[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ftul2:ACD30267.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "2c95B.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "1akyA.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "3akyA.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "2ax4A.bssp"
#ERROR : Can't open dsspfile "2ax4B.bssp"
#ERROR : Can't open dsspfile "2bwjC.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"

## Summary of PDB Search
:209
    2e-14  14%  1e2mA  [c.37.1] THYMIDINE KINASE
    2e-13  13%  1e2hA  [c.37.1] THYMIDINE KINASE
    8e-13  12%  1e2jA  [c.37.1] THYMIDINE KINASE
    1e-12  12%  1e2lA  [c.37.1] THYMIDINE KINASE
    2e-11  16%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    6e-11  10%  1e2iA  [c.37.1] THYMIDINE KINASE
    6e-10  17%  2c95B  [x.x.x] ADENYLATE KINASE 1
    2e-09  19%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    1e-08  16%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    1e-08  14%  2cdnA  [x.x.x] ADENYLATE KINASE
    3e-08  10%  1e2lB  [c.37.1] THYMIDINE KINASE
    6e-08  12%  1e2nB  [c.37.1] THYMIDINE KINASE
    2e-07  21%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    3e-07  10%  1e2kB  [c.37.1] THYMIDINE KINASE
    7e-07  13%  1e2mB  [c.37.1] THYMIDINE KINASE
    2e-06  14%  1akyA  [x.x.x] ADENYLATE KINASE
    2e-06  15%  1e2nA  [c.37.1] THYMIDINE KINASE
    4e-06  13%  1e2iB  [c.37.1] THYMIDINE KINASE
    6e-06  11%  1e2kA  [c.37.1] THYMIDINE KINASE
    3e-05  16%  3akyA  [x.x.x] ADENYLATE KINASE
    4e-05  11%  1e2hB  [c.37.1] THYMIDINE KINASE
    6e-05  18%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    6e-05  14%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    2e-04  15%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-04  14%  2ax4A  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    5e-04  15%  2ax4B  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    0.001  15%  2bwjC  [x.x.x] ADENYLATE KINASE 5
    0.001  56%  2cckB  [x.x.x] THYMIDYLATE KINASE
:209

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSDSELLM
1e2mA           -TLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVM
1e2hA           -TLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQGEISAGDAAVVMTSAQI
1e2jA           -TLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLSAGDAAVVMTSANI
1e2lA           -TLLRVYIDGPHGMGKTTTTQLLDIVYVPEPWRVLGASETIANIFTTQHRLDQGEISAGDAAVVMTSAQI
2a2zA           -RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFTFQTYACLS
1e2iA           ---LRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASETIANIYTTQHRLD--QGEISAGDAAVVMTSAQI
2c95B           KKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLST------GDLLRSEVSSGSAR--GKKLSEIMEKGQLV
2a2zD           -RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFTFQTYACLS
2a2zB           -RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQM-MYEKPERWSFTFQTYACL
2cdnA           ---MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKL--------GVEAKRYLDAGDLV
1e2lB           ---LRVYIDGPHGMGKTTTTQLLVALGSRDDIPMTYWRVLGASETIANIFTTQHRLDAGDAAVVMTSAQI
1e2nB           -TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVYWRVLGASETIANIYTTQHGEISAGDAAVVMTSAQ
2a30B           -RIKKISIEGNIAAGKSTFV---------NILKWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFTFQTY
1e2kB           -TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVYWRVLGASETIANIYTDQGEISAGDAAVVMTSAQI
1e2mB           ---LRVYIDGPHGMGKTTTTQLLVALGSRDDIPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVM
1akyA           -ESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNM
1e2nA           -TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVM
1e2iB           ---LRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVYWRVLGASETIANIYTDQGEISAGDAAVVMTSAQI
1e2kA           ---LRVYIDGPHGMGKTTTTQLLVADDIVYYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQI
3akyA           -ESIRMVLIGPPGAGKGTQAPNLQERFHAAHLAT--------GDMLRSQIAKGTQLGLEAKKIMDQGGLV
1e2hB           ---LRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVYWRVLGASETIANIRLDQGEISAGDAAVVMTSAQI
1e2fA           ---ALIVLEGVDRAGKSTQSRKLEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSA
2a30A           -RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFTFQTYACLS
1dvrA           ---IRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRS--------QIAKGTQLGLEAKKIMDQGGLV
2ax4A           -RGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKL
2ax4B           -RGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLD-------GDNVRHGL-----NRNLGFSPGDRE
2bwjC           RKCKIIFIIGGPGSGKGTQCEKLVEKYGFT---HLSTGELLREELAESERSKLIRDIMERGDLVPSGI--
2cckB           --SAFITFEGPEGSGKTT----------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDP
1e2mA           TYAVTDAVLAPHIGGEAGSPPALIFDRHPIAALLCYPLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPE
1e2hA           TMGMPYAVTDAVLAPHIGGEATLIFDRHPIAALLCYYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPE
1e2jA           TMGMPYAVTDAVLAGSPPPALTLIFDRHPIAALLCYPLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPE
1e2lA           TMGMPYAVTDAVLAPHIGGEAGLIFDRHPIAALLCYYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPE
2a2zA           RIRAQLASLNGKEKPVLFFERSVYSDRYIFASNLYESECTEWTIYQDDWMNNQFGQSLELDGIIYLQATP
1e2iA           TMGMPYAVTDAVLAPGPPPALTLIFDRHPIAALLCYRYLMGSMTPAVLAFVALIPPTLPGTNIVLGALPE
2c95B           PLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERR---------------IGQPTLLLYVDAGP
2a2zD           RI--RAQLASLNEKPVLFFERSVYSDRYIFASNLYESECEWTIYQDHDWMNNQFGQSLELDGIIYLQATP
2a2zB           SRIRAQLASLNGEKPVLFFERSVYSDRYIFASNLYESECMNTIYQDWHDWMNNQFGQSLELGIIYLQATP
2cdnA           PSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKAL------------HEMLERRGTDIDAVLEFRVSE
1e2lB           TMGMPYAVTDAVLAPHIGGELTLIFDRHPIAALLCYPAMGSMTPQAVLAFVALIPPTLPGTNIVLGALPE
1e2nB           ITMGMPYAVTDAVLAPHIGGEAGSPPALTLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPE
2a30B           ACLSRIRAQLASLNDAEKPVRSVYSDRYIFASNLYESECMTIYQDWHDWMNNQFGQSLELDGIIYLQATP
1e2kB           TMGMPYAVTDAVLAPHIGGEAHPIAALLCYPAARYLMGSMTPQA--VLAFVALIPPTLPGTNIVLGALPE
1e2mB           TSAQITMGMPYAVTDAVLPALTLIFDRHPIAALLCYPAAGSMTPQAVLAFVALIPPTLPGTNIVLGALPE
1akyA           IKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEELLVARITGRLIHPASGRSYHKIFN-PP
1e2nA           PYAVTDAVLAPHIGGEAGSPPALIFDRHPIAALLCYPAAGSMTPQAVLAFVALIPPTLPGTNIVLGALPE
1e2iB           TMGMPYEAHAPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQA--VLAFVALIPPTLPGTNIVLGALPE
1e2kA           TMGMPYAVTDAVLAPHIGGELTLIFDRHPIAALLCYARYLMGSMTPQAVLAFVALITLPGTNIVLGALPE
