[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ftul2:ACD31468.1

[Show Plain Result]


## Summary of Sequence Search
    1::443
    1::443     e-148  61%  453 aa  YEGQ_ECOLI RecName: Full=Uncharacterized protease yegQ;       
    6::448     e-145  59%  460 aa  Y419_HAEIN RecName: Full=Uncharacterized protease HI0419;       
   20::409     6e-59  37%  422 aa  YRRO_BACSU RecName: Full=Uncharacterized protease yrrO;       
    1::333     2e-56  39%  422 aa  Y155_HELPJ RecName: Full=Uncharacterized protease jhp_0155;        
    1::333     3e-56  39%  422 aa  Y169_HELPY RecName: Full=Uncharacterized protease HP_0169;       
    6::403     6e-54  37%  407 aa  Y090_METJA RecName: Full=Uncharacterized protease MJ0090;       
    1::267     6e-38  38%  309 aa  YRRN_BACSU RecName: Full=Uncharacterized protease yrrN;       
    7::355     1e-32  34%  653 aa  YDCP_ECOLI RecName: Full=Uncharacterized protease ydcP;       
   33::277     4e-25  36%  334 aa  PRTC1_PORGI RecName: Full=Collagenase;         EC=3.4.-.-;Flags:
    2::292     2e-23  32%  331 aa  YHBU_ECOLI RecName: Full=Uncharacterized protease yhbU;       
   33::273     2e-19  35%  330 aa  PRTC2_PORGI RecName: Full=Collagenase;         EC=3.4.-.-;Flags:
    1::443

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKRPELLSPAGTLKAMRYAFAYGADAVYIGQPRYSLRARNNEFSKLEILETATTEAHAQGKKIMLANNIA
YEGQ_ECOLI      MFKPELLSPAGTLKNMRYAFAYGADAVYAGQPRYSLRVRNNEFNH-ENLQLGINEAHALGKKFYVVVNIA
Y419_HAEIN      --KPELLSPAGSLKNMRYAFAYGADAVYAGQPRYSLRVRNNEFNHAN-LKIGIDEAHSLGKKFYVVVNIA
YRRO_BACSU      -KKPELLAPAGNLEKLKIAVHYGADAVFIGGQEYGLRSNADNFTIEEIAE-GVEFAKKYGAKIYVTTNIF
Y155_HELPJ      MNQVELLSPAGNLKKLKIALNYGADAVYGGVSHFSLRNRAGKEFTLETFKEGIDYAHALDKKVYATINGF
Y169_HELPY      MNQVELLSPAGNLKKLKIALNYGADAVYGGVSHFSLRNRAGKEFTLETFKEGIDYAHALNKKVYATINGF
Y090_METJA      ----ELLSPANDLTCLKTAIDYGADAVYCGLKELNMRANAKNFTREELIE-GIKYAHDNNKKVYLCTNTV
YRRN_BACSU      MKKPELLTPTSTADILPLIQA-GATAFLVGEQRYGLRLAG-EFSREDVTK-AVEIAHKEGAKVYVAVNAI
YDCP_ECOLI      --RLELLSPARDAAIAREAILHGADAVYIGGPGFG--ARHNASNSLKDIAELVPFAHRYGAKIFVTLNTI
PRTC1_PORGI     ----------------------------------------------------------------------
YHBU_ECOLI      ----ELLCPAGNLPALKAAIENGADAVYIGL-KDDTNARH--FAGLNFTEKKLQEAHQHRRKLHIAINTF
PRTC2_PORGI     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PHNAKIKTYIKDITPVIALKPDAMIMSDPGMIMLVREHFPDQEIHLSVQANAVNYETVRFWQKFGIKRVV
YEGQ_ECOLI      PHNAKLKTFIRDLKPVVEMGPDALIMSDPGLIMLVREHFPEMPIHLSVQANAVNWATVKFWQQMGLTRVX
Y419_HAEIN      PHNSKLKTFIKDLQPVIDMKPDALIMSDPGLIMLVRENFPNIDIHLSVQANAVNWATVKFWKQMGLTRVI
YRRO_BACSU      AHNENLEDYLKALGDANVA---GIIVADPLIIETCRRVAPNVEVHLSTQQSLSNWKAVQFWKEEGLDRVV
Y155_HELPJ      PFNSQLKLLEEHLYKMAELEPDAFIIAAPGVIKLASKIAPHIPVHLSTQANVLNTLDAQVFYDLGVKRIV
Y169_HELPY      PFNSQLKLLEEHIDKMAELEPDAFIIAAPGVVKLALKIAPHIPIHLSTQANVLNLLDAQVFYDLGVKRIV
Y090_METJA      VYENDLKKVEEILDFANSAEVDAVIVSDLGTMQLANEL--GLRVHASVQCNVTNSLTAKFYSKFA-KRVI
YRRN_BACSU      FHNDKVGELGEYLAFLAEAGVDAAVFGDPAVLMAARESAPDLKLHWSTETTGTNYYTCNYWGRKGAARSV
YDCP_ECOLI      LHDDELEPAQRLITDLYQTGVDALIVQDMGILEL---DIPPIELHASTQCDIRTVEKAKFLSDVGFTQIV
PRTC1_PORGI     ------------------------------------------EVHLSTQLNISNAEALRFYSRFA-DVVV
YHBU_ECOLI      AHPDGYARWQRAVDMXXXXXXXXXXXXXXXXXEYAAERYPHIERHVSVQASATNEEAINFYHRFDVARVV
PRTC2_PORGI     ------------------------------------------EVHLSTQLNISNAEALRFWQRAEYGSGT


