[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ftul2:ACD30290.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ddqD.bssp"
#ERROR : Can't open dsspfile "2e2hA.bssp"
#ERROR : Can't open dsspfile "2e2iA.bssp"
#ERROR : Can't open dsspfile "3cqzA.bssp"
#ERROR : Can't open dsspfile "2a6hD.bssp"
#ERROR : Can't open dsspfile "3dxjD.bssp"
#ERROR : Can't open dsspfile "2aukE.bssp"
#ERROR : Can't open dsspfile "2eabB.bssp"
#ERROR : Can't open dsspfile "2a9gB.bssp"
#ERROR : Can't open dsspfile "1eexA.bssp"
#ERROR : Can't open dsspfile "3e0sB.bssp"
#ERROR : Can't open dsspfile "3e0sA.bssp"
#ERROR : Can't open dsspfile "2aujD.bssp"
#ERROR : Can't open dsspfile "2ab4A.bssp"
#ERROR : Can't open dsspfile "3dtzC.bssp"
#ERROR : Can't open dsspfile "3brpB.bssp"
#ERROR : Can't open dsspfile "2aukB.bssp"
#ERROR : Can't open dsspfile "2aukA.bssp"
#ERROR : Can't open dsspfile "2b8kD.bssp"
#ERROR : Can't open dsspfile "2aukC.bssp"
#ERROR : Can't open dsspfile "2d5cB.bssp"
#ERROR : Can't open dsspfile "2ckzC.bssp"
#ERROR : Can't open dsspfile "1ci3M.bssp"
#ERROR : Can't open dsspfile "3e7hA.bssp"
#ERROR : Can't open dsspfile "3e7hB.bssp"
#ERROR : Can't open dsspfile "3csqD.bssp"
#ERROR : Can't open dsspfile "2e74C.bssp"
#ERROR : Can't open dsspfile "3cuxA.bssp"
#ERROR : Can't open dsspfile "3bboX.bssp"
#ERROR : Can't open dsspfile "1cfmA.bssp"
#ERROR : Can't open dsspfile "3dqyA.bssp"
#ERROR : Can't open dsspfile "2cbiA.bssp"
#ERROR : Can't open dsspfile "2b0pA.bssp"
#ERROR : Can't open dsspfile "2b13A.bssp"
#ERROR : Can't open dsspfile "2b44A.bssp"
#ERROR : Can't open dsspfile "3csqA.bssp"
#ERROR : Can't open dsspfile "3bmaB.bssp"
#ERROR : Can't open dsspfile "1e2vA.bssp"
#ERROR : Can't open dsspfile "1e2zA.bssp"
#ERROR : Can't open dsspfile "2c35A.bssp"
#ERROR : Can't open dsspfile "3dsoA.bssp"
#ERROR : Can't open dsspfile "2aukE.bssp"
#ERROR : Can't open dsspfile "2aujD.bssp"
#ERROR : Can't open dsspfile "2aukA.bssp"
#ERROR : Can't open dsspfile "2aukC.bssp"

## Summary of PDB Search
:1417
      0.0  45%  1ddqD  [x.x.x] DNA-DIRECTED RNA POLYMERASE
      0.0  19%  2e2hA  [x.x.x] DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
      0.0  19%  2e2iA  [x.x.x] DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
      0.0  18%  3cqzA  [x.x.x] DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
      0.0  38%  2a6hD  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN
      0.0  37%  3dxjD  [x.x.x] BACTRIAL RNA POLYMERASE BETA-PRIME SUBUNIT
    1e-44  37%  2aukE  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN
    1e-35   9%  2eabB  [x.x.x] ALPHA-FUCOSIDASE
    7e-32  10%  2a9gB  [x.x.x] ARGININE DEIMINASE
    4e-30   7%  1eexA  [c.1.19] PROPANEDIOL DEHYDRATASE
    3e-28  11%  3e0sB  [x.x.x] UNCHARACTERIZED PROTEIN
    1e-27  10%  3e0sA  [x.x.x] UNCHARACTERIZED PROTEIN
    7e-24  11%  2aujD  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN
    3e-22  11%  2ab4A  [x.x.x] TRNA PSEUDOURIDINE SYNTHASE B
    5e-22  10%  3dtzC  [x.x.x] PUTATIVE CHLORITE DISMUTASE TA0507
    7e-22  13%  3brpB  [x.x.x] C-PHYCOCYANIN BETA CHAIN
    9e-21  37%  2aukB  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN
    1e-18  38%  2aukA  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN
    4e-18  10%  2b8kD  [x.x.x] DNA-DIRECTED RNA POLYMERASE II 32 KDA
    4e-18  37%  2aukC  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN
    8e-18  17%  2d5cB  [x.x.x] SHIKIMATE 5-DEHYDROGENASE
    1e-16  10%  2ckzC  [x.x.x] DNA-DIRECTED RNA POLYMERASE III 18 KD
    3e-16  17%  1ci3M  [b.2.6 - b.84.2] PROTEIN (CYTOCHROME F)
    9e-16  18%  3e7hA  [x.x.x] DNA-DIRECTED RNA POLYMERASE SUBUNIT BETA
    1e-15  18%  3e7hB  [x.x.x] DNA-DIRECTED RNA POLYMERASE SUBUNIT BETA
    1e-14  10%  3csqD  [x.x.x] MORPHOGENESIS PROTEIN 1
    2e-12  12%  2e74C  [x.x.x] APOCYTOCHROME F
    5e-12  16%  3cuxA  [x.x.x] MALATE SYNTHASE
    1e-11  16%  3bboX  [x.x.x] RIBOSOMAL PROTEIN L27
    1e-10  14%  1cfmA  [b.2.6 - b.84.2] CYTOCHROME F
    6e-10   9%  3dqyA  [x.x.x] TOLUENE 1,2-DIOXYGENASE SYSTEM FERREDOXIN
    7e-10   4%  2cbiA  [x.x.x] HYALURONIDASE
    1e-08  16%  2b0pA  [x.x.x] GLYCYL-GLYCINE ENDOPEPTIDASE LYTM
    8e-08  19%  2b13A  [x.x.x] GLYCYL-GLYCINE ENDOPEPTIDASE LYTM
    1e-07  19%  2b44A  [x.x.x] GLYCYL-GLYCINE ENDOPEPTIDASE LYTM
    1e-05  12%  3csqA  [x.x.x] MORPHOGENESIS PROTEIN 1
    1e-05  11%  3bmaB  [x.x.x] D-ALANYL-LIPOTEICHOIC ACID SYNTHETASE
    2e-05  18%  1e2vA  [b.2.6 - b.84.2] CYTOCHROME F
    2e-05  19%  1e2zA  [b.2.6 - b.84.2] CYTOCHROME F
    2e-05  13%  2c35A  [x.x.x] DNA-DIRECTED RNA POLYMERASE II 16 KDA
    3e-04  21%  3dsoA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN COPK
    5e-05  22%  2aukE  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN(query 1163->1272)
    8e-07  22%  2aujD  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN(query 1163->1209)
    4e-13  16%  2aukA  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN(query 1134->1301)
    8e-09  17%  2aukC  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN(query 1139->1301)
:1417

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxGILHQNYNSKKFDIIKISLASPEVIRSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
1ddqD           ----------------------------------------------------------------------
2e2hA           ------------RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQC
2e2iA           ---GQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQT
3cqzA           ------------RTVKEVQFGLFSPEEVRAISVAKIRFPETAKIGGLNDPRLGSIDRNLKCQT------C
2a6hD           ----------------------------------------------------------------------
3dxjD           ---------------------------------------------------------YLTLFLEWTEP--
2aukE           ----------------------------------------------------------------------
2eabB           ----------------------------------------------------------------------
2a9gB           ----------------------------------------------------------------------
1eexA           ----------------------------------------------------------------------
3e0sB           ----------------------------------------------------------------------
3e0sA           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2ab4A           -------------EYDQVPPAYSAKKYKGERLYKLAREGKIINLPPKRVKIFKIWDVNIEGRDVSFRVEV
3dtzC           ----------------------------------------------------------------------
3brpB           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2b8kD           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2d5cB           ----------------------------------------------------------------------
2ckzC           ----------------------------------------------------------------------
1ci3M           ----------------------------------------------------------------------
3e7hA           ----------------------------------------------------------------------
3e7hB           ----------------------------------------------------------------------
3csqD           ----------------------------------------------------------------------
2e74C           ----------------------------------------------------------------------
3cuxA           ----------------------------------------------------------------------
3bboX           ----------------------------------------------------------------------
1cfmA           ----------------------------------------------------------------------
3dqyA           ----------------------------------------------------------------------
2cbiA           ---------------------------------------------------------DDPYHREKWREPY
2b0pA           ----------------------------------------------------------------------
2b13A           ----------------------------------------------------------------------
2b44A           ----------------------------------------------------------------------
3csqA           ----------------------------------------------------------------------
3bmaB           ----------------------------------------------------------------------
1e2vA           ----------------------------------------------------------------------
1e2zA           ----------------------------------------------------------------------
2c35A           ----------------------------------------------------------------------
3dsoA           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GKYKRLKHXXXXXXXXXXXXXQAKVRRERMGHIDLVCPVVHIWYLKSLPSRIGLFLDMPLKNVEKVLYFE
1ddqD           ----------------------------------------------------------------------
2e2hA           QEGM-------------------NECPGHFGHIDLAKPVFHVGFIAKIKKVVCMHCGKLLLDEHNELMRQ
2e2iA           CQEGM------------------NECPGHFGHIDLAKPVFHVGFIAKIKKVVCMHCGKLLLDEHNELMRQ
3cqzA           QEGM-------------------NECPGHFGHIDLAKPVFHVGFIAKVCECVCMHCGKLLLDEHNELMRQ
2a6hD           ---------------------------------------------------------SILVVKARVYPFE
3dxjD           -KDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASI---LVVK----ARVYPFE
2aukE           ----------------------------------------------------------------------
2eabB           ----------------------------------------------------------------------
2a9gB           ----------------------------------------------------------------------
