[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ftul2:ACD30141.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2dzuB.bssp"
#ERROR : Can't open dsspfile "3c6eA.bssp"
#ERROR : Can't open dsspfile "1d3hA.bssp"
#ERROR : Can't open dsspfile "3ceuB.bssp"
#ERROR : Can't open dsspfile "1al8A.bssp"
#ERROR : Can't open dsspfile "1b3oB.bssp"
#ERROR : Can't open dsspfile "2a4aA.bssp"
#ERROR : Can't open dsspfile "1bwlA.bssp"
#ERROR : Can't open dsspfile "2dzxB.bssp"

## Summary of PDB Search
:248
    1e-05   9%  2dzuB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    3e-05  11%  3c6eA  [x.x.x] ENVELOPE PROTEIN E
    4e-05  17%  1d3hA  [c.1.4] DIHYDROOROTATE DEHYDROGENASE
    1e-04   6%  3ceuB  [x.x.x] THIAMINE PHOSPHATE PYROPHOSPHORYLASE
    1e-04  14%  1al8A  [x.x.x] GLYCOLATE OXIDASE
    3e-04   9%  1b3oB  [c.1.5 - d.37.1 - d.37.1] PROTEIN (INOSINE MONOPHOSPHATE
    3e-04  12%  2a4aA  [x.x.x] DEOXYRIBOSE-PHOSPHATE ALDOLASE
    7e-04   9%  1bwlA  [c.1.4] PROTEIN (NADPH DEHYDROGENASE 1)
    7e-04   9%  2dzxB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
:248

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxLKRIIISPPFGKYLKFKETSNVYGSFTVNRRWGLIKQAIKTIRKIDKNAWRNKIGLRNPGLANTN
2dzuB           -----KDGSLIPYLTAGDQSTLNFLLALDEIELGIPFSDPIADGKTIQESHYRAFKLREAFWIVKEFRRH
3c6eA           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
3ceuB           ----------------------------------------------------------------------
1al8A           ----------------------------------------------------------------------
1b3oB           -----------------------------------------------------KGKLPIVNEDDELVAII
2a4aA           ----------------------------------------------CNESVKTCPFAAAVCVYPKFVKFI
1bwlA           ----------------------------------------------------------------------
2dzxB           ------DGSLIPYLTAGDPSTLNFLLALDEIELGIPFSDPIADGKTIQESHYRALKNGFKLRE-AFWIVK


                         .         .         *         .         .         .         .:140
query           PPKRAQDIISLAALDMSDWHSFAETLKLPKFAQHRNIEINIGCPNASIVDFPAELAPLFEDRNISIKMPP
2dzuB           SSTPIVLMTYYNPIYRAGVRNFLA-----EAKASGVNGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPN
3c6eA           -------------------------------------FQGMRCINRDFVEGVSGGSWVDICVTTMAKNKP
1d3hA           -------------------------------------QERDGLRRVHRPAVLVKIAPDLTSQDKEDIASV
3ceuB           -------IVVTTPTFFVEEDKIITALFE---EGLDILHLRKPETPAYSERLLTLIPEKYHRRIV-THEHF
1al8A           ---------------YKDRNVVAQLVRRAERAGFKAIALTVDTPRLRFVLPPFLTLKNFEGIDLGLIDRS
1b3oB           ARTDLKKNRDYASKDAKKQLLCGAAIGTHEDDKYRLDDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVIG
2a4aA           PFKPKIACVINFPYGTDSMEKVLNDTEKALDDGADEIDLVINYKKIIDEGLKEATKLTQSVKKLLTNKIL
1bwlA           ----------------------------------------IGHEKVGLRLSPYGVFNSMSGGAETGIVAQ
2dzxB           EFRRHSSTPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDPVFHAKEFTEIARAAGIKTVFLAAPNT


                         +         .         .         .         .         *         .:210
query           TVDHNAKIREYLAVGITTFHLCNTIPTAKGGISGYPLHKYSLPAIKKARQEFGDSXXXXXXXXXYTLDDA
2dzuB           TPDERLKVIDDMTTGFVYLVS--------LYGTTEEIPKTAYDLLRRAKRICRN--KVAVGFGVSKREHV
3c6eA           TLDFELIPATLRKYCIEAKLTNTTRCPTQGEPSLNEEQDKRFVCKHSVDRGWGNGCGLFGKGGIVTCAMF
1d3hA           VKELGIDLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDA
3ceuB           YLKEEFNPSEPHDVSCSCHSVEEVKNRKHFYDYVFSPIYSTYTAEELREAQKAKIIDSKVALGGINEDNL
1al8A           LSWKDVAWLQTITSLPILVKGVITAEDARHGARQLDYVPATIMALEEVVKAAQGRIPVFLDGGVRRGTDV
1b3oB           GNVVTAAQAKNLIAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARFGVPVIADGGIQNVGHI
2a4aA           KVIIEVGELAVLNGNADFIKTSTGKVQINATPSSV---EYIIKAIKKNNPEKNNKIGLKVSGGISDLNTA
1bwlA           YAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWK--GPVIRAGNFALHPEV
2dzxB           PDER---LKVIDDMTTGFVYLVS------LYGTTEEIPKTAYDLLRRAKRICR--NKVAVGFGVSKREHV


                         .         .         .         +         .         .         .:280
query           KKYIEAGADHLSLSSIMFNPIRGKKLVKEIVKFWLDDx
2dzuB           VSLLKEGANGVVVSALVKIIEKGREATEFLKKK-----
3c6eA           RCKKNMEGKVVQPENLEY--------------------
1d3hA           LEKIRAGASLVQLYTTFWGPPVVGKVKREL--------
3ceuB           LEIKDFGFGGAVVLGDLWNKFDACLDQNYLAV------
1al8A           FKALALGAAGVFIRPVVFSLAEGEAGVKKVLQMMRDE-
1b3oB           AKALALGASTVMMSLLAATTGEDKGSIHKFVPYLIAG-
2a4aA           SHYILLARRFLSDNFRIGSS------------------
1bwlA           VREEVKDKRTLIGYGRFF--ISNPDLVDRLEK------
2dzxB           VSLLKEGANGVVVSALVKIIGEGREATEFLKKK-----