                         +         .         .         .         .         *         .:210
query           LSRELSLKEIAEIKENVPDMEIETFVHGSLCMAYSGRCLLSGYYSHRDPNQGVCNNACRNNYKVAEAKQN
YEGQ_ECOLI      XXXXXXXXXXXXXXNQVPDMEIEIFVHGALCMAYSGRCLLSGYINKRDPNQGTCTNACRWEYNVQEGKED
Y419_HAEIN      LSRELSIDEIAEIRQQVPDIELEIFVHGALCMAYSGRCLLSGYINKRDPNQGTCTNACRWEYKMEEGTTD
YRRO_BACSU      LARETSALEIREMKEKV-DIEIESFIHGAMCIAYSGRCVLSNHMTARDSNRGGCCQSCR-----------
Y155_HELPJ      CARELSLNDAVEIKKALPDLELEIFVHGSMCFAFSGRCLISALQKGRVPNRGSCANDCRFDYE-------
Y169_HELPY      CARELSLNDAIEIKKALPNLELEIFVHGSMCFAFSGRCLISALQKGRVPNRGSCANDCRFDYE-------
Y090_METJA      LSRELTLNQIKEIRENLKDLELEGFVHGALCVAISGRCFLSSYLFGRHANCGDCLQPCRRKWKLI-----
YRRN_BACSU      LARELNMDSIVEIKENA-EVEIEIQVHGMTCMFQSKRSLIGNYFEYQGKVMDI------------ERKKK
YDCP_ECOLI      LARELNLDQIRAIHQ-ATDATIEFFIHGALCVAYSGQCYISHAQTGRSANRGDCSQACRLPYTLKD----
PRTC1_PORGI     LARELNMDQVRTIHETIVPVRIEMFAHGALCMAVSGKCYLSLHEHNSSANRGACAQICRRGYTV------
YHBU_ECOLI      LPRVLSIHQVKQLARVTP-VPLEVFAFGSLCIMSEGRCYLSSYLTGESPNTGAC----------SPARFV
PRTC2_PORGI     YNRDHRQGHICGPKGH--PVRIEMFAHGALCMAVSGKCYLSLHEHNTSANRGACAQICRRGYTVKDS---


                         .         .         .         +         .         .         .:280
query           EWGDFEPIQTQSTLGIGTPSDKVVLIENDKEPGQYNPMFEDEHGTYIMNSKDLRAIQHVETMMKMGVDCF
YEGQ_ECOLI      DVGNYEPIPVQNTLGIGAPTDKVFMIEEAQRPGEYMTAFEDEHGTYIMNSKDLRAIAHVERLTKMGVHSL
Y419_HAEIN      DVGNIVPIEVKNTLGEGAVTDKVFLYTESQKPDEQMTAFEDKHGTYFMNSKDLRAVQHVEKLTALGVHSL
YRRO_BACSU      -W-DYDLYQTDGANAVA--------------------LYGEEDAPFAMSPKDLKLIESIPKMIEMGIDSL
Y155_HELPJ      -----------------------YYVKNPDNGVMMRLVEEEGVGTHIFNAKDLNLSGHIEILSSNAISAL
Y169_HELPY      -----------------------YYVKNPDNGVMMRLVEEEGVGTHIFNAKDLNLSGHIEILSSNAISAL
Y090_METJA      ---------------------------NEHHDGTYEIVCE---GKYLLSPKDLCMIEHIPELMEV-FDSF
YRRN_BACSU      ESGMF---------------------LHDKERDNKYPIFEDENGTHIMSPNDVCIIDELEELIDAGIDSF
YDCP_ECOLI      ------------------DQGRVVSYEK-----------------HLLSMKDNDQTANLGALIDAGVRSF
PRTC1_PORGI     ---------------------------KDKDSG----LELDIENQYIMSPKDLKTIHFINKMMDAGVRVF
YHBU_ECOLI      RW-------QQTPQGLESRLNEVLIDRQDGENAGYPTLCK---GRYLVDGESLNTLELLPELMAANIASV
PRTC2_PORGI     ----------------GLELD----IENQ----------------YIMSPKDLKTIHFINKMMDAGVRVF