1eexA           ----------------------------------------------------------------------
3e0sB           ----------------------------------------------------------------------
3e0sA           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2ab4A           SPGTYISLCMDIGYKLGCGATAVELVRESVGPHTIEESLNVFEAAP-------EEIENRIIPLEKCLEWL
3dtzC           ----------------------------------------------------------------------
3brpB           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2b8kD           --------------------------------------------------------EFQLKQINHQGEEE
2aukC           ----------------------------------------------------------------------
2d5cB           ----------------------------------------------------------------------
2ckzC           ----------------------------------------------------------------------
1ci3M           ----------------------------------------------------------------------
3e7hA           ----------------------------------------------------------------------
3e7hB           ----------------------------------------------------------------------
3csqD           ----------------------------------------------------------------------
2e74C           ----------------------------------------------------------------------
3cuxA           ----------------------------------------------------------------------
3bboX           ----------------------------------------------------------------------
1cfmA           ----------------------------------------------------------------------
3dqyA           ----------------------------------------------------------------------
2cbiA           PESEMMQELINASAENKVDFVFGISPGIDIRFFNHLITKAESLYDMGVRSFAIYWDDIQDKSAAKHAQVL
2b0pA           ----------------------------------------------------------------------
2b13A           ----------------------------------------------------------------------
2b44A           ----------------------------------------------------------------------
3csqA           ----------------------------------------------------------------------
3bmaB           ------------------------------------------------------FLKHQSGDQA-SQYAA
1e2vA           ----------------------------------------------------------------------
1e2zA           ----------------------------------------------------------------------
2c35A           ----------------------------------------------------------------------
3dsoA           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SYIVTDPGMTPLEKKQLLTDEEYAEALENYGYEFEASMGAEAIRDLLADTDIESEIELLQXXXXXXXXXX
1ddqD           ----------------------------------------------------------------------
2e2hA           ALAIKDSKKRFAAIWTLCKTKMVCE--TDVPSELVSRGGCGNTQPTIRKDGLKLVGSWLRVLSTEEILNI
2e2iA           ALAIKDSKIWTLCKTKMVCETDVPS--EDDPTQLVSRGGCGNTQPTIRKDGLKLVGSWKLRVLSTEEILN
3cqzA           ALAIKDSKKWTLCKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDGLKLVGSWKKELRVLSTEEILN
2a6hD           DDVEVSTG-DRVAPGDVLADGGK-VKSDVYGYDIDARMGAEAIQQLLKELDLEAEKELLEEMKHPSRARR
3dxjD           DDVEVSTG-DRVAPGDVLADGGKVKSDVYESYDIDARMGAEAIQQLLKELDLEAEKELLEEMKHPSRARR
2aukE           ----------------------------------------------------------------------
2eabB           ----------------------------------------------------------------------
2a9gB           ----------------------------------------------------------------------
1eexA           ----------------------------------------------------------------------
3e0sB           --VFDPEKTAWMLAGKRTNDLRDSDVYLLRREEYTSLLPPSLRPALDPFFSLEADKRL------------
3e0sA           --VFDPEKTAWMLAGKRTNDLRDSDVYLLRREEYTSLLPPSLRPALDPFFSDLEA-----------DKRL
2aujD           ----------------------------------------------------------------------
2ab4A           PRVVVHQESKMILNGSQIHLEMLKEWDGFKKGEVVRVFNEEGRLLALAEAERNSSF--------------
3dtzC           ----------------------------------------------------------------------
3brpB           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2b8kD           ELIALNLSEARLVIKALVERRRAFKRSQKKFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFS
2aukC           ----------------------------------------------------------------------
2d5cB           ----------------------------------------------------------------------
2ckzC           --------MKVLERNAFLSDYEVLKFLTDLEKKHLWDQKSLAALRPYNHPELQGITRNV-VNYLSIISKM
1ci3M           ----------------------------------------------------------------------
3e7hA           ----------------------------------------------------------------------
3e7hB           ----------------------------------------------------------------------
3csqD           ----------------------------------------------------------------------
2e74C           ----------------------------------------------------------------------
3cuxA           ----------------------------------------------------------------------
3bboX           ----------------------------------------------------------------------
1cfmA           ----------------------------------------------------------------------
3dqyA           ----------------------------------------------------------------------
2cbiA           NRFNEEFVKAKGDVKPLITVPTEYDTGAMVSNGQPRAYTRIFAETVDPSIEVMWGPGVVTNEIPLSDAQL
2b0pA           ----------------------------------------------------------------------
2b13A           ----------------------------------------------------------------------
2b44A           ----------------------------------------------------------------------
3csqA           ----------------------------------------------------------------------
3bmaB           TRLLQQFPNVAMKDLQKLASKEELSTADNEMIEL-LARFNERQASFFGQFSVRGYVNYDKHVAKYLKILP
1e2vA           ----------------------------------------------------------------------
1e2zA           ----------------------------------------------------------------------
2c35A           ---------------------EEDASQLIFPKEFETLLNSEVHMLLEHNESAEDEQELSEVFMKTLNYTA
3dsoA           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXIKRLRLLETFQASGNKPEWMVMTXXXXXXXXXXXXXXIEGGRFATSDLNDLYXXXXXXXXXXXXX
1ddqD           ------------------GNRPEWMILEAVPVLPPD-----------FATSDLNDLYRRLINRNNRLKKL
2e2hA           FKHI-SVKDFTSLGFNEVFSRPEWMILTCLPVPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETL
2e2iA           IFKHISVKDFTSLGFNEVFSRPEWMILTCLPVPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETL
3cqzA           IFKHISVKDFTSLGFNEVFSRPEWMILTCLPVPPPPVRPTFKLA--------------------------
2a6hD           AKAR--KRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKL
3dxjD           AKAR--KRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKL
2aukE           ----------------------------------------------------------------------
2eabB           ----------------------------------------------------------------------
2a9gB           ----------------------------------------------------------------------
1eexA           ----------------------------------------------------------------------
3e0sB           HHRQFCRYLTGREYSGFMTSLKEFIAEGELPDPETAPLAAE--PTGDVAAKTIRKALKKVLVHGRSDAEL
3e0sA           HHRQFCRYLTGREYSGFMTSLKEFIAEG--ELPDPETAPLAAEPTGDVAAKTIRKALKKVLVHGRSDAEL
2aujD           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
3dtzC           ----------------------------------------------------------------------
3brpB           ---------------------------------------------GEFLNTQLDALSKMVSEGNKRLD--
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2b8kD           RFRDQETVGAVIQLLKSTGLHPVAQLGSLACDTADEAKTLIPSLNNKISDDELERIL-------------
2aukC           ----------------------------------------------------------------------
2d5cB           ----------------------------------------------------------------------
2ckzC           SDESFAELMTKLNSFKLF-KAEKLQIVNQLPANMVHLYSIVEECDARFDEKTIEEML-------------
1ci3M           ----------------------------------------------------------------------
3e7hA           ----------------------------------------------------------------------
3e7hB           ----------------------------------------------------------------------
3csqD           ----------------------------------------------------------------------
2e74C           ----------------------------------------------------------------------
3cuxA           ----------------------------------------------------------------------
3bboX           ----------------------------------------------------------------------
1cfmA           ----------------------------------------------------------------------
3dqyA           ----------------------------------------------------------------------
2cbiA           ISGIYNRNMAVWWNYPVTDYFKGKLAL-------------------------------------------
2b0pA           ----------------------------------------------------------------------
2b13A           ----------------------------------------------------------------------
2b44A           ----------------------------------------------------------------------
3csqA           ----------------------------------------------------------------------
3bmaB           DQFSYIEDVVKADAEKNTSNNEMGMENY------------------------------------------
1e2vA           ----------------------------------------------------------------------
1e2zA           ----------------------------------------------------------------------
2c35A           RFSRFKNIASVRSLLLQKKLHELACLANLCPETAEESKALIPSLEGRFEDEELQQIL-------------
