------------------------------------------------------------------
PURQ_COREF      ----------------------------------------------------------------------
PURQ_SYNJA      ----------------------------------------------------------------------
PURQ_ACAM1      ----------------------------------------------------------------------
PURQ_STAAS      ----------------------------------------------------------------------
PURL_METBF      LWSEHCSYR---------------SSAPLLKTFTSKG-ENVIIGPGDDAAIIK-----------------
PURL_LEPBL      MWSEHCSYKNSVLKLKTLPTSSDKLLAK---------------AGEENAGAMDIG---------------
PURL_LEPBJ      MWSEHCSYKNSVLKLKTLPTSSDKLLAK---------------AGEENAGAMDIG---------------
PURQ_THELT      ----------------------------------------------------------------------
PURQ_SYNS9      ----------------------------------------------------------------------
PURQ_STAAW      ----------------------------------------------------------------------
PURQ_STAAN      ----------------------------------------------------------------------
PURQ_STAAM      ----------------------------------------------------------------------
PURQ_STAAC      ----------------------------------------------------------------------
PURQ_STAA8      ----------------------------------------------------------------------
PURQ_STAA3      ----------------------------------------------------------------------
PURQ_HALSA      ----------------------------------------------------------------------
PURQ_BACWK      ----------------------------------------------------------------------
PURQ_SYNSC      ----------------------------------------------------------------------
PURQ_STAAR      ----------------------------------------------------------------------
PURQ_STAAB      ----------------------------------------------------------------------
PURQ_PROMA      ----------------------------------------------------------------------
PURQ_NATPD      ----------------------------------------------------------------------
PURQ_LACLA      ----------------------------------------------------------------------
PURQ_BACHK      ----------------------------------------------------------------------
PURQ_BACC7      ----------------------------------------------------------------------
PURQ_BACC2      ----------------------------------------------------------------------
PURQ_BACC1      ----------------------------------------------------------------------
PURQ_BACC0      ----------------------------------------------------------------------
PURQ_BACAN      ----------------------------------------------------------------------
PURQ_BACAC      ----------------------------------------------------------------------
PURQ_BACAA      ----------------------------------------------------------------------
PURL_LEPIC      MWSEHCSYKNSILKLKTLPTTSDKLLAK---------------AGEENAGAMDIG---------------
PURL_LACSS      MWSEHCSYK---------------------------NSKPILKKFPTNGPVLQG-------PGEGAGILD
PURQ_BACCR      ----------------------------------------------------------------------
PURQ_BACC4      ----------------------------------------------------------------------
PURQ_BACAH      ----------------------------------------------------------------------
PURL_LEPIN      MWSEHCSYKNSILKLKTLPTTSDKLLAK---------------AGEENAGAMDIG---------------
PURQ_SYNPX      ----------------------------------------------------------------------
PURQ_METAC      ----------------------------------------------------------------------
PURQ_HALWD      ----------------------------------------------------------------------
PURQ_STAS1      ----------------------------------------------------------------------
PURQ_PELLD      ----------------------------------------------------------------------
PURQ_NITWN      ----------------------------------------------------------------------
PURQ_NITHX      ----------------------------------------------------------------------
PURQ_METMA      ----------------------------------------------------------------------
PURQ_BRAJA      ----------------------------------------------------------------------
PURQ_BACC3      ----------------------------------------------------------------------
PURQ_WOLSU      ----------------------------------------------------------------------
PURQ_THEEB      ----------------------------------------------------------------------
PURQ_SYNJB      ----------------------------------------------------------------------
PURQ_RHORT      ----------------------------------------------------------------------
PURQ_BACCZ      ----------------------------------------------------------------------
PURQ_BACCQ      ----------------------------------------------------------------------
PURQ_ANAVT      ----------------------------------------------------------------------
PURQ_RHOSR      ----------------------------------------------------------------------
PURQ_BARQU      ----------------------------------------------------------------------
PURQ_AQUAE      ----------------------------------------------------------------------
PURQ_ANASP      ----------------------------------------------------------------------
PURL_METAC      LWSEHCSYR------------SSAPLLKTFTSTGEN----VLIGPGDDAAIIKF----------------
PURQ_RHIEC      ----------------------------------------------------------------------
PURQ_PROMM      ----------------------------------------------------------------------
PURQ_METTH      ----------------------------------------------------------------------
PURQ_LACRJ      ----------------------------------------------------------------------
PURQ_LACRD      ----------------------------------------------------------------------
PURQ_BARHE      ----------------------------------------------------------------------
PURQ_BACCN      ----------------------------------------------------------------------
PURQ_NOCFA      ----------------------------------------------------------------------
PURQ_STRCO      ----------------------------------------------------------------------
PURQ_SILPO      ----------------------------------------------------------------------
PURQ_MYCLE      ----------------------------------------------------------------------
PURQ_LACLC      ----------------------------------------------------------------------