3akyA           SDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTP-----------LEKAIELKVDD
1e2hB           TMGMPYAVTDAVLAPHIGGEAGLIFDRHPIAALLCYPAAGSMTPQAVLAFVALIPPTLPGTNIVLGALPE
1e2fA           NRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGL-------PKPDLVLFLQLQL
2a30A           RIRAQLASLNGKLKDAEKPVSDRYIFASNLYESECMNETEWTIYQWHDWMNNQFGQSLELDGIIYLQATP
1dvrA           SDDIMVNMIKDELTNNPACKNGFILVGFPRTIPQAEGTPLEKAIELKRITGRLIHPASGRSYHKIFNKDD
2ax4A           FADAGLVCITSFISPFAK-------DRENARKIHESAG--------------------LPFFEIFVDAPL
2ax4B           ENIRRIAEVAKLFADA---GLVCITSF---------ISPFAKDRENARKIHE---SAGLPFFEIFVDAPL
2bwjC           ----VLELLKEAMVASLGDTRGFLID--GYPREVKQGEEFGRRIGDPQLVICMDCSADTM------TNRL
2cckB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSDNAIEIDAAKSIQEVEKQIYLILDKHFNxxx
1e2mA           DRHIDRLAKRQ--RPGERLDLAMLAAIRRVYGLRYLQCGGSWREDW-----------------------
1e2hA           DRHIDRLAKRQ--RPGERLDLAMLAAIRRVYGLLA----------------------------------
1e2jA           DRHIDRLAKRQ--RPGERLDLAMLAAIRRVYGLLA----------------------------------
1e2lA           DRHIDRLAKRQ--RPGERLDLAMLAAIRRVYGLLA----------------------------------
2a2zA           ETCLHRIYLRGRNEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLS---
1e2iA           DRHIDRLAKRQ--RPGERLDLAMLAAIRRVYQCGGSWREDWGQLSGTGPRPHIGDTLFTLFRAP-----
2c95B           ETMTQRLLKRGETSGRVDDNEETIKKRLETYYAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALLN---
2a2zD           ETCLHRIYLRGRNQGIPLEYLEKLHYKHESWLLHRLQEVPILTLDVNEDFKDKYESLVEKVKEFLS---
2a2zB           ETCLHRIYLRGRNQGIPLEYLEKLHYKHESWLLHRLQEVPILTLDVNEDFKDKYESLVEKVKEFLS---
2cdnA           EVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQKTVDAVGTMDEVFARALRALGK------
1e2lB           DRHIDRLAKRLDLAMLAA---------------------------------------------------
1e2nB           D---------RHIDRLAKLDLAMLAAIRRVYGLLANTVRYLQCGGS-----------------------
2a30B           ETCLHRIYLRGRNQGIPLEYLEKLHYKHESTNFDYLQEVPILTLDVNE-YESLVEKVKEFLST------
1e2kB           DRHIDRLAKRERVYGLLANTVRYLQCGGSWREDWGQLSGTAVPQSNAGPRPHIGDTLFTLF--------
1e2mB           DRHIDRLA--------KRLDLAMLAAIRRVYGLLA----------------------------------
1akyA           KEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQTEPTGIWAGVDASQPPATVWADILNKLGKN-----
1e2nA           DRHIDRLAKRQ--RPGERLDLAMLAAIRRVYGLLA----------------------------------
1e2iB           DRHIDRLAKRERLD------LAMLAAIRRVYGLL-----------------------------------
1e2kA           DRHIDRLAKRQ--RPGERLDLAMLAAIRRVYGLLASWREDWGQLSGTGPRPHIGDTLFTLFR-------
3akyA           ELLVARITGVQRSDDNADALKKRLAAYHAQTEPIVKKTGIWAGVDASQPPATVWADFLNKLGK------
1e2hB           DRHIDRLAKRLDLAMLAA---------------------------------------------------
1e2fA           ADAAKRGAFGHERYENGAFQERALRCFHQLMKDT---TLNWKMVDASKSIEAVHEDIRVLSED------
2a30A           ETCLHYLRGRNEEQGIPLEYLEKLHYKHESTNFDYLQEVPILTLDVNE-YESLVEKVKEFLST------
1dvrA           VTGEALVQISDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADILNKLGKN-----
2ax4A           NICESRDVK-GLYKRARAGEIKGFTGIDSDYEKPETP---ERVLKTNLTVSDCVHQVVELLQEQ-----
2ax4B           NICESRDVK-GLYKRARAGEIKGFTGIDSDYEKPETP---ERVLKTNLTVSDCVHQVVELLQEQ-----
2bwjC           LQMSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINAEGTPEDVFLQLCTAIDSIF----
2cckB           ---------------------------------------------------------------------