3dsoA           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           XXXXAPDIIVRNEKRMLQEAVDALLDNGRRGRAVTGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGR
1ddqD           LAQGAPEIIIRNEKRMLQEAVDAVIDNGRRGSPVTNPSERPLRSLTDILSGKQGRFRQNLLGKRVDYSGR
2e2hA           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQP---QAGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
2e2iA           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQLQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
3cqzA           ------DILKANI--SLETLEH--------------------NGAPHHAIEEAESLLQFHVATYMDFSAR
2a6hD           LAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGR
3dxjD           LAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGR
2aukE           ----------------------------------------------------------------------
2eabB           ----------------------------------------------------------------------
2a9gB           ----------------------------------------------------------------------
1eexA           ----------------------------------------------------------------------
3e0sB           HELRID----CKKLRYLLEFFASLFPPKATAQVL-----RQMKTLQDNLGTFVDLQMEFLQSRLETISEA
3e0sA           HELRID----CKKLRYLLEFFASLFPPKATAQVL-----RQMKTLQDNLGTFVTVQMEFLQSRLETISEA
2aujD           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
3dtzC           ----------ADTRSLDRRSIDEFFSANHIYRSYRTDSDVIFWYSSRNPDLILAKERVQASRPIAVSSFS
3brpB           ----VVNRITSNASAIVTNAARALFSEQPQLIQPGGAEIILRYVSYAIIAGDSSVLDDRCLNQALGVPGA
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2b8kD           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2d5cB           ----------------------------------------------------------------------
2ckzC           ----------------------------------------------------------------------
1ci3M           ----------------------------------------------------------------------
3e7hA           ----------------------------------------------------------------------
3e7hB           ----------------------------------------------------------------------
3csqD           ----------------------------------------------------------------------
2e74C           ----------------------------------------------------------------------
3cuxA           ----------------------------------------------------------------------
3bboX           ----------------------------------------------------------------------
1cfmA           ----------------------------------------------------------------------
3dqyA           ----------------------------------------------------------------------
2cbiA           ----------------------------------------------------------------------
2b0pA           ----------------------------------------------------------------------
2b13A           ----------------------------------------------------------------------
2b44A           ----------------------------------------------------------------------
3csqA           ----------------------------------------------------------------------
3bmaB           ----------------------------------------------------------------------
1e2vA           ----------------------------------------------------------------------
1e2zA           ----------------------------------------------------------------------
2c35A           ----------------------------------------------------------------------
3dsoA           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SVITVGPSLRLHECGLPKKMALELFKPFVYSKLRLGGHATTIKQAKRMVELEEAVVWDILETVINEHPVL
1ddqD           SVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKAFAPNVKAARRMLERQRDIVWDALEEVIHGKVVL
2e2hA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
2e2iA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNISGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
3cqzA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
2a6hD           SVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIVWDALEEVIHGKVVL
3dxjD           SVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIVWDALEEVIHGKVVL
2aukE           ----------------------------------------------------------------------
2eabB           ----------------------------------------------------------------------
2a9gB           --------------------------------------------------------AGKLRKVMVCSPGL
1eexA           ----------------------------------------------------------------------
3e0sB           AAIGGLLTTLYRKREKVREHFHEIFSGFDSNETG------------------------------------
3e0sA           AAIGGLLTTLYRKREKVREHFHEIFSGFDSNETG------------------------------------
2aujD           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
3dtzC           SISIYDKKLEDSLRLPPLRYF--VAYPSKTPDWYLLDFDTRKEIHEHIKALNH-----------------
3brpB           SVAVGVEKMKDSAIAIANDPSGITTGDCSALMAEVGTYFDRAATA-------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2b8kD           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2d5cB           ------------------------------------------------------------------HPVA
2ckzC           ----------------------------------------------------------------------
1ci3M           ----------------------------------------------------------------------
3e7hA           ----------------------------------------------------------------------
3e7hB           ----------------------------------------------------------------------
3csqD           ----------------------------------------------------------------------
2e74C           ----------------------------------------------------------------------
3cuxA           ----------------------------------------------------------------------
3bboX           ----------------------------------------------------------------------
1cfmA           ----------------------------------------------------------------------
3dqyA           --------------------------------------------------QGDLPPGEMQRYEGGPEPVM
2cbiA           ----------------------------------------------------------------------
2b0pA           ----------------------------------------------------------------------
2b13A           ----------------------------------------------------------------------
2b44A           ----------------------------------------------------------------------
3csqA           ----------------------------------------------------------------------
3bmaB           ----------------------------------------------------------------------
1e2vA           ----------------------------------------------------------------------
1e2zA           ----------------------------------------------------------------------
2c35A           ----------------------------------------------------------------------
3dsoA           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LNRAPTLHRLGIQAFEPRLIEGKAIQLHPLVCAAFNADFDGDQMAVHVPLTVESQLEARVLMMSTNNILS
1ddqD           LNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLS
2e2hA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
2e2iA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
3cqzA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
2a6hD           LNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLS
3dxjD           LNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLS
2aukE           ----------------------------------------------------------------------
2eabB           ----------------------------------------------------------------------
2a9gB           AHQRLTPSNCDELLFDDVIWVNQAKRDHF----DFVTKMRERGIDVLEMHNLLTETIQNPEAL--KWILD
1eexA           ----------------------------------------------------------------------
3e0sB           ----------------------------------------------------------------------
3e0sA           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
3dtzC           ----------------------------------------------------------------------
3brpB           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2b8kD           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2d5cB           HSLSPAMHALGLEGS-YEAWDTPLEALPGRLKE-VRRAFRG--VNLTLPLKEAALVSPEAQRIGAVNTVL
2ckzC           ----------------------------------------------------------------------
1ci3M           ----------------------------------------------------------------------
3e7hA           ----------------------------------------------------------------------
3e7hB           ----------------------------------------------------------------------
3csqD           ----------------------------------------------------------------------
2e74C           ----------------------------------------------------------------------
3cuxA           ----------------------------------------------------------------------
3bboX           ----------------------------------------------------------------------
1cfmA           ----------------------------------------------------------------------
3dqyA           VNVDGEFFAVQDTCHGDWALSDGYLDGDIVECTLHFGKFVRTGKVKALP---------------------
2cbiA           ----------------------------------------------------------------------
2b0pA           ----------------------------------------------------------------------
2b13A           ----------------------------------------------------------------------
2b44A           ----------------------------------------------------------------------