                         .         *         .         .         .         .         +:350
query           KIEGRTKSFFYAARTAQLYDQAIKDALAGKPFDMTLMDKLEGLAHRGYTEGFYRRHVHDEYQKYDNSDSR
YEGQ_ECOLI      KIEGRTKSFYYCARTAQVYRKAIDDAAAGKPFDTSLLETLEGLAHRGYTEGFLRRHTHDDYQNYEYGYSV
Y419_HAEIN      KIEGRTKSFYYCARTAQVYRKAIDDAAAGKPFDESLMDTLESLAHRGYTEGFLRRHTHDEYQNYEYGYSI
YRRO_BACSU      KIEGRMKSIHYVATVVSVYRKVI-DAYCADPENFVILEELDKCANRDTATAFFEGTPGYEEQMF-GEHAK
Y155_HELPJ      KIEGRTKSSYYAAQTTRIYRLAVDDFYHNTLKPSFYASELNTLKNRGFTDGYLMRRPFERLDTQNHQTAI
Y169_HELPY      KIEGRTKSSYYAAQTTRIYRLAVDDFYHNTLKPSFYASELNTLKNRGFTDGYLMRRPFERLDTQNHQTAI
Y090_METJA      KIEGRAKNADYVMRTTKIYREAIDSVLDGSYYDKLFKKELQKVYNRSYDTGFYFRDINKNHDQYEIEGNA
YRRN_BACSU      KIDGVLKMPEYLIEVTKMYREAI-----------------------------------------------
YDCP_ECOLI      KIEGRYKDMSYVKNITAHYRQML-DAIIEERGDLAFVPSTEKTFHRGSTDYFVNARKGD----IGAFDSP
PRTC1_PORGI     KIEGRARGPEYVYTVCRCYKEAI-EAYCNGTYDEEAIEQLATVFNRGFWDGYYLGQRLGEWHRYGSGATR
YHBU_ECOLI      KIEGRQRSPAYVSQVAKVWRQAI-----------------------------------------------
PRTC2_PORGI     KIEGRARGPEYVYTVCRCYKEAI-EAYCNGTYDEESIEQLATVFNRGFWDGYYLGQRLGEWHRYGSGRTR


                         .         .         .         .         *         .         .:420
query           SSTQQFVGEITNFDAHTGYADVNVRNKIKIGDSIELMLPSGSREIILDNMQDKDGKHMEEAKGSGYQAKI
YEGQ_ECOLI      SDRQQFVGEFTG-ERKGDLAAVAVKNKFSVGDSLELMTPQGNINFTLEHMENAKGEAMPIAPGDGYTVWL
Y419_HAEIN      SDRQQFVGEFTGKRNEQGMAEVAVKNKFLLGDNVEMMTPQGNINFKIEKMLNRKNETVDAALGDGH---F
YRRO_BACSU      KTTYDFVGLVLNYDEDTQMVTLQQRNFFKKGDEVEFFGPEENFTHTIETIWDEDGNELDAARHPLQIVKF
Y155_HELPJ      SEGDQVNGEIT-----------------------------------------------------------
Y169_HELPY      SEGDQVNGEIT-----------------------------------------------------------
Y090_METJA      SKYRKIIGRVVNFYKKVSVAEIELWHDLKIGDTILIIKTTGCVEEVVKSMQ-INHKDVEIAK-KGERVGV
YRRN_BACSU      ----------------------------------------------------------------------
YDCP_ECOLI      KFIGLPVGEVVK--VAKDHLDVAVTEPLANGDGLNVLI---KREVV------------------------
PRTC1_PORGI     QKI--YVGKGIKYFSRLGVAEFEIESELHIGD--------------------------------------
YHBU_ECOLI      ----------------------------------------------------------------------
PRTC2_PORGI     QKT--YVGKGIKYFSRLGVAEFEIESELHIGD--------------------------------------


                         .         .         +         .         .         .         .:490
query           KFDNVTAEDMKFALMIKNKSxxx
YEGQ_ECOLI      PVPQDL--ELNYALLMRNFS---
Y419_HAEIN      VFLNVPQDNLNYALLMRN-----
YRRO_BACSU      KLD--------------------
Y155_HELPJ      -----------------------
Y169_HELPY      -----------------------
Y090_METJA      KLNHLVREGDRVYLL--------
YRRN_BACSU      -----------------------
YDCP_ECOLI      -----------------------
PRTC1_PORGI     -----------------------
YHBU_ECOLI      -----------------------
PRTC2_PORGI     -----------------------