PURQ_JANSC      ----------------------------------------------------------------------
PURQ_DEIGD      ----------------------------------------------------------------------
PURQ_ANOFW      ----------------------------------------------------------------------
PURL_LEPBP      MWSEHCSYKNSILKLKTLPTKSDKLLXXXXXXXXXXMDIG------DGLAVV------------------
PURL_LEPBA      MWSEHCSYKNSILKLKTLPTKSDKLLXXXXXXXXXXMDIG------DGLAVV------------------
PURQ_THETN      ----------------------------------------------------------------------
PURQ_STAES      ----------------------------------------------------------------------
PURQ_STAEQ      ----------------------------------------------------------------------
PURQ_LACPL      ----------------------------------------------------------------------
PURQ_PROAC      ----------------------------------------------------------------------
PURQ_METJA      ----------------------------------------------------------------------
PURQ_OCEIH      ----------------------------------------------------------------------
PURQ_METBF      ----------------------------------------------------------------------
PURQ_PYRAE      ----------------------------------------------------------------------
PURQ_MESSB      ----------------------------------------------------------------------
PURL_PYRIL      HWSEHCSYKST----------------KMWLRELPGSAPWVVRGRGTDAPLVEVAH----------GLY-
PURQ_SULSO      ----------------------------------------------------------------------
PURQ_LISIN      ----------------------------------------------------------------------
PURQ_BRUSU      ----------------------------------------------------------------------
PURQ_BRUME      ----------------------------------------------------------------------
PURQ_BRUAB      ----------------------------------------------------------------------
PURQ_BRUA2      ----------------------------------------------------------------------
PURQ_PROM9      ----------------------------------------------------------------------
PURQ_LACCB      ----------------------------------------------------------------------
PURQ_BACHD      ----------------------------------------------------------------------
PURQ_SILST      ----------------------------------------------------------------------
PURQ_LISW6      ----------------------------------------------------------------------
PURQ_GEOSW      ----------------------------------------------------------------------
PURQ_CORGL      ----------------------------------------------------------------------
PURQ_THET8      ----------------------------------------------------------------------
PURQ_THET2      ----------------------------------------------------------------------
PURQ_LISMH      ----------------------------------------------------------------------
PURQ_LACC3      ----------------------------------------------------------------------
PURQ_NOVAD      ----------------------------------------------------------------------
PURQ_LISMO      ----------------------------------------------------------------------
PURQ_LISMF      ----------------------------------------------------------------------
PURQ_LISMC      ----------------------------------------------------------------------
PURQ_LEIXX      ----------------------------------------------------------------------
PURQ_LACDA      ----------------------------------------------------------------------
PURQ_RHOP2      ----------------------------------------------------------------------
PURQ_MYCPA      ----------------------------------------------------------------------
PURQ_HELHP      ----------------------------------------------------------------------
PURL_HALSA      LWSEHCAYR---------------------------SSRSLLSAFDSDSEXXXXXXXXXXXXXXXPGTDQ
PURL_HALS3      LWSEHCAYR---------------------------SSRSLLSAFDSDSEXXXXXXXXXXXXXXXPGTDQ
PURQ_LACSS      ----------------------------------------------------------------------
PURQ_BACP2      ----------------------------------------------------------------------
PURQ_ALKMQ      ----------------------------------------------------------------------
PURQ_SPHAL      ----------------------------------------------------------------------
PURQ_PROMP      ----------------------------------------------------------------------
PURQ_BACSU      ----------------------------------------------------------------------
PURQ_LYSSC      ----------------------------------------------------------------------
PURL_SALRD      MWSEHCSYKNSTA---------------LLKTLPTEGDQLLAEVGEENAGLVDVGDGKA-----------
PURQ_RHILO      ----------------------------------------------------------------------
PURQ_STAHJ      ----------------------------------------------------------------------
PURQ_RHOPB      ----------------------------------------------------------------------
PURQ_MYCTU      ----------------------------------------------------------------------
PURQ_MYCBO      ----------------------------------------------------------------------
PURQ_GLOVI      ----------------------------------------------------------------------
PURQ_METTP      ----------------------------------------------------------------------
PURQ_DEIRA      ----------------------------------------------------------------------
PURQ_BACA2      ----------------------------------------------------------------------
PURQ_GEOTN      ----------------------------------------------------------------------
PURQ_CHLCH      ----------------------------------------------------------------------
PURQ_BACLD      ----------------------------------------------------------------------
PURQ_SYMTH      ----------------------------------------------------------------------
PURQ_ENTFA      ----------------------------------------------------------------------
PURQ_CAUCR      ----------------------------------------------------------------------
PURQ_THEMA      ----------------------------------------------------------------------
PURQ_LEPIN      ----------------------------------------------------------------------
PURQ_LEPIC      ----------------------------------------------------------------------
PURQ_CORJK      ----------------------------------------------------------------------
PURQ_CAMJE      --------------------------------------------------