3csqA           ----------------------------------------------------------------------
3bmaB           ----------------------------------------------------------------------
1e2vA           ----------------------------------------------------------------------
1e2zA           ----------------------------------------------------------------------
2c35A           ----------------------------------------------------------------------
3dsoA           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           PASGQPIITPTQDIVLGLYYITREKEGARGEGKLFSSYEDVSRAYNSGTIDIHAKIKLRIDRQVFDTKGN
1ddqD           PASGEPLAKPSRDIILGLYYITQVRKEKKGAGMAFATPEEALAAYERGEVALNAPIVVAVGRLKFQDVVT
2e2hA           PQSNKPCMGIVQDTLCGIRKLTLRDWVPDWDGVIPTPAIIKPKPLWSGKQILSVAIPNGI------HLQR
2e2iA           PQSNKPCMGIVQDTLCGIRKLTLRDTVPDWDGVIPTPAIIKPKPLWSGKQILSVAIPNGIH---LQRFDE
3cqzA           PQSNKPCMGIVQDTLCGIRKLTLRDWVPDWDGVIPTPAIIKPKPLWSGKQILSVAIPNGI------HLQR
2a6hD           PASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPRETSVGRLKYVFVVT
3dxjD           PASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRVVT
2aukE           ----------------------------------------------------------------------
2eabB           ----------------------------------------------------------------------
2a9gB           RKITADSVGLGLTSELRSWLESLEPRKLAEYLIGGVAADDLPASEGANILK-MYREYLGHSSFLLPPLPN
1eexA           ----------------------------------------------------------------------
3e0sB           ----------------------------------------------------------------------
3e0sA           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
3dtzC           ----------------------------------------------------------------------
3brpB           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2b8kD           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2d5cB           QVEGRLF----GFNTDAPGFLEALKAG-------------------------------------------
2ckzC           ----------------------------------------------------------------------
1ci3M           ----------------------------------------------------------------------
3e7hA           ----------------------------------------------------------------------
3e7hB           ----------------------------------------------------------------------
3csqD           ----------------------------------------------------------------------
2e74C           ----------------------------------------------------------------------
3cuxA           ----------------------------------------------------------------------
3bboX           ----------------------------------------------------------------------
1cfmA           ----------------------------------------------------------------------
3dqyA           ----------------------------------------------------------------------
2cbiA           ----------------------------------------------------------------------
2b0pA           ----------------------------------------------------------------------
2b13A           ----------------------------------------------------------------------
2b44A           ----------------------------------------------------------------------
3csqA           ----------------------------------------------------------------------
3bmaB           ----------------------------------------------------------------------
1e2vA           ----------------------------------------------------------------------
1e2zA           ----------------------------------------------------------------------
2c35A           ----------------------------------------------------------------------
3dsoA           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           TYNEKGVVNTTVGRALLLNILPEGLSFSLLNKVLVKKEISKIINQAFRVLGGKATVVLADKLMYAGFKYS
1ddqD           VRYLGRRLETNPGRILFARIVGEAVGDEKVAQELIKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTLS
2e2hA           FDEGTTLLSPKDNGML---IIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
2e2iA           GTTLLSPKDNGM------LIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
3cqzA           FDEGTTLLSPKDNG---MLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
2a6hD           VRYMGKRLETSPGRILFARIVAVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFS
3dxjD           VRYMGKRLETSPGRILFARIVAEAVEDEKLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFS
2aukE           ----------------------------------------------------------------------
2eabB           -----------------------------------DGDTSKDDWLWYKQP--ASQTDATATAGGNYGNRW
2a9gB           TQFTRDTTCWIYGGVTLNPMYWPA-----------RRQETLLTTAIYKFHPEFANAE--FEIWYGDPDKD
1eexA           ----------------------------VTELDGKPVSDFDLIDHFIARYGINLNRAVMAMDSVKLANML
3e0sB           ----------------------------------------------------------------------
3e0sA           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
3dtzC           ----------------------------------------------------------------------
3brpB           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2b8kD           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2d5cB           ----------------------------------------------------------------------
2ckzC           ----------------------------------------------------------------------
1ci3M           ----------------------------------------------------------------------
3e7hA           ----------------------------------------------------------------------
3e7hB           ----------------------------------------------------------------------
3csqD           ----------------------------------------------------------------------
2e74C           ----------------------------------------------------------------------
3cuxA           ----------------------------------------------------------------------
3bboX           ----------------------------------------------------------------------
1cfmA           ----------------------------------------------------------------------
3dqyA           ----------------------------------------------------------------------
2cbiA           ----------------------------------------------------------------------
2b0pA           ----------------------------------------------------------------------
2b13A           ----------------------------------------------------------------------
2b44A           ----------------------------------------------------------------------
3csqA           ----------------------------------------------------------------------
3bmaB           ----------------------------------------------------------------------
1e2vA           ----------------------------------------------------------------------
1e2zA           ----------------------------------------------------------------------
2c35A           ----------------------------------------------------------------------
3dsoA           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           TLSGVSVGVDDMTIPDNXXXXXXXXXXXXXQITEQYQSSLITENERYNNIINIWSKTSDEVGASMMDAIS
1ddqD           TTSGITIGIDDAVIPEEKQRYLEEADRKLRQIEQAYEMGFLTDRERYDQVIQLWTETTEKVTQAVFNNFE
2e2hA           LHNGFSTGIGDTIADGPTMREITETIAEAKKVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGR
2e2iA           LHNGFSTGIGDTIADGPTMREITETIAEAKKVTKEAQANLLTAKHGMTLRESFEDNVVRFLNE-----AR
3cqzA           LHNGFSTGIGDTIADGPTMREITETIAEAKKVTKEAQANLLTAKHGMTLRESFEDNVVRFLN-EARDKAG
2a6hD           TTSGITIGIDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFE
3dxjD           TTSGITIGIDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFE
2aukE           ----------------------------------------------------------------------
2eabB           QQTTLPFGNGKITVWGEVSRERVTFNEETLWTGGPGSSTSYNGGNNETKGQNGATLRAL-----------
2a9gB           HGSSTLEGGDVMPIGNG--VVLIGMGERSSRQAIGQVAQSLFAKGAAERVIVAGLPKSRMHLDTVFSFCD
1eexA           CDPNVKRSEIVPLTTAMTPAKIVEVVSHMNVVERTPSQQAHVTNVKDNPVQIAADAAEGAWRGFDEQETT
3e0sB           ----------------------------------------------------------------------
3e0sA           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
3dtzC           ----------------------------------------------------------------------
3brpB           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2b8kD           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2d5cB           ----------------------------------------------------------------------
2ckzC           ----------------------------------------------------------------------
1ci3M           ----------------------------------------------------------------------
3e7hA           ----------------------------------------------------------------------
3e7hB           ----------------------------------------------------------------------
3csqD           ----------------------------------------------------------------------
2e74C           ----------------------------------------------------------------------
3cuxA           ----------------------------------------------------------------------
3bboX           ----------------------------------------------------------------------
1cfmA           ----------------------------------------------------------------------
3dqyA           ----------------------------------------------------------------------
2cbiA           ----------------------------------------------------------------------
