[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ftul2:ACD30153.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3d4eA.bssp"

## Summary of PDB Search
:118
    5e-08  16%  3d4eA  [x.x.x] PUTATIVE BETA-LACTAMASE INHIBITOR PROTEIN
:118

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxYTAPVPQGKEIKDKKLFEIKPNMTKSEVTYILGSPDIIDTFNPN
3d4eA           --------------------------SNFSFSREAKIGKEDYDELKIGESYKKIVEKLGEPDVLSQSSSD


                         .         .         *         .         .         .         .:140
query           QYVYINTYKRNMQDTQFSESKLILTFNNQDRLIGISGNYxxxxxxxxx
3d4eA           KEEQT--VWSSGIKTKSSSATIELYFEN-GLLKNKTQKD---------