2b0pA           ----------------------------------------------------------------------
2b13A           ----------------------------------------------------------------------
2b44A           ----------------------------------------------------------------------
3csqA           ----------------------------------------------------------------------
3bmaB           ----------------------------------------------------------------------
1e2vA           ----------------------------------------------------------------------
1e2zA           ----------------------------------------------------------------------
2c35A           ----------------------------------------------------------------------
3dsoA           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           KDTVSINGEKKEIESFNSVYMMAKSGARGSYNQMRQLAGMRGLMAKPDGTMIETAITANFREGLSVLQYF
1ddqD           ENY-----------PFNPLYVMAQSGARGNPQQIRQLCGMRGLMQKPSGETFEVPVRSSFREGLTVLEYF
2e2hA           L-------AEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVAFGFVDRTFVENSYLRGLTPQEFF
2e2iA           DKAGRLA--EVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVAFGFVDRTLVENSYLRGLTPQEFF
3cqzA           RLA------EVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVAFGFVDRTFVENSYLRGLTPQEFF
2a6hD           EN-----------YPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYF
3dxjD           EN-----------YPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYF
2aukE           ----------------------------------------------------------------------
2eabB           ---------------NKQLANGAETVNPGNLTGGENAAEQGNYLNWGDIYLDKADVTFKHDGVTYTREYF
2a9gB           RD--------------LVTVFPEVVKEIVPFSLRPDPSSPYGMNIRREEKTFLEVVAESLGLKKLRV---
1eexA           V--------AVARYAPFNAIALLVGSQVGRPGVLTQCSLEEATELKLGMLGHTCYLASSYASRGLKMRFT
3e0sB           ----------------------------------------------------------------------
3e0sA           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
3dtzC           ----------------------------------------------------------------------
3brpB           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2b8kD           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2d5cB           ----------------------------------------------------------------------
2ckzC           ----------------------------------------------------------------------
1ci3M           ----------------------------------------------------------------------
3e7hA           ----------------------------------------------------------------------
3e7hB           ----------------------------------------------------------------------
3csqD           ----------------------------------------------------------------------
2e74C           ----------------------------------------------------------------------
3cuxA           ----------------------------------------------------------------------
3bboX           ----------------------------------------------------------------------
1cfmA           ----------------------------------------------------------------------
3dqyA           ----------------------------------------------------------------------
2cbiA           ----------------------------------------------------------------------
2b0pA           ----------------------------------------------------------------------
2b13A           ----------------------------------------------------------------------
2b44A           ----------------------------------------------------------------------
3csqA           ----------------------------------------------------------------------
3bmaB           ----------------------------------------------------------------------
1e2vA           ----------------------------------------------------------------------
1e2zA           ----------------------------------------------------------------------
2c35A           ----------------------------------------------------------------------
3dsoA           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           TSTHGARKGLADTALKTANAGYLTRRLVDVAQDLVVIEEDCGTDDGLMFSAIVEDGEVKVPLVERALGRT
1ddqD           ISSHGARKGGADTALRTADSGYLTRKLVDVAHEIVVREADCGTTKYISV-PLFQMDEVTRTLRLRKYGRV
2e2hA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIEDGMDAAHIEKQSLDTI
2e2iA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIEDGMDAAHIEKQSLDTI
3cqzA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIEDGMDAAHIEKQSLDTI
2a6hD           ISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLF-QPDEVTRSLRLRKRADI
3dxjD           ISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLF-QPDEVTRSLRLRKRADI
2aukE           ----------------------------------------------------------------------
2eabB           ---ASNPDNVMVARLTASKAGKLNFNVSMPTNTNYSKTGETTTVDTLTVKGALGNNGLLYNSQIKVVLDG
2a9gB           VETGAAEREQWDDG--------------------------------------------------------
1eexA           SGSGSEVQ--MGYAEGKS-MLYLEARCIYITKAAGVQGLQNGSV--------------------------
3e0sB           ----------------------------------------------------------------------
3e0sA           ----------------------------------------------------------------------
2aujD           ---------LTDEEYRELRYGKQETYPLPAGVDALVKDGEEVVKGQELAPGVVSRMDGVAKERAALRIPL
2ab4A           ----------------------------------------------------------------------
3dtzC           ----------------------------------------------------------------------
3brpB           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2b8kD           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2d5cB           ----------------------------------------------------------------------
2ckzC           ----------------------------------------------------------------------
1ci3M           ----------------------------------------------------------------------
3e7hA           --------------------GETATFDIEADGK-VYVEKGRRVTARHIRQLEKDGVNFIEVPVEYIVGKV
3e7hB           --------------------GETATFDIEADGKVYVEKGRRVTARHIR-QLEKDGVNFIEVPVEYIVGKV
3csqD           ----------------------------------------------------------------------
2e74C           ----------------------------------------------------------------------
3cuxA           ----------------------------------------------------------------------
3bboX           ----------------------------------------------------------------------
1cfmA           ----------------------------------------------------------------------
3dqyA           ----------------------------------------------------------------------
2cbiA           ----------------------------------------------------------------------
2b0pA           ----------------------------------------------------------------------
2b13A           ----------------------------------------------------------------------
2b44A           ----------------------------------------------------------------------
3csqA           ----------------------------------------------------------------------
3bmaB           ----------------------------------------------------------------------
1e2vA           ----------------------------------------------------------------------
1e2zA           ----------------------------------------------------------------------
2c35A           ----------------------------------------------------------------------
3dsoA           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           LAADVVTEKGVVLLEAGTXXXXXXXXXXXXXGIDMIKVRSPITCKTRRGLCAKCYGRDLARERQVNVGES
1ddqD           LAREV--EALGRRLEEGREDVHFLIKAAEAGEVREVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEA
2e2hA           GGSDAAFEKRRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVD-----GEA
2e2iA           GGSDAAFEKRVDLLNTDHTLDPSLLESGSEILGDLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNIRRI
3cqzA           GGSDAAFEKRVDLLNTDH-TLDPSLLESGSEILGDLKLQVLLDEKDRKFLREVFVDGEANWPLPVNIRRI
2a6hD           EAGLYVLAREVEVLYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEA
3dxjD           EAGLYVLAREVEVLYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEA
2aukE           ----------------------------------------------------------------------
2eabB           TLSEGSDGASLKVSDAKKQKYPSYRTGETAAEVNTRVAKVVQDAANKGYTAVKKAHIDDHSAIYDRVKID
2a9gB           ----------------------------------------------------------------------
1eexA           ----------------------------------------------------------------------
3e0sB           ----------------------------------------------------------------------
3e0sA           ----------------------------------------------------------------------
2aujD           SWVEKEAYRPGEVLAELSEPYLFRAEESGVVELKDLAEGHLIYLRQEEEVVARYFLP---AGMTPLVVEG
2ab4A           ----------------------------------------------------------------------
3dtzC           ----------------------------------------------------------------------
3brpB           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2b8kD           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2d5cB           ----------------------------------------------------------------------
2ckzC           ----------------------------------------------------------------------
1ci3M           ----------------------------------------------------------------------
3e7hA           SAKDYVNEAGELIITANQ----------------------------------------------------
3e7hB           SAKDYVNEAGELIITANQ----------------------------------------------------
3csqD           ----------------------------------------------------------------------
2e74C           ----------------------------------------------------------------------
3cuxA           ----------------------------------------------------------------------
3bboX           ----------------------------------------------------------------------
1cfmA           ----------------------------------------------------------------------
3dqyA           ----------------------------------------------------------------------
2cbiA           ----------------------------------------------------------------------
2b0pA           ----------------------------------------------------------------------
2b13A           ----------------------------------------------------------------------
2b44A           ----------------------------------------------------------------------
3csqA           ----------------------------------------------------------------------
3bmaB           ----------------------------------------------------------------------
1e2vA           ----------------------------------------------------------------------
1e2zA           ----------------------------------------------------------------------
2c35A           ----------------------------------------------------------------------
3dsoA           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           VGVIAAQSIGEPGTQLTMRTFHTGGAASLGITVSDIKVKTAGKIKFKNIRTVTNKEGQEIVISRAGEIIV
1ddqD           VGVVAAESIGEPGTQLTMRTFHTGGAVGTDITQGLPRVIELFEARRPKAKAVSEIDGVVRIEEGEDRLSV
2e2hA           NWPLPVNIRRIIQNAQQTFHIDHTKPSDLEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQAFDWV
2e2iA           IQNAQQTFHIDHTKPLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQ--EYRLTKQAFDWV
3cqzA           IQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRRLATRRVLQEYRLTKQAFDWV
2a6hD           VGIVAAQSIGEPGTQLTMRDITQGLPRVIELFEARRPKAKAVISEIDGVVRIEE---------TEEKLSV
3dxjD           VGIVAAQSIGEPGTQLTMRTFHTGGVAG-AADITQGLPRVIELFEARRPKVISEIDGVVRIEETEEKLSV
2aukE           --------------------------SHMAAAESSIQVKNKGSIKLSNVKSVVNSSGKLVITSRNTELKL
2eabB           LGQSGHSSDGAVATDALLKAYQ------------------------------------------------
2a9gB           ----------------------------------------------------------------------
1eexA           ----------------------------------------------------------------------
3e0sB           ----------------------------------------------------------------------
3e0sA           ----------------------------------------------------------------------
2aujD           EIVEVGQPLAEGKGLLRLPRHMTAKEVEAEEEGDSVHLTLFLEWTEPKDYKVAPHMNVIVPEGAKVQALH
2ab4A           ----------------------------------------------------------------------
3dtzC           ----------------------------------------------------------------------
3brpB           ----------------------------------------------------------------------
2aukB           ---------------------------------SSIQVKNKGSIKLSNVKSVVNSSGKLVITSRNTELKL
2aukA           ---------------------------------SSIQVKNKGSIKLSNVKSVVNSSGKLVITSRNTELKL
2b8kD           ----------------------------------------------------------------------
2aukC           -----------------------------------IQVKNKGSIKLSNVKSVVNSSGKLVITSRNTELKL
2d5cB           ----------------------------------------------------------------------
2ckzC           ----------------------------------------------------------------------
1ci3M           -------------------------------------REATGRIVCANAAKPAEIEVPQAVLPKIPYDHS
3e7hA           ----------------------------------------------------------------------
3e7hB           ----------------------------------------------------------------------
3csqD           ----------------------------------------------------------------------
2e74C           ----------------------------------------------------------------------
3cuxA           ----------------------------------------------------------------------
3bboX           ----------------------------------------------------------------------
1cfmA           ----------------------------------------------------------------------
3dqyA           ----------------------------------------------------------------------
2cbiA           ----------------------------------------------------------------------
2b0pA           ----------------------------------------------------------------------
2b13A           ----------------------------------------------------------------------
2b44A           ----------------------------------------------------------------------
3csqA           ----------------------------------------------------------------------
3bmaB           ----------------------------------------------------------------------
1e2vA           ----------------------------------------------------------------------
1e2zA           ----------------------------------------------------------------------
2c35A           ----------------------------------------------------------------------
3dsoA           -----------------------------------------------VVKTYDLQDGSKVHVFKDGKMGM
2aukE           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           SDTMGRVREQHKIPMGAVVPLASGKAVEIGDVIATWDPHAQPLITDVAGKVVLEDVIDGITSKHTYDDLT
1ddqD           FVESEGFSKEYKLPKDARLLVKDGDYVEAGQPLGAIDPH---QLLEAKGPEAVERYLQGVKLHDKHIEIV
2e2hA           LSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPS
2e2iA           LSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLKKVTSGVPR-------LKEILNVAKNMKTPSLTV
3cqzA           LSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPS
2a6hD           FVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVKLH
3dxjD           FVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVK
2aukE           IDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANWDPHTMPVITEVSGFVRFTDMIDGQTITRQTDELT
2eabB           ----------------------------------------------------------------------
2a9gB           ----------------------------------------------------------------------
1eexA           ----------------------------------------------------------------------
3e0sB           ----------------------------------------------------------------------
3e0sA           ----------------------------------------------------------------------
2aujD           EPASILVVKARVYPFEDDVEVTTGDRVAPGDVLAGKVKS-------------------------------
2ab4A           ----------------------------------------------------------------------
3dtzC           ----------------------------------------------------------------------
3brpB           ----------------------------------------------------------------------
2aukB           IDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANWDPHTMPVITEVSGFVRFTDMIDGQTITRQTDELT
2aukA           IDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANWDPHTMPVITEVSGFVRFTDMIDGQTITRQTDELT
2b8kD           ----------------------------------------------------------------------
2aukC           IDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANWDPHTMPVITEVSGFVRFTDMIDGQTITRQTDELT
2d5cB           ----------------------------------------------------------------------
2ckzC           ----------------------------------------------------------------------
1ci3M           VQQVQADGSKGPLNVGAVLM------LPEGFTIAPEDRIPEEMKEEVGPSYLFQPYADDKQNIVLVGPLP
3e7hA           ----------------------------------------------------------------------
3e7hB           ----------------------------------------------------------------------
3csqD           ----------------------------------------------------------------------
2e74C           ------------------------------PAEVEVPQSVLPDTVKAVVKIPYDTKLQQVAADGSKVGLN
3cuxA           ----------------------------------------------------------------------
3bboX           ----------------------------------------------------------------------
1cfmA           -------------PVFAQQNYANPREANGRIVCANCHLAQKAVEIEVPQAVLPDTVFEAVIELPYDKQVK
3dqyA           ----------------------------------------------------------------------
2cbiA           ----------------------------------------------------------------------
2b0pA           ----------------------------------------------------------------------
2b13A           ----------------------------------------------------------------------
2b44A           ----------------------------------------------------------------------
3csqA           ----------------------------------------------------------------------
3bmaB           ----------------------------------------------------------------------
1e2vA           ----------------------------------------------------------------------
1e2zA           ----------------------------------------------------------------------
2c35A           ----------------------------------------------------------------------
3dsoA           ENKFG---KSMNMPEGKVMETRDGKIIMKGNEIFRLD---------------------------------
2aukE           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           GQQTIEITSISQRTTSKNLKPVVKIVDEKGAKLKSIPLAVGAVLNVADDSILEVGDIVAKIPLEGSKNKD
1ddqD           VRQMLKYVEVT-----------------------------------------------------------
2e2hA           LTVYLEPGHAADQEQAKLIRSAIEHTTLKSDPDPRSTVIPEDEEIIQLHFSLQQSPWLLRLELDRAAMND
2e2iA           YLEPGHAADQAKLIRSAIEHTTLKSVTIASEIYYDPDVIPEDEEIIQLHFSLQQSPWLLRLELDRAAMND
3cqzA           LTVYLEPTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLRLELDRAAMNDKDLTMGQVGERIKQTFKNDLF
2a6hD           D-KHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKS
3dxjD           LHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKS
2aukE           GLSSLVVLDSAERTAGKDLRPALKIVDAQGNDVLQYFLPGKAIVQLEDGVQISSGDTLARIPQE------
2eabB           ----------------------------------------------------------------------
2a9gB           ----------------------------------------------------------------------
1eexA           ----------------------------------------------------------------------
3e0sB           ----------------------------------------------------------------------
3e0sA           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
3dtzC           ----------------------------------------------------------------------
3brpB           ----------------------------------------------------------------------
2aukB           GSSLVVLDSAERTAGGKDLRPALKIVDAQGNDVLQYFLPGKAIVQLEDGVQISSGDTLARIPQE------
2aukA           GLSSLVVLDSAERTGGKDLRPALKIVDAQGNDVLQYFLPGKAIVQLEDGVQISSGDTLARIPQE------
2b8kD           ----------------------------------------------------------------------
2aukC           GLSSLVVLDSERTAGGKDLRPALKIVDAQGNDVLQYFLPGKAIVQLEDGVQISSGDTLARIPQE------
2d5cB           ----------------------------------------------------------------------
2ckzC           ----------------------------------------------------------------------
1ci3M           G------------------DEYEEIVFPVLSPN------PATNKSVAFGKYSHLGANR------------
3e7hA           ----------------------------------------------------------------------
3e7hB           ----------------------------------------------------------------------
3csqD           ----------------------------------------------------------------------
2e74C           VGAVLMLPEGFKIAPEERIPEELKKEVGDVYFQPYVGPLPGEQYQEIVFPVLSPNPTTDKNIHFGKYAIH
3cuxA           ----------------------------------------------------------------------
3bboX           -------------------------------------PGQRLGVKIYGDQVAKPGAI------------I
1cfmA           QVLANGKKGDLNVGMVLILPEGFELAPPDRVIKEKVGNLYYQPYSPEQKNILVVGPVPGKNVSYLKYPIY
3dqyA           ----------------------------------------------------------------------
2cbiA           ----------------------------------------------------------------------
2b0pA           ----------------------------------------------------------------------
2b13A           ----------------------------------------------------------------------
2b44A           ----------------------------------------------------------------------
3csqA           ----------------------------------------------------------------------
3bmaB           ----------------------------------------------------------------------
1e2vA           ----------------------------------------------------------------------
1e2zA           ----------------------------------------------------------------------
2c35A           ----------------------------------------------------------------------
3dsoA           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           ITGGLPRVAELFEARRPKDAAILSPCDGMVRLGNRDTKEKQRIEIIDKNGHIVEEILLPKSRHLVVFDGE
1ddqD           ----------------------------------------------------------------------
2e2hA           KDLTMGQVGERIKQTFKNDLFVIWSEDLIIRCRVRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETD
2e2iA           KDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETD
3cqzA           VEDNDEKLIIRCRVVEAEEDHMLKKIENTMLENLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETD
2a6hD           WLSAANTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEA-
3dxjD           WLSAASTTHVLTEAAIAGKKDELIGLKENVILG-RLIPASDFVRFTQVVDQKTLKAIEEARKE--AVEA-
2aukE           ----------------------------------------------------------------------
2eabB           ----------------------------------------------------------------------
2a9gB           ----------------------------------------------------------------------
1eexA           ----------------------------------------------------------------------
3e0sB           ----------------------------------------------------------------------
3e0sA           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
3dtzC           ----------------------------------------------------------------------
3brpB           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2b8kD           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2d5cB           ----------------------------------------------------------------------
2ckzC           ----------------------------------------------------------------------
1ci3M           -----GRGQIYPTGEKSNNAVYNASAAGVITAIAKADDGSAEVKIRTEDGTTIVD-KIPAGPELIVSEGE
3e7hA           ----------------------------------------------------------------------
3e7hB           ----------------------------------------------------------------------
3csqD           -------------VGKTEKYPYYAPCDCTCVWRGDALAWTSDKEVMCADGVRYITWVNVHESPLPFDVGK
2e74C           LGANRGRGQIYPTGEKSNNNVFTASATGTITEDEYGNVKYQVSIQTDSGKTVVDTI--PAGPELIVSEGQ
3cuxA           ----------------------------------------------------------------------
3bboX           VRQRGTKFHAGKNVGIGKDHTIFSLIDGLVKFE-KFGPDRKKISVYPREI--------------------
1cfmA           FGGNRGRGQVYPDGKKSNNTIYNASAAGKIVAALSEKKGGFEVSIEKANGEVVVD-KIPAGPDLIVKEGQ
3dqyA           ----------------------------------------------------------------------
2cbiA           ----------------------------------------------------------------------
2b0pA           ------------DYAMPENSPVYSLTDGTVVQAGWSNYGGGNQVTIKEANSNNYQ-WYMHNNRLTVSAGD
2b13A           --------------AMPENSPVYSLTDGTVVQAGWSNYGGGNQVTIKEANSNNYQ-WYMHNNRLTVSAGD
2b44A           --------------AMPENSPVYSLTDGTVVQAGWSNYGGGNQVTIKEANSNNYQ-WYMHNNRLTVSAGD
3csqA           -------------VGKTEKYPYYAPCDCTCVWDASAYLAWTSDKEVMCADGSVRYIVNVHESPLPFDVGK
3bmaB           ----------------------------------------------------------------------
1e2vA           ---QRGRGQVYPDGKKSNNTIYNASAAGKIVAALSEKKGGFEVSIEKANGEVVVD-KIPAGPDLIVKEGQ
1e2zA           -----------PDGKKSNNTIYNASAAGKIVAALSEKKGGFEVSIEKANGEVVVD-KIPAGPDLIVKEGQ
2c35A           ----------------------------------------------------------------------
3dsoA           ----------------------------------------------------------------------
2aukE           ------------------------------------------LKLIDEFGRTKESYKVPYGAVLAKGDGE
2aujD           ------------------------------------------LHEPASILVVKARVYPFEDDVEV-TTGD
2aukA           -------------HMAAAESSIQVKNKGSIKLSNVKSNSSGKLVITSRNTELKLIDEVPYGAVLAKGDGE
2aukC           ------------------ESSIQVKNKGSIKLSNVKSNSSGKLVITSRNTELKLIDEVPYGAVLAKGDGE


                         *         .         .         .         .         +         .:1260
query           QVSRGDVLADGPTDPHDLLKYKGLEEFADYILIEAQSVYRMQGVVINDKHIETIVRQMLRKAVILDEGDS
1ddqD           ----------------------------------------------------------------------
2e2hA           GVNLSEVMTVPGIDPTRIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTS----
2e2iA           GVNLSEVMTVPGNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTS----
3cqzA           GVNLSEVMTVPGIDPIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDV-------------
2a6hD           ----------------------------------------------------------------------
3dxjD           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2eabB           ----------------------------------------------------------------------
2a9gB           ----------------------------------------------------------------------
1eexA           ----------------------------------------------------------------------
3e0sB           ----------------------------------------------------------------------
3e0sA           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
3dtzC           ----------------------------------------------------------------------
3brpB           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2b8kD           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2d5cB           ----------------------------------------------------------------------
2ckzC           ----------------------------------------------------------------------
1ci3M           EVAAGAALTNNP----------------------------------------------------------
3e7hA           ----------------------------------------------------------------------
3e7hB           ----------------------------------------------------------------------
3csqD           KLKKGDLMGHTGIGGGDHWHF------------NVIDGKEYQGWTKKP--DSCLAGTELHIYDVFAVNNV
2e74C           AVKAGEALTNNPNVGQDPNRVKWMIAFQLMLILKKKQVEKVQAAEMN-----------------------
3cuxA           ------------------VTLVGEMAYNEILTPEALSFLKELHENFNERRIELLQKRMKKQQKIDAGEFP
3bboX           ----------------------------------------------------------------------
1cfmA           TVQADQPLTNNP----------------------------------------------------------
3dqyA           ----------------------------------------------------------------------
2cbiA           ----------------------------------------------------------------------
2b0pA           KVKAGDQIAYSGSTG---------NSTAPHVHFQRMSGGIGNQYAVD-----------------------
2b13A           KVKAGDQIAYSGSTG-------------------------------------------------------
2b44A           KVKAGDQIAYSGSTG-------------------------------------------------------
3csqA           KLKKGDLMGHGIGGDHWHFNVIDGKE-YQGWTKKPDSCLAGTELHIYDV-FAVNNVEIINGNGYDW----
3bmaB           ----------------------------------------------------------------------
1e2vA           TVQADQPLTNNP----------------------------------------------------------
1e2zA           TVQADQPLTNNP----------------------------------------------------------
2c35A           ----------------------------------------------------------------------
3dsoA           ----------------------------------------------------------------------
2aukE           QVAGGETVAN--WDPHTMVRFTDMID-GQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKIVDAQG
2aujD           RVAPGDVLADGGKVKSEIY---------------------------------------------------
2aukA           QVAGGETVANWDPHTMPVITEVTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALIVDAQGN
2aukC           QVAGGETVANWDPHTMPVIRFTDMID-GQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALIVDAQGN


                         .         .         .         *         .         .         .:1330
query           KFVKDESIELVRILEENDKLRKQGKKEVEYELVLMGITRSSLSTESFLSAASFQETTRVLTEASINSQID
1ddqD           ----------------------------------------------------------------------
2e2hA           ----------------------------------VTRHGFNRSNTGALMRCSFEETVEILFEAGASAELD
2e2iA           ----------------------------------VTRHGFNRSNTGALMRCSFEETVEILFEAGASAELD
3cqzA           ----------------------------------MTTQGGLTSVTRHGMRCSFEETVEILFEAGASAELD
2a6hD           ----------------------------------------------------------------------
3dxjD           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2eabB           ----------------------------------------------------------------------
2a9gB           ----------------------------------------------------------------------
1eexA           ----------------------------------------------------------------------
3e0sB           ----------------------------------------------------------------------
3e0sA           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
3dtzC           ----------------------------------------------------------------------
3brpB           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2b8kD           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2d5cB           ----------------------------------------------------------------------
2ckzC           ----------------------------------------------------------------------
1ci3M           ----------------------------------------------------------------------
3e7hA           ----------------------------------------------------------------------
3e7hB           ----------------------------------------------------------------------
3csqD           EIINGNGYDWKTSDWQD-----------------------------------------------------
2e74C           ----------------------------------------------------------------------
3cuxA           KFLEEKRIREADWTIAKLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNSPTWENAIEGQIN
3bboX           ----------------------------------------------------------------------
1cfmA           ----------------------------------------------------------------------
3dqyA           ----------------------------------------------------------------------
2cbiA           ----------------------------------------------------------------------
2b0pA           ----------------------------------------------------------------------
2b13A           ----------------------------------------------------------------------
2b44A           ----------------------------------------------------------------------
3csqA           ----------------------------------------------------------------------
3bmaB           ----------------------------------------------------------------------
1e2vA           ----------------------------------------------------------------------
1e2zA           ----------------------------------------------------------------------
2c35A           ----------------------------------------------------------------------
3dsoA           ----------------------------------------------------------------------
2aukE           NDVLIPGTDMPA----------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2aukA           DVLIPGTDMPAQYFLGKAIVQLEDGVQISSGDTLARIPQES-----------------------------
2aukC           DVLIPGTDMPAQYFLGKAIVQLEDGVQISSGDTLARIPQES-----------------------------


                         .         +         .         .         .         .         *:1400
query           NLRGLKENVLIGRLIPTGTGLAVRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ddqD           ----------------------------------------------------------------------
2e2hA           DCRGVSENVILGQMAPIGTGA-------------------------------------------------
2e2iA           DCRGVSENVILGQMAPIGTGA-------------------------------------------------
3cqzA           DCRGVSENVILGQMAPIGTGA-------------------------------------------------
2a6hD           ----------------------------------------------------------------------
3dxjD           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2eabB           ----------------------------------------------------------------------
2a9gB           ----------------------------------------------------------------------
1eexA           ----------------------------------------------------------------------
3e0sB           ----------------------------------------------------------------------
3e0sA           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
3dtzC           ----------------------------------------------------------------------
3brpB           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2b8kD           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2d5cB           ----------------------------------------------------------------------
2ckzC           ----------------------------------------------------------------------
1ci3M           ----------------------------------------------------------------------
3e7hA           ----------------------------------------------------------------------
3e7hB           ----------------------------------------------------------------------
3csqD           ----------------------------------------------------------------------
2e74C           ----------------------------------------------------------------------
3cuxA           LRDAVKGTISHKNENGKEYRLNSK----------------------------------------------
3bboX           ----------------------------------------------------------------------
1cfmA           ----------------------------------------------------------------------
3dqyA           ----------------------------------------------------------------------
2cbiA           ----------------------------------------------------------------------
2b0pA           ----------------------------------------------------------------------
2b13A           ----------------------------------------------------------------------
2b44A           ----------------------------------------------------------------------
3csqA           ----------------------------------------------------------------------
3bmaB           ----------------------------------------------------------------------
1e2vA           ----------------------------------------------------------------------
1e2zA           ----------------------------------------------------------------------
2c35A           ----------------------------------------------------------------------
3dsoA           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2aujD           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           xxxxxxxxxxxxxxxxx
1ddqD           -----------------
2e2hA           -----------------
2e2iA           -----------------
3cqzA           -----------------
2a6hD           -----------------
3dxjD           -----------------
2aukE           -----------------
2eabB           -----------------
2a9gB           -----------------
1eexA           -----------------
3e0sB           -----------------
3e0sA           -----------------
2aujD           -----------------
2ab4A           -----------------
3dtzC           -----------------
3brpB           -----------------
2aukB           -----------------
2aukA           -----------------
2b8kD           -----------------
2aukC           -----------------
2d5cB           -----------------
2ckzC           -----------------
1ci3M           -----------------
3e7hA           -----------------
3e7hB           -----------------
3csqD           -----------------
2e74C           -----------------
3cuxA           -----------------
3bboX           -----------------
1cfmA           -----------------
3dqyA           -----------------
2cbiA           -----------------
2b0pA           -----------------
2b13A           -----------------
2b44A           -----------------
3csqA           -----------------
3bmaB           -----------------
1e2vA           -----------------
1e2zA           -----------------
2c35A           -----------------
3dsoA           -----------------
2aukE           -----------------
2aujD           -----------------
2aukA           -----------------
2aukC